F448030

General Info

Members Datasets Scaffolds Average Seq Length
457 331 914 296

Family's Representative Sequence

Representative Sequence 3300041407|Ga0439447_013158|Ga0439447_013158_1255_2295
Length 346
Sequence MPESFPGPLAVRWRRFRAGRFSLLMEGEVIDSLSMGLFFLVRLSIAGAMQEGMMKTVKAGVLEIAYLEIGPVDGAPVVLLHGFPYDVHAYDEVARILASAGKRCLTPYLRGYGPTRFLDEQTMRSGEQAAIGADLLAFLDALKIEKALLAGYDWGGRAACIVAALWPERVSGLVSCGGYSIQNIAEAHQPASPEAEHLLWYQYYLHGSRGRAGLTSNRKDFCRLLWRMWSPTWRFTQEAFETTAAAFENDDFVDVVTHSYRHRFGLVEGDPAYRNIESRLAAQPRIAVPSLVLEGGADAVDPPAEEDPFARHFTGPYRREILEGIGHNVPQEAPGTFADGILSLGG

Samples

Sample ID Description Type Environment
1 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
291 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
292 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
297 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
298 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
299 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
300 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
301 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
302 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
303 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
304 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
305 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
306 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
307 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
308 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
309 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
310 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
311 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
312 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
313 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
314 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
315 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
316 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
317 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
318 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
319 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
320 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
321 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
322 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
323 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
324 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
325 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
326 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
327 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
328 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
329 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
330 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
331 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 0
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0
Rhizoplane 6.78
Rhizosphere 80.96
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439447_013158 3300041407 Bacteria 2354
2 MRS1b_contig_2248537 2162886011 Bacteria 6522
3 JGI24742J22300_10022576 3300002244 Bacteria 1079
4 JGI25162J39368_1000081 3300002737 Bacteria 113016
5 JGI25163J39215_1000016 3300002771 Bacteria 82638
6 JGI25164J39214_1000060 3300002772 Bacteria 110667
7 JGI25151J46595_10001299 3300003187 Bacteria 17505
8 JGI25151J46595_10006332 3300003187 Bacteria 5964
9 JGI25165J46597_1000153 3300003214 Bacteria 113016
10 JGI25405J52794_10002968 3300003911 Bacteria 2948
11 Ga0065714_10002262 3300005288 Bacteria 35666
12 Ga0065714_10004999 3300005288 Bacteria 6542
13 Ga0065712_10068085 3300005290 Bacteria 15225
14 Ga0070658_10001588 3300005327 Bacteria 19209
15 Ga0070676_10000290 3300005328 Bacteria 22266
16 Ga0070683_100001772 3300005329 Bacteria 16802
17 Ga0070690_100155005 3300005330 Bacteria 1565
18 Ga0070670_100000416 3300005331 Bacteria 35091
19 Ga0070670_100071138 3300005331 Bacteria 2986
20 Ga0070677_10003248 3300005333 Bacteria 5236
21 Ga0068869_100001632 3300005334 Bacteria 13367
22 Ga0070680_100128895 3300005336 Bacteria 2115
23 Ga0068868_100038076 3300005338 Bacteria 3732
24 Ga0070660_100000052 3300005339 Bacteria 68022
25 Ga0070689_100001678 3300005340 Bacteria 14140
26 Ga0070687_100000134 3300005343 Bacteria 25638
27 Ga0070661_100007867 3300005344 Bacteria 7359
28 Ga0070661_100248960 3300005344 Bacteria 1371
29 Ga0070692_10015776 3300005345 Bacteria 3580
30 Ga0070669_100065038 3300005353 Bacteria 2686
31 Ga0070675_100002647 3300005354 Bacteria 13454
32 Ga0070671_100006839 3300005355 Bacteria 9128
33 Ga0070674_100002955 3300005356 Bacteria 9429
34 Ga0070688_100000725 3300005365 Bacteria 16228
35 Ga0070659_100000813 3300005366 Bacteria 22774
36 Ga0070667_100147225 3300005367 Bacteria 2066
37 Ga0070714_100172911 3300005435 Bacteria 1961
38 Ga0070713_100242713 3300005436 Bacteria 1641
39 Ga0070710_10103857 3300005437 Bacteria 1697
40 Ga0070701_10031866 3300005438 Bacteria 2619
41 Ga0070711_100014026 3300005439 Bacteria 5042
42 Ga0070711_100077928 3300005439 Bacteria 2353
43 Ga0070705_100011223 3300005440 Bacteria 4513
