F448041

General Info

Members Datasets Scaffolds Average Seq Length
457 256 914 299

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0328076|Ga0466963_0328076_17_985
Length 322
Sequence MRTPTVVRAAPAPLAPMPDRVTIYEVGPRDGLQNEKALLEVDQKLEFIQRLEAAGARRIETVSFVNPKRVPQMAGAEEISAALPHEAGRSRIGLVLNARGWDRCLEAKCDEANVVVCATDGFGIRNQGASAAEQTQAMQAILARRKAEGGPPITVTISVAFGCPFDGEVSEDQVIRIVRAAAEAGADEIALADTIGVADPWLVRKRVEATKTAAPGIPLRMHFHDTRNTGLANAFASVEAGVDVLDASCGGLGGCPFAPDATGNIGTEDLVYMLERAGYSTGYDLDGLIGTAKWMAGILGKPPAASVSRAGGFPVPKAQAAA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
205 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
226 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
227 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
228 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
229 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
230 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
231 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
232 2643221583 Caulobacter sp. Root655 Isolate Unclassified
233 2643221584 Caulobacter sp. Root656 Isolate Unclassified
234 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
235 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
236 2643221640 Caulobacter sp. Root342 Isolate Unclassified
237 2643221642 Caulobacter sp. Root343 Isolate Unclassified
238 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
239 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
240 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
241 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
242 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
243 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
244 2818991435 Caulobacter henricii 536 Isolate Unclassified
245 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
246 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
247 2849560528 Caulobacter zeae 410 Isolate Unclassified
248 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
249 2851153111 Caulobacter radicis 736 Isolate Unclassified
250 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
251 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
252 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
253 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
254 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
255 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
256 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.44
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.26
Nodule 0.22
Rhizoplane 3.5
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0328076 3300044694 Bacteria 1077
2 JGI25153J46596_10024978 3300003215 Bacteria 2144
3 JGI25153J46596_10045067 3300003215 Bacteria 1319
4 rootH1_10081374 3300003316 Bacteria 1996
5 Ga0006562J51391_1084114 3300003578 Bacteria 3520
6 Ga0006562J51391_1084116 3300003578 Bacteria 2090
7 Ga0055524_1006227 3300003775 Bacteria 5206
8 Ga0055536_1001011 3300003781 Bacteria 17865
9 Ga0055536_1001362 3300003781 Bacteria 14857
10 Ga0055536_1002645 3300003781 Bacteria 9958
11 Ga0055536_1002964 3300003781 Bacteria 9309
12 Ga0055536_1015837 3300003781 Bacteria 2556
13 Ga0055528_1003679 3300003790 Bacteria 7606
14 Ga0055530_10001080 3300003791 Bacteria 21471
15 Ga0055530_10003058 3300003791 Bacteria 9958
16 Ga0055531_10002770 3300003794 Bacteria 11506
17 Ga0065165_1000264 3300005262 Bacteria 90435
18 Ga0065165_1001205 3300005262 Bacteria 29843
19 Ga0070670_100000013 3300005331 Bacteria 250768
20 Ga0070670_100009610 3300005331 Bacteria 8254
21 Ga0070680_100023814 3300005336 Bacteria 4887
22 Ga0070680_100228410 3300005336 Bacteria 1571
23 Ga0070660_100246796 3300005339 Bacteria 1455
24 Ga0070661_100360119 3300005344 Bacteria 1143
25 Ga0070668_100000042 3300005347 Bacteria 78694
26 Ga0070668_100000707 3300005347 Bacteria 22821
27 Ga0070668_100005345 3300005347 Bacteria 9534
28 Ga0070668_100007523 3300005347 Bacteria 8089
29 Ga0070668_100009879 3300005347 Bacteria 7068
30 Ga0070671_100084419 3300005355 Bacteria 2656
31 Ga0070659_100000428 3300005366 Bacteria 31806
32 Ga0070659_100001301 3300005366 Bacteria 18120
33 Ga0070659_100067459 3300005366 Bacteria 2837
34 Ga0070667_100000168 3300005367 Bacteria 81935
35 Ga0070667_100001255 3300005367 Bacteria 23018
36 Ga0070667_100003824 3300005367 Bacteria 12796
37 Ga0070663_100038077 3300005455 Bacteria 3352
38 Ga0070678_100195914 3300005456 Bacteria 1664
39 Ga0070662_100057789 3300005457 Bacteria 2820
40 Ga0070681_10011298 3300005458 Bacteria 8834
41 Ga0070681_10117505 3300005458 Bacteria 2596