44 Ga0070708_100012168 3300005445 Bacteria 7014
45 Ga0070663_100000805 3300005455 Bacteria 17079
46 Ga0070663_100234191 3300005455 Bacteria 1447
47 Ga0070678_100007114 3300005456 Bacteria 6619
48 Ga0070662_100000701 3300005457 Bacteria 20526
49 Ga0070685_10000949 3300005466 Bacteria 15589
50 Ga0070706_100060343 3300005467 Bacteria 3501
51 Ga0070706_100066157 3300005467 Bacteria 3343
52 Ga0070707_100001008 3300005468 Bacteria 27893
53 Ga0070707_100128149 3300005468 Bacteria 2466
54 Ga0070707_100192068 3300005468 Bacteria 1991
55 Ga0070698_100005483 3300005471 Bacteria 13852
56 Ga0070698_100171866 3300005471 Unclassified 2108
57 Ga0070684_100002455 3300005535 Bacteria 13652
58 Ga0070697_100083531 3300005536 Bacteria 2634
59 Ga0070697_100176231 3300005536 Bacteria 1811
60 Ga0070697_100196606 3300005536 Bacteria 1713
61 Ga0068853_100000288 3300005539 Bacteria 35623
62 Ga0070672_100001812 3300005543 Bacteria 13346
63 Ga0070686_100010839 3300005544 Bacteria 5155
64 Ga0070695_100009656 3300005545 Bacteria 5746
65 Ga0070696_100007067 3300005546 Bacteria 7496
66 Ga0068855_100000202 3300005563 Bacteria 76682
67 Ga0070664_100000880 3300005564 Bacteria 23311
68 Ga0068857_100007319 3300005577 Bacteria 9508
69 Ga0068857_100494925 3300005577 Bacteria 1147
70 Ga0068854_100000406 3300005578 Bacteria 27042
71 Ga0068854_100188563 3300005578 Bacteria 1615
72 Ga0068856_100003305 3300005614 Bacteria 16389
73 Ga0068852_100001778 3300005616 Bacteria 14653
74 Ga0068859_100609995 3300005617 Unclassified 1184
75 Ga0068866_10000446 3300005718 Bacteria 19086
76 Ga0068861_100005061 3300005719 Bacteria 8894
77 Ga0068851_10000065 3300005834 Bacteria 58958
78 Ga0068870_10000197 3300005840 Bacteria 21559
79 Ga0068863_100030495 3300005841 Bacteria 5148
80 Ga0068858_100288631 3300005842 Bacteria 1563
81 Ga0068860_100507068 3300005843 Bacteria 1205
82 Ga0068862_100082740 3300005844 Bacteria 2786
83 Ga0081455_10110772 3300005937 Bacteria 2182
84 Ga0081538_10046818 3300005981 Bacteria 2661
85 Ga0081540_1001798 3300005983 Bacteria 17972
86 Ga0081539_10004590 3300005985 Bacteria 15078
87 Ga0070717_10284254 3300006028 Bacteria 1468
88 Ga0070717_10616999 3300006028 Bacteria 984
89 Ga0070712_100002146 3300006175 Bacteria 12130
90 Ga0070712_100263572 3300006175 Bacteria 1382
91 Ga0070712_100300268 3300006175 Bacteria 1299
92 Ga0075367_10263020 3300006178 Bacteria 1083
93 Ga0097621_100000918 3300006237 Bacteria 20604
94 Ga0075370_10021067 3300006353 Bacteria 3570
95 Ga0075370_10024243 3300006353 Bacteria 3350
96 Ga0068871_100001441 3300006358 Bacteria 15931
97 Ga0075428_100097377 3300006844 Unclassified 3207
98 Ga0075428_100168635 3300006844 Bacteria 2374
99 Ga0075428_100259600 3300006844 Bacteria 1871
100 Ga0075428_100444670 3300006844 Bacteria 1388
101 Ga0075431_100056035 3300006847 Bacteria 4066
102 Ga0075433_10007389 3300006852 Bacteria 8721
103 Ga0075434_100017537 3300006871 Bacteria 6901
104 Ga0075434_100109807 3300006871 Bacteria 2768
105 Ga0075434_100147280 3300006871 Bacteria 2375
106 Ga0075429_100005732 3300006880 Bacteria 10717
107 Ga0075429_100011692 3300006880 Bacteria 7611
108 Ga0075429_100031959 3300006880 Bacteria 4576
109 Ga0075436_100047351 3300006914 Bacteria 2966
110 Ga0097620_100610023 3300006931 Unclassified 1184
111 Ga0075435_100016670 3300007076 Bacteria 5541
112 Ga0075435_100019967 3300007076 Bacteria 5122
113 Ga0105251_10014606 3300009011 Bacteria 4330
114 Ga0105244_10001757 3300009036 Bacteria 17030
115 Ga0105244_10044419 3300009036 Bacteria 2289
116 Ga0105240_10003064 3300009093 Bacteria 26280
117 Ga0111539_10014556 3300009094 Bacteria 9822
118 Ga0111539_10015198 3300009094 Bacteria 9589
119 Ga0111539_10019377 3300009094 Bacteria 8399
120 Ga0105245_10003480 3300009098 Bacteria 14099
121 Ga0105247_10000835 3300009101 Bacteria 23400
122 Ga0114129_10046663 3300009147 Bacteria 6088
123 Ga0114129_10260107 3300009147 Unclassified 2326
124 Ga0114129_10287093 3300009147 Bacteria 2197
125 Ga0114129_10344929 3300009147 Unclassified 1974
126 Ga0105243_10000310 3300009148 Bacteria 53933
127 Ga0105243_10003726 3300009148 Bacteria 12228
128 Ga0105243_10004796 3300009148 Bacteria 10628
129 Ga0105243_10043712 3300009148 Bacteria 3511
130 Ga0105241_10000829 3300009174 Bacteria 23452
131 Ga0105242_10001542 3300009176 Bacteria 18118
132 Ga0105248_10014172 3300009177 Bacteria 8776
133 Ga0105237_10000190 3300009545 Bacteria 87182
134 Ga0105238_10003095 3300009551 Bacteria 16587
135 Ga0105238_10105833 3300009551 Bacteria 2795
136 Ga0105238_10271615 3300009551 Bacteria 1676
137 Ga0105249_10000986 3300009553 Bacteria 25228
138 Ga0105249_10161751 3300009553 Bacteria 2164
139 Ga0105239_10003835 3300010375 Bacteria 18255
140 Ga0105246_10012204 3300011119 Bacteria 5354
141 Ga0105246_10171990 3300011119 Bacteria 1660
142 Ga0157373_10006961 3300013100 Bacteria 8421
143 Ga0157371_10000264 3300013102 Bacteria 71499
144 Ga0157371_10004934 3300013102 Bacteria 11461
145 Ga0157371_10203782 3300013102 Bacteria 1419
146 Ga0157369_10000161 3300013105 Bacteria 94988
147 Ga0157374_10002380 3300013296 Bacteria 15849
148 Ga0157378_10010750 3300013297 Bacteria 8001
149 Ga0163162_10007385 3300013306 Bacteria 10687
150 Ga0163162_10144033 3300013306 Bacteria 2498
151 Ga0163162_10184906 3300013306 Bacteria 2210
152 Ga0157372_10007592 3300013307 Bacteria 11528
153 Ga0157375_10004227 3300013308 Bacteria 12449
154 Ga0157375_10200441 3300013308 Bacteria 2152
155 Ga0163163_10061450 3300014325 Bacteria 3722
156 Ga0163163_10406509 3300014325 Bacteria 1420
157 Ga0182008_10000050 3300014497 Bacteria 103527
158 Ga0182008_10003128 3300014497 Bacteria 10127
159 Ga0182008_10024635 3300014497 Bacteria 3062
160 Ga0157377_10000141 3300014745 Bacteria 45798
161 Ga0157379_10000079 3300014968 Bacteria 63166
162 Ga0157376_10001389 3300014969 Bacteria 15949
163 Ga0182006_1002944 3300015261 Bacteria 9007
164 Ga0182007_10000383 3300015262 Bacteria 27816
165 Ga0213876_10020279 3300021384 Bacteria 3513
166 Ga0213876_10039609 3300021384 Bacteria 2490
167 Ga0213876_10039761 3300021384 Bacteria 2485
168 Ga0209760_100041 3300025207 Bacteria 115995
169 Ga0207427_100104 3300025231 Bacteria 119099
170 Ga0209437_100348 3300025233 Bacteria 54213
171 Ga0209148_1000377 3300025254 Bacteria 54144
172 Ga0209129_1004420 3300025258 Bacteria 5486
173 Ga0209233_1000202 3300025261 Bacteria 119099
174 Ga0209455_1000299 3300025272 Bacteria 51077
175 Ga0209025_1000244 3300025294 Bacteria 127938
176 Ga0209025_1001083 3300025294 Bacteria 39415
177 Ga0207426_1060307 3300025302 Bacteria 1093
178 Ga0207697_10058552 3300025315 Bacteria 1600
179 Ga0207656_10001575 3300025321 Bacteria 7584
180 Ga0207655_1000285 3300025728 Bacteria 77315
181 Ga0207655_1001301 3300025728 Bacteria 23616
182 Ga0207655_1009652 3300025728 Bacteria 5967
183 Ga0207713_1028623 3300025735 Bacteria 2509
184 Ga0207682_10000319 3300025893 Bacteria 21917
185 Ga0207710_10005587 3300025900 Bacteria 5410
186 Ga0207688_10000015 3300025901 Bacteria 57722
187 Ga0207680_10002258 3300025903 Bacteria 8988
188 Ga0207647_10004455 3300025904 Bacteria 10380
189 Ga0207699_10206421 3300025906 Bacteria 1334
190 Ga0207645_10000025 3300025907 Bacteria 98264
191 Ga0207643_10000023 3300025908 Bacteria 104515
192 Ga0207705_10019245 3300025909 Bacteria 4883
193 Ga0207684_10011436 3300025910 Bacteria 7764
194 Ga0207684_10047516 3300025910 Bacteria 3640
195 Ga0207654_10005498 3300025911 Bacteria 6411
196 Ga0207695_10017104 3300025913 Bacteria 8455
197 Ga0207671_10045493 3300025914 Bacteria 3246
198 Ga0207693_10002609 3300025915 Bacteria 15668
199 Ga0207693_10106776 3300025915 Bacteria 2196
200 Ga0207693_10470289 3300025915 Bacteria 982
201 Ga0207663_10005937 3300025916 Bacteria 6198
202 Ga0207660_10041423 3300025917 Bacteria 3227
203 Ga0207662_10000346 3300025918 Bacteria 20992
204 Ga0207657_10000067 3300025919 Bacteria 97934
205 Ga0207657_10137903 3300025919 Bacteria 1995
206 Ga0207649_10004571 3300025920 Bacteria 7508
207 Ga0207649_10210596 3300025920 Bacteria 1379
208 Ga0207646_10001835 3300025922 Bacteria 25670
209 Ga0207646_10006933 3300025922 Bacteria 11629
210 Ga0207646_10448973 3300025922 Bacteria 1163
211 Ga0207681_10004137 3300025923 Bacteria 8998
212 Ga0207694_10003230 3300025924 Bacteria 12989
213 Ga0207650_10000147 3300025925 Bacteria 85501
214 Ga0207650_10001599 3300025925 Bacteria 16169
215 Ga0207659_10003682 3300025926 Bacteria 9240
216 Ga0207687_10002309 3300025927 Bacteria 12983
217 Ga0207644_10001339 3300025931 Bacteria 15822
218 Ga0207706_10000119 3300025933 Bacteria 84681
219 Ga0207709_10000280 3300025935 Bacteria 58638
220 Ga0207709_10001108 3300025935 Bacteria 19734
221 Ga0207709_10019553 3300025935 Bacteria 3811
222 Ga0207709_10025878 3300025935 Bacteria 3364
223 Ga0207670_10000100 3300025936 Bacteria 59919
224 Ga0207669_10006044 3300025937 Bacteria 5494
225 Ga0207704_10003255 3300025938 Bacteria 7366
226 Ga0207665_10057232 3300025939 Bacteria 2633
227 Ga0207691_10000079 3300025940 Bacteria 82300
228 Ga0207711_10000189 3300025941 Bacteria 65922
229 Ga0207689_10001164 3300025942 Bacteria 25319
230 Ga0207661_10003663 3300025944 Bacteria 10706
231 Ga0207679_10000531 3300025945 Bacteria 25768
232 Ga0207679_10001426 3300025945 Bacteria 15043
233 Ga0207667_10113926 3300025949 Bacteria 2788
234 Ga0207651_10002161 3300025960 Bacteria 9301
235 Ga0207651_10279801 3300025960 Bacteria 1378
236 Ga0207712_10000157 3300025961 Bacteria 70058
237 Ga0207712_10048663 3300025961 Bacteria 2950
238 Ga0207668_10004328 3300025972 Bacteria 8336
239 Ga0207658_10000885 3300025986 Bacteria 24958
240 Ga0207677_10000113 3300026023 Bacteria 65880
241 Ga0207703_10002397 3300026035 Bacteria 16297
242 Ga0207639_10093313 3300026041 Bacteria 2414
243 Ga0207639_10095516 3300026041 Bacteria 2389
244 Ga0207678_10004616 3300026067 Bacteria 12376
245 Ga0207678_10223987 3300026067 Bacteria 1610
246 Ga0207708_10052922 3300026075 Bacteria 3092
247 Ga0207702_10030569 3300026078 Bacteria 4487
248 Ga0207641_10009975 3300026088 Bacteria 7815
249 Ga0207648_10000095 3300026089 Bacteria 84340
250 Ga0207676_10005002 3300026095 Bacteria 9387
251 Ga0207674_10001904 3300026116 Bacteria 26535
252 Ga0207674_10123837 3300026116 Bacteria 2551
253 Ga0207675_100001269 3300026118 Bacteria 25244
254 Ga0207683_10000050 3300026121 Bacteria 87435
255 Ga0207698_10007847 3300026142 Bacteria 6712
256 Ga0209970_1006384 3300027614 Bacteria 1933
257 Ga0209983_1000121 3300027665 Bacteria 13836
258 Ga0209971_1000070 3300027682 Bacteria 31653
259 Ga0209966_1000042 3300027695 Bacteria 53500
260 Ga0209998_10000127 3300027717 Bacteria 29842
261 Ga0268266_10000415 3300028379 Bacteria 64982
262 Ga0268266_10087294 3300028379 Bacteria 2729
263 Ga0268265_10005984 3300028380 Bacteria 8278
264 Ga0268265_10006904 3300028380 Bacteria 7680
265 Ga0268264_10001060 3300028381 Bacteria 27306
266 Ga0268264_10503256 3300028381 Bacteria 1182
267 Ga0265338_10009743 3300028800 Bacteria 11397
268 Ga0307405_10035526 3300031731 Bacteria 2977
269 Ga0373955_0302225 3300035172 Bacteria 965
270 Ga0373935_0047600 3300035692 Bacteria 2712
271 Ga0373927_0146796 3300035695 Bacteria 1544
272 Ga0373947_0038381 3300035725 Bacteria 2845
273 Ga0373937_0094562 3300036401 Bacteria 2771
274 Ga0373925_0076960 3300037068 Bacteria 2531
275 Ga0373925_0206700 3300037068 Bacteria 1563
276 Ga0436365_0628342 3300039437 Bacteria 21312
277 Ga0436362_1260443 3300039453 Bacteria 1342
278 Ga0439436_0033840 3300041404 Bacteria 1479
279 Ga0439438_000491 3300041405 Bacteria 17909
280 Ga0439466_0020609 3300041411 Bacteria 2348
281 Ga0439432_003095 3300042006 Bacteria 6196
282 Ga0450889_005401 3300042144 Bacteria 1273
283 Ga0450909_006935 3300042185 Bacteria 1634
284 Ga0451577_0025297 3300042876 Bacteria 5388
285 Ga0451577_0087727 3300042876 Bacteria 2775
286 Ga0453683_0094466 3300044673 Bacteria 1875
287 Ga0451576_0002155 3300045051 Bacteria 30466
288 Ga0451576_0036547 3300045051 Bacteria 5205
289 Ga0451576_0128687 3300045051 Bacteria 2639
290 Ga0451576_0139484 3300045051 Bacteria 2529
291 Ga0466967_0429485 3300045976 Bacteria 1289
292 Ga0495629_0290505 3300046459 Bacteria 1121
293 Ga0495650_0007708 3300046471 Bacteria 6414
294 Ga0495580_0002649 3300046472 Bacteria 15549
295 Ga0495580_0086230 3300046472 Bacteria 2187
296 Ga0495605_0002430 3300046474 Bacteria 11518
297 Ga0495585_0083781 3300046492 Bacteria 1725
298 Ga0495596_0000793 3300046500 Bacteria 19224
299 Ga0495607_0000094 3300046501 Bacteria 92515
300 Ga0495607_0000224 3300046501 Bacteria 60214
301 Ga0495607_0000530 3300046501 Bacteria 37462
302 Ga0495607_0021489 3300046501 Bacteria 4060
303 Ga0495606_0004740 3300046507 Bacteria 13395
304 Ga0495610_0000840 3300046512 Bacteria 28602
305 Ga0495620_0000181 3300046515 Bacteria 48918
306 Ga0495620_0031535 3300046515 Bacteria 2428
307 Ga0495630_0349274 3300046517 Bacteria 1132
308 Ga0495632_0000022 3300046519 Bacteria 187045
309 Ga0495632_0000492 3300046519 Bacteria 37278
310 Ga0495648_0000236 3300046524 Bacteria 63182
311 Ga0495654_0000923 3300046530 Bacteria 21856
312 Ga0495654_0001535 3300046530 Bacteria 15672
313 Ga0495609_0000214 3300046538 Bacteria 57759
314 Ga0495656_0003948 3300046615 Bacteria 5035
315 Ga0495656_0009485 3300046615 Bacteria 3500
316 Ga0495625_0000242 3300046660 Bacteria 85764
317 Ga0495661_0038071 3300046665 Bacteria 2999
318 Ga0495671_0009897 3300046692 Bacteria 5305
319 Ga0495660_0000316 3300046810 Bacteria 43536
320 Ga0495660_0000353 3300046810 Bacteria 40596
321 Ga0495660_0029994 3300046810 Bacteria 3065
322 Ga0495674_0088530 3300047319 Bacteria 2648
323 Ga0495683_0000014 3300047323 Bacteria 199398
324 Ga0495687_040316 3300047443 Bacteria 2058
325 Ga0495679_004826 3300047446 Bacteria 6094
326 Ga0495681_0115295 3300047470 Bacteria 1159
327 Ga0495684_0350920 3300047471 Bacteria 1047
328 Ga0495626_0000010 3300048091 Bacteria 270265
329 Ga0496100_0100141 3300048903 Bacteria 1995
330 Ga0496102_0001170 3300048905 Bacteria 23917
331 Ga0496102_0036346 3300048905 Bacteria 4437
332 Ga0496103_0115093 3300048906 Bacteria 1710
333 Ga0496106_0005729 3300048909 Bacteria 9192
334 Ga0496106_0238036 3300048909 Bacteria 1454
335 Ga0496106_0310864 3300048909 Bacteria 1264
336 Ga0496107_0013880 3300048910 Bacteria 5631
337 Ga0496107_0014757 3300048910 Bacteria 5471
338 Ga0496108_0062730 3300048911 Bacteria 3129
339 Ga0496109_0031366 3300048912 Bacteria 4769
340 Ga0496109_0087463 3300048912 Bacteria 2878
341 Ga0496110_0012626 3300048913 Bacteria 6948
342 Ga0496112_0000706 3300048915 Bacteria 23155
343 Ga0496115_0078325 3300048918 Bacteria 2689
344 Ga0496116_0000290 3300048919 Bacteria 85274
345 Ga0496116_0006174 3300048919 Bacteria 10956
346 Ga0496117_0005356 3300048920 Bacteria 13519
347 Ga0496117_0038298 3300048920 Bacteria 3558
348 Ga0496118_0007440 3300048921 Bacteria 11601
349 Ga0496118_0066631 3300048921 Bacteria 2627
350 Ga0496121_0000255 3300048924 Bacteria 113201
351 Ga0496121_0004122 3300048924 Bacteria 19920
352 Ga0496121_0022587 3300048924 Bacteria 6095
353 Ga0496122_0000654 3300048925 Bacteria 69918
354 Ga0496122_0102436 3300048925 Bacteria 1909
355 Ga0496123_0000688 3300048926 Bacteria 55759
356 Ga0496124_0000004 3300048927 Bacteria 976131
357 Ga0496124_0017153 3300048927 Bacteria 6843
358 Ga0496125_0016989 3300048928 Bacteria 6957
359 Ga0496125_0070849 3300048928 Bacteria 2727
360 Ga0495682_0000169 3300049460 Bacteria 55128
361 Ga0501033_0167467 3300049570 Bacteria 1579
362 Ga0501034_0535495 3300049571 Bacteria 1082
363 Ga0501036_0403902 3300049572 Bacteria 1140
364 Ga0501038_0325005 3300049574 Bacteria 1202
365 Ga0501040_0046212 3300049576 Bacteria 2972
366 Ga0501042_0057975 3300049578 Bacteria 2764
367 Ga0501046_0010569 3300049580 Bacteria 7921
368 Ga0501047_0292641 3300049581 Bacteria 1472
369 Ga0501048_0121839 3300049582 Bacteria 1843
370 Ga0501048_0217995 3300049582 Bacteria 1353
371 Ga0501048_0288750 3300049582 Bacteria 1166
372 Ga0501071_0042738 3300049587 Bacteria 3248
373 Ga0501072_0063873 3300049588 Bacteria 2904
374 Ga0501072_0076321 3300049588 Bacteria 2651
375 Ga0501075_0004477 3300049591 Bacteria 9462
376 Ga0501076_0000949 3300049592 Bacteria 18914
377 Ga0501076_0313858 3300049592 Bacteria 1286
378 Ga0501077_0002556 3300049593 Bacteria 10911
379 Ga0501079_0025494 3300049741 Bacteria 4534
380 Ga0501080_0050722 3300049742 Bacteria 3862
381 Ga0501081_0012354 3300049743 Bacteria 5609
382 Ga0501083_0056039 3300049744 Bacteria 2642
383 Ga0501045_0046525 3300049824 Bacteria 3160
384 nmdc:mga0k408_20506_c1 3300050493 Bacteria 3703
385 nmdc:mga07m45_2016_c1 3300050496 Bacteria 7703
386 nmdc:mga07m45_3006_c1 3300050496 Bacteria 8036
387 nmdc:mga05p37_12706_c1 3300050507 Bacteria 10064
388 nmdc:mga05p37_198027_c1 3300050507 Unclassified 2435
389 nmdc:mga05p37_32968_c1 3300050507 Bacteria 6342
390 nmdc:mga05p37_351599_c1 3300050507 Bacteria 1735
391 nmdc:mga05p37_61662_c1 3300050507 Bacteria 4616
392 nmdc:mga05p37_76650_c1 3300050507 Bacteria 4116
393 nmdc:mga09592_2326_c1 3300050508 Bacteria 15337
394 nmdc:mga09592_368921_c1 3300050508 Bacteria 1242
395 nmdc:mga09592_86625_c1 3300050508 Bacteria 2673
396 nmdc:mga09592_98997_c1 3300050508 Bacteria 2496
397 nmdc:mga06r32_43096_c1 3300050510 Bacteria 4293
398 nmdc:mga08y16_6236_c1 3300050511 Bacteria 12503
399 nmdc:mga08y16_65497_c1 3300050511 Bacteria 3793
400 nmdc:mga08y16_6961_c1 3300050511 Bacteria 11853
401 nmdc:mga0n895_20267_c1 3300050512 Bacteria 6198
402 nmdc:mga0n895_387825_c1 3300050512 Bacteria 1413
403 nmdc:mga0n895_62203_c1 3300050512 Bacteria 3688
404 nmdc:mga0rr50_351000_c1 3300050513 Bacteria 1241
405 nmdc:mga0rr50_368708_c1 3300050513 Unclassified 1210
406 nmdc:mga0rr50_37999_c1 3300050513 Bacteria 3480
407 nmdc:mga0rr50_490839_c1 3300050513 Bacteria 1043
408 nmdc:mga08x19_116436_c1 3300050514 Bacteria 1787
409 nmdc:mga08x19_59413_c1 3300050514 Bacteria 2475
410 nmdc:mga0a205_1366_c1 3300050515 Bacteria 20598
411 nmdc:mga0a205_202625_c1 3300050515 Bacteria 1874
412 nmdc:mga0a205_77333_c1 3300050515 Bacteria 3215
413 Ga0500583_0003828 3300053092 Bacteria 4811
414 Ga0500555_040490 3300053103 Bacteria 1298
415 Ga0500588_0004769 3300053146 Unclassified 2960
416 Ga0501084_0013285 3300054114 Bacteria 6813
417 Ga0501082_0002686 3300060353 Bacteria 15543
418 Ga0530510_0003767 3300061734 Bacteria 10442
419 Ga0530510_0020627 3300061734 Bacteria 4686
420 Ga0530510_0237610 3300061734 Bacteria 1356
421 Ga0530510_0262991 3300061734 Bacteria 1287
422 2513230012 2513020051 Bacteria 6053213
423 2555671107 2554235341 Bacteria 6867980
424 2585270862 2582581307 Bacteria 6597605
425 2585558586 2585427531 Bacteria 6992870
426 2596374109 2595698237 Bacteria 6712432
427 2599358406 2599185160 Bacteria 6844013
428 2599364724 2599185161 Bacteria 6960462
429 2599371045 2599185162 Bacteria 6957254
430 2599377444 2599185163 Bacteria 6995158
431 2599383751 2599185164 Bacteria 6841688
432 2599390018 2599185165 Bacteria 6843250
433 2599396298 2599185166 Bacteria 6959206
434 2599408485 2599185168 Bacteria 6997636
435 2599465400 2599185181 Bacteria 6844519
436 2599471707 2599185182 Bacteria 6883168
437 2599494244 2599185186 Bacteria 6831633
438 2600211634 2599185356 Bacteria 6843884
439 2601624244 2600255283 Bacteria 6061572
440 2601771770 2600255313 Bacteria 6842543
441 2644039498 2643221605 Bacteria 4772303
442 2671100924 2667528171 Bacteria 6900659
443 2819705933 2818991464 Bacteria 6907494
444 2826585619 2826581358 Bacteria 5963467
445 2842818477 2842815866 Bacteria 5947510
446 2842853178 2842849001 Bacteria 5924277
447 2844671657 2844665904 Bacteria 6817974
448 2902411860 2902405164 Bacteria 6784948
449 2904544094 2904541872 Bacteria 8915136
450 2917074967 2917070673 Bacteria 6868303
451 2928129693 2928125067 Bacteria 5937560
452 2929162346 2929160207 Bacteria 9075316
453 2929192428 2929189879 Bacteria 5930554
454 2935355045 2935353572 Unclassified 6955622
455 2939658851 2939657138 Bacteria 3740283
456 637321441 637000220 Bacteria 7074893
457 8056134875 8056131705 Bacteria 6107031
458 Ga0439447_013158
459 MRS1b_contig_2248537
460 JGI24742J22300_10022576
461 JGI25162J39368_1000081
462 JGI25163J39215_1000016
463 JGI25164J39214_1000060
464 JGI25151J46595_10001299
465 JGI25151J46595_10006332
466 JGI25165J46597_1000153
467 JGI25405J52794_10002968
468 Ga0065714_10002262
469 Ga0065714_10004999
470 Ga0065712_10068085
471 Ga0070658_10001588
472 Ga0070676_10000290
473 Ga0070683_100001772
474 Ga0070690_100155005
475 Ga0070670_100000416
476 Ga0070670_100071138
477 Ga0070677_10003248
478 Ga0068869_100001632
479 Ga0070680_100128895
480 Ga0068868_100038076
481 Ga0070660_100000052
482 Ga0070689_100001678
483 Ga0070687_100000134
484 Ga0070661_100007867
485 Ga0070661_100248960
486 Ga0070692_10015776
487 Ga0070669_100065038
488 Ga0070675_100002647
489 Ga0070671_100006839
490 Ga0070674_100002955
491 Ga0070688_100000725
492 Ga0070659_100000813
493 Ga0070667_100147225
494 Ga0070714_100172911
495 Ga0070713_100242713
496 Ga0070710_10103857
497 Ga0070701_10031866
498 Ga0070711_100014026
499 Ga0070711_100077928
500 Ga0070705_100011223
501 Ga0070708_100012168
502 Ga0070663_100000805
503 Ga0070663_100234191
504 Ga0070678_100007114
505 Ga0070662_100000701
506 Ga0070685_10000949
507 Ga0070706_100060343
508 Ga0070706_100066157
509 Ga0070707_100001008
510 Ga0070707_100128149
511 Ga0070707_100192068
512 Ga0070698_100005483
513 Ga0070698_100171866
514 Ga0070684_100002455
515 Ga0070697_100083531
516 Ga0070697_100176231
517 Ga0070697_100196606
518 Ga0068853_100000288
519 Ga0070672_100001812
520 Ga0070686_100010839
521 Ga0070695_100009656
522 Ga0070696_100007067
523 Ga0068855_100000202
524 Ga0070664_100000880
525 Ga0068857_100007319
526 Ga0068857_100494925
527 Ga0068854_100000406
528 Ga0068854_100188563
529 Ga0068856_100003305
530 Ga0068852_100001778
531 Ga0068859_100609995
532 Ga0068866_10000446
533 Ga0068861_100005061
534 Ga0068851_10000065
535 Ga0068870_10000197
536 Ga0068863_100030495
537 Ga0068858_100288631
538 Ga0068860_100507068
539 Ga0068862_100082740
540 Ga0081455_10110772
541 Ga0081538_10046818
542 Ga0081540_1001798
543 Ga0081539_10004590
544 Ga0070717_10284254
545 Ga0070717_10616999
546 Ga0070712_100002146
547 Ga0070712_100263572
548 Ga0070712_100300268
549 Ga0075367_10263020
550 Ga0097621_100000918
551 Ga0075370_10021067
552 Ga0075370_10024243
553 Ga0068871_100001441
554 Ga0075428_100097377
555 Ga0075428_100168635
556 Ga0075428_100259600
557 Ga0075428_100444670
558 Ga0075431_100056035
559 Ga0075433_10007389
560 Ga0075434_100017537
561 Ga0075434_100109807
562 Ga0075434_100147280
563 Ga0075429_100005732
564 Ga0075429_100011692
565 Ga0075429_100031959
566 Ga0075436_100047351
567 Ga0097620_100610023
568 Ga0075435_100016670
569 Ga0075435_100019967
570 Ga0105251_10014606
571 Ga0105244_10001757
572 Ga0105244_10044419
573 Ga0105240_10003064
574 Ga0111539_10014556
575 Ga0111539_10015198
576 Ga0111539_10019377
577 Ga0105245_10003480
578 Ga0105247_10000835
579 Ga0114129_10046663
580 Ga0114129_10260107
581 Ga0114129_10287093
582 Ga0114129_10344929
583 Ga0105243_10000310
584 Ga0105243_10003726
585 Ga0105243_10004796
586 Ga0105243_10043712
587 Ga0105241_10000829
588 Ga0105242_10001542
589 Ga0105248_10014172
590 Ga0105237_10000190
591 Ga0105238_10003095
592 Ga0105238_10105833
593 Ga0105238_10271615
594 Ga0105249_10000986
595 Ga0105249_10161751
596 Ga0105239_10003835
597 Ga0105246_10012204
598 Ga0105246_10171990
599 Ga0157373_10006961
600 Ga0157371_10000264
601 Ga0157371_10004934
602 Ga0157371_10203782
603 Ga0157369_10000161
604 Ga0157374_10002380
605 Ga0157378_10010750
606 Ga0163162_10007385
607 Ga0163162_10144033
608 Ga0163162_10184906
609 Ga0157372_10007592
610 Ga0157375_10004227
611 Ga0157375_10200441
612 Ga0163163_10061450
613 Ga0163163_10406509
614 Ga0182008_10000050
615 Ga0182008_10003128
616 Ga0182008_10024635
617 Ga0157377_10000141
618 Ga0157379_10000079
619 Ga0157376_10001389
620 Ga0182006_1002944
621 Ga0182007_10000383
622 Ga0213876_10020279
623 Ga0213876_10039609
624 Ga0213876_10039761
625 Ga0209760_100041
626 Ga0207427_100104
627 Ga0209437_100348
628 Ga0209148_1000377
629 Ga0209129_1004420
630 Ga0209233_1000202
631 Ga0209455_1000299
632 Ga0209025_1000244
633 Ga0209025_1001083
634 Ga0207426_1060307
635 Ga0207697_10058552
636 Ga0207656_10001575
637 Ga0207655_1000285
638 Ga0207655_1001301
639 Ga0207655_1009652
640 Ga0207713_1028623
641 Ga0207682_10000319
642 Ga0207710_10005587
643 Ga0207688_10000015
644 Ga0207680_10002258
645 Ga0207647_10004455
646 Ga0207699_10206421
647 Ga0207645_10000025
648 Ga0207643_10000023
649 Ga0207705_10019245
650 Ga0207684_10011436
651 Ga0207684_10047516
652 Ga0207654_10005498
653 Ga0207695_10017104
654 Ga0207671_10045493
655 Ga0207693_10002609
656 Ga0207693_10106776
657 Ga0207693_10470289
658 Ga0207663_10005937
659 Ga0207660_10041423
660 Ga0207662_10000346
661 Ga0207657_10000067
662 Ga0207657_10137903
663 Ga0207649_10004571
664 Ga0207649_10210596
665 Ga0207646_10001835
666 Ga0207646_10006933
667 Ga0207646_10448973
668 Ga0207681_10004137
669 Ga0207694_10003230
670 Ga0207650_10000147
671 Ga0207650_10001599
672 Ga0207659_10003682
673 Ga0207687_10002309
674 Ga0207644_10001339
675 Ga0207706_10000119
676 Ga0207709_10000280
677 Ga0207709_10001108
678 Ga0207709_10019553
679 Ga0207709_10025878
680 Ga0207670_10000100
681 Ga0207669_10006044
682 Ga0207704_10003255
683 Ga0207665_10057232
684 Ga0207691_10000079
685 Ga0207711_10000189
686 Ga0207689_10001164
687 Ga0207661_10003663
688 Ga0207679_10000531
689 Ga0207679_10001426
690 Ga0207667_10113926
691 Ga0207651_10002161
692 Ga0207651_10279801
693 Ga0207712_10000157
694 Ga0207712_10048663
695 Ga0207668_10004328
696 Ga0207658_10000885
697 Ga0207677_10000113
698 Ga0207703_10002397
699 Ga0207639_10093313
700 Ga0207639_10095516
701 Ga0207678_10004616
702 Ga0207678_10223987
703 Ga0207708_10052922
704 Ga0207702_10030569
705 Ga0207641_10009975
706 Ga0207648_10000095
707 Ga0207676_10005002
708 Ga0207674_10001904
709 Ga0207674_10123837
710 Ga0207675_100001269
711 Ga0207683_10000050
712 Ga0207698_10007847
713 Ga0209970_1006384
714 Ga0209983_1000121
715 Ga0209971_1000070
716 Ga0209966_1000042
717 Ga0209998_10000127
718 Ga0268266_10000415
719 Ga0268266_10087294
720 Ga0268265_10005984
721 Ga0268265_10006904
722 Ga0268264_10001060
723 Ga0268264_10503256
724 Ga0265338_10009743
725 Ga0307405_10035526
726 Ga0373955_0302225
727 Ga0373935_0047600
728 Ga0373927_0146796
729 Ga0373947_0038381
730 Ga0373937_0094562
731 Ga0373925_0076960
732 Ga0373925_0206700
733 Ga0436365_0628342
734 Ga0436362_1260443
735 Ga0439436_0033840
736 Ga0439438_000491
737 Ga0439466_0020609
738 Ga0439432_003095
739 Ga0450889_005401
740 Ga0450909_006935
741 Ga0451577_0025297
742 Ga0451577_0087727
743 Ga0453683_0094466
744 Ga0451576_0002155
745 Ga0451576_0036547
746 Ga0451576_0128687
747 Ga0451576_0139484
748 Ga0466967_0429485
749 Ga0495629_0290505
750 Ga0495650_0007708
751 Ga0495580_0002649
752 Ga0495580_0086230
753 Ga0495605_0002430
754 Ga0495585_0083781
755 Ga0495596_0000793
756 Ga0495607_0000094
757 Ga0495607_0000224
758 Ga0495607_0000530
759 Ga0495607_0021489
760 Ga0495606_0004740
761 Ga0495610_0000840
762 Ga0495620_0000181
763 Ga0495620_0031535
764 Ga0495630_0349274
765 Ga0495632_0000022
766 Ga0495632_0000492
767 Ga0495648_0000236
768 Ga0495654_0000923
769 Ga0495654_0001535
770 Ga0495609_0000214
771 Ga0495656_0003948
772 Ga0495656_0009485
773 Ga0495625_0000242
774 Ga0495661_0038071
775 Ga0495671_0009897
776 Ga0495660_0000316
777 Ga0495660_0000353
778 Ga0495660_0029994
779 Ga0495674_0088530
780 Ga0495683_0000014
781 Ga0495687_040316
782 Ga0495679_004826
783 Ga0495681_0115295
784 Ga0495684_0350920
785 Ga0495626_0000010
786 Ga0496100_0100141
787 Ga0496102_0001170
788 Ga0496102_0036346
789 Ga0496103_0115093
790 Ga0496106_0005729
791 Ga0496106_0238036
792 Ga0496106_0310864
793 Ga0496107_0013880
794 Ga0496107_0014757
795 Ga0496108_0062730
796 Ga0496109_0031366
797 Ga0496109_0087463
798 Ga0496110_0012626
799 Ga0496112_0000706
800 Ga0496115_0078325
801 Ga0496116_0000290
802 Ga0496116_0006174
803 Ga0496117_0005356
804 Ga0496117_0038298
805 Ga0496118_0007440
806 Ga0496118_0066631
807 Ga0496121_0000255
808 Ga0496121_0004122
809 Ga0496121_0022587
810 Ga0496122_0000654
811 Ga0496122_0102436
812 Ga0496123_0000688
813 Ga0496124_0000004
814 Ga0496124_0017153
815 Ga0496125_0016989
816 Ga0496125_0070849
817 Ga0495682_0000169
818 Ga0501033_0167467
819 Ga0501034_0535495
820 Ga0501036_0403902
821 Ga0501038_0325005
822 Ga0501040_0046212
823 Ga0501042_0057975
824 Ga0501046_0010569
825 Ga0501047_0292641
826 Ga0501048_0121839
827 Ga0501048_0217995
828 Ga0501048_0288750
829 Ga0501071_0042738
830 Ga0501072_0063873
831 Ga0501072_0076321
832 Ga0501075_0004477
833 Ga0501076_0000949
834 Ga0501076_0313858
835 Ga0501077_0002556
836 Ga0501079_0025494
837 Ga0501080_0050722
838 Ga0501081_0012354
839 Ga0501083_0056039
840 Ga0501045_0046525
841 nmdc:mga0k408_20506_c1
842 nmdc:mga07m45_2016_c1
843 nmdc:mga07m45_3006_c1
844 nmdc:mga05p37_12706_c1
845 nmdc:mga05p37_198027_c1
846 nmdc:mga05p37_32968_c1
847 nmdc:mga05p37_351599_c1
848 nmdc:mga05p37_61662_c1
849 nmdc:mga05p37_76650_c1
850 nmdc:mga09592_2326_c1
851 nmdc:mga09592_368921_c1
852 nmdc:mga09592_86625_c1
853 nmdc:mga09592_98997_c1
854 nmdc:mga06r32_43096_c1
855 nmdc:mga08y16_6236_c1
856 nmdc:mga08y16_65497_c1
857 nmdc:mga08y16_6961_c1
858 nmdc:mga0n895_20267_c1
859 nmdc:mga0n895_387825_c1
860 nmdc:mga0n895_62203_c1
861 nmdc:mga0rr50_351000_c1
862 nmdc:mga0rr50_368708_c1
863 nmdc:mga0rr50_37999_c1
864 nmdc:mga0rr50_490839_c1
865 nmdc:mga08x19_116436_c1
866 nmdc:mga08x19_59413_c1
867 nmdc:mga0a205_1366_c1
868 nmdc:mga0a205_202625_c1
869 nmdc:mga0a205_77333_c1
870 Ga0500583_0003828
871 Ga0500555_040490
872 Ga0500588_0004769
873 Ga0501084_0013285
874 Ga0501082_0002686
875 Ga0530510_0003767
876 Ga0530510_0020627
877 Ga0530510_0237610
878 Ga0530510_0262991
879 2513230012
880 2555671107
881 2585270862
882 2585558586
883 2596374109
884 2599358406
885 2599364724
886 2599371045
887 2599377444
888 2599383751
889 2599390018
890 2599396298
891 2599408485
892 2599465400
893 2599471707
894 2599494244
895 2600211634
896 2601624244
897 2601771770
898 2644039498
899 2671100924
900 2819705933
901 2826585619
902 2842818477
903 2842853178
904 2844671657
905 2902411860
906 2904544094
907 2917074967
908 2928129693
909 2929162346
910 2929192428
911 2935355045
912 2939658851
913 637321441
914 8056134875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

75

334

0.85

PF12146

Hydrolase_4

Serine aminopeptidase, S33

73

334

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

77

340

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9657 2 290
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.94 2 290
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8877 1 123
4bat-assembly1.cif.gz_A-2 structure of a putative epoxide hydrolase t131d mutant from pseudomonas aeruginosa. 0.8578 1 292
4b9a-assembly1.cif.gz_A structure of a putative epoxide hydrolase from pseudomonas aeruginosa. 0.8552 1 292
ID Description Score Start End Superfamily
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.965 2 290 3.40.50.1820
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.933 2 290 3.40.50.1820
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8744 10 123 3.40.50.12270
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8734 1 91 3.40.50.12270
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8466 1 296 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1H3G878-F1-model_v4 Alpha/beta hydrolase fold 1.002 3 99 GO:0016787
AF-A0A352SAJ5-F1-model_v4 Alpha/beta hydrolase 0.9954 1 115 GO:0016020
GO:0046464
GO:0047372
AF-A0A563EMW7-F1-model_v4 Alpha/beta hydrolase 0.9905 1 97 GO:0016787
AF-A0A520HLZ4-F1-model_v4 Alpha/beta hydrolase 0.9904 1 226 GO:0016020
GO:0016787
AF-A0A366KLG2-F1-model_v4 Alpha/beta hydrolase 0.99 1 290 GO:0016020
GO:0046464
GO:0047372

Map