42 Ga0070681_10192454 3300005458 Bacteria 1959
43 Ga0070679_100000858 3300005530 Bacteria 26439
44 Ga0070679_100013292 3300005530 Bacteria 7881
45 Ga0068853_100033140 3300005539 Bacteria 4381
46 Ga0068853_100048684 3300005539 Bacteria 3642
47 Ga0068853_100121869 3300005539 Bacteria 2327
48 Ga0068853_100194710 3300005539 Bacteria 1843
49 Ga0070693_100192798 3300005547 Bacteria 1319
50 Ga0070665_100000363 3300005548 Bacteria 67699
51 Ga0070665_100000593 3300005548 Bacteria 50386
52 Ga0070665_100035716 3300005548 Bacteria 4999
53 Ga0070665_100709724 3300005548 Bacteria 1019
54 Ga0068855_100009421 3300005563 Bacteria 11794
55 Ga0068855_100029587 3300005563 Bacteria 6547
56 Ga0068855_100038442 3300005563 Bacteria 5686
57 Ga0068855_100152342 3300005563 Bacteria 2629
58 Ga0068857_100288394 3300005577 Bacteria 1511
59 Ga0068856_100373172 3300005614 Bacteria 1445
60 Ga0068856_100443989 3300005614 Bacteria 1318
61 Ga0068864_100000135 3300005618 Bacteria 71759
62 Ga0068864_100004585 3300005618 Bacteria 11336
63 Ga0068861_100417565 3300005719 Bacteria 1195
64 Ga0068863_100000735 3300005841 Bacteria 32827
65 Ga0068863_100003449 3300005841 Bacteria 15593
66 Ga0068863_100302201 3300005841 Bacteria 1552
67 Ga0068863_100539567 3300005841 Bacteria 1151
68 Ga0068858_100000020 3300005842 Bacteria 175896
69 Ga0068858_100006409 3300005842 Bacteria 11462
70 Ga0068858_100155985 3300005842 Bacteria 2148
71 Ga0068860_100000133 3300005843 Bacteria 120382
72 Ga0068860_100000382 3300005843 Bacteria 58081
73 Ga0068860_100022661 3300005843 Bacteria 6071
74 Ga0068862_100000463 3300005844 Bacteria 43942
75 Ga0068862_100017278 3300005844 Bacteria 6005
76 Ga0068862_100017936 3300005844 Bacteria 5895
77 Ga0075366_10017266 3300006195 Bacteria 4152
78 Ga0075370_10059242 3300006353 Bacteria 2179
79 Ga0068865_100001019 3300006881 Bacteria 16107
80 Ga0079104_1012955 3300006946 Bacteria 2593
81 Ga0105250_10008707 3300009092 Bacteria 4298
82 Ga0105240_10014687 3300009093 Bacteria 10685
83 Ga0105240_10015807 3300009093 Bacteria 10241
84 Ga0105240_10071922 3300009093 Bacteria 4276
85 Ga0105240_10393733 3300009093 Bacteria 1562
86 Ga0105247_10108210 3300009101 Bacteria 1786
87 Ga0105248_10000305 3300009177 Bacteria 58472
88 Ga0105248_10007895 3300009177 Bacteria 11694
89 Ga0105248_10044159 3300009177 Bacteria 4998
90 Ga0105248_10115539 3300009177 Bacteria 3027
91 Ga0105248_10249898 3300009177 Bacteria 1996
92 Ga0105248_10376092 3300009177 Bacteria 1599
93 Ga0105238_10010208 3300009551 Bacteria 9415
94 Ga0105238_10062344 3300009551 Bacteria 3729
95 Ga0105238_10071800 3300009551 Bacteria 3459
96 Ga0105238_10107471 3300009551 Bacteria 2771
97 Ga0105238_10390454 3300009551 Bacteria 1384
98 Ga0105249_10000610 3300009553 Bacteria 32602
99 Ga0105249_10158178 3300009553 Bacteria 2187
100 Ga0157373_10010029 3300013100 Bacteria 6981
101 Ga0157373_10011866 3300013100 Bacteria 6402
102 Ga0157371_10268736 3300013102 Bacteria 1230
103 Ga0157370_10013802 3300013104 Bacteria 8298
104 Ga0157370_10305478 3300013104 Bacteria 1468
105 Ga0157369_10002971 3300013105 Bacteria 20293
106 Ga0163163_10019624 3300014325 Bacteria 6349
107 Ga0163163_10034972 3300014325 Bacteria 4871
108 Ga0163163_10076982 3300014325 Bacteria 3332
109 Ga0163163_10119452 3300014325 Bacteria 2669
110 Ga0163163_10254132 3300014325 Bacteria 1808
111 Ga0157379_10032873 3300014968 Bacteria 4625
112 Ga0157379_10113097 3300014968 Bacteria 2440
113 Ga0163161_10248513 3300017792 Bacteria 1386
114 Ga0213872_10048638 3300021361 Bacteria 1927
115 Ga0213874_10060618 3300021377 Bacteria 1184
116 Ga0213876_10000081 3300021384 Bacteria 108997
117 Ga0209026_1010478 3300025250 Bacteria 1727
118 Ga0209565_1000395 3300025263 Bacteria 36792
119 Ga0209673_1010662 3300025273 Bacteria 3853
120 Ga0209676_1000213 3300025292 Bacteria 128039
121 Ga0209676_1000467 3300025292 Bacteria 67659
122 Ga0209676_1000560 3300025292 Bacteria 56233
123 Ga0209676_1005154 3300025292 Bacteria 6949
124 Ga0209564_1001381 3300025295 Bacteria 25325
125 Ga0209564_1017524 3300025295 Bacteria 2786
126 Ga0209564_1024212 3300025295 Bacteria 2080
127 Ga0209758_1001633 3300025297 Bacteria 25481
128 Ga0209758_1002447 3300025297 Bacteria 18951
129 Ga0209758_1005737 3300025297 Bacteria 9350
130 Ga0209050_1000461 3300025298 Bacteria 72912
131 Ga0209050_1001753 3300025298 Bacteria 21523
132 Ga0209050_1002433 3300025298 Bacteria 15998
133 Ga0209050_1003548 3300025298 Bacteria 11365
134 Ga0209256_1003362 3300025299 Bacteria 11323
135 Ga0209256_1005306 3300025299 Bacteria 7502
136 Ga0209257_1000125 3300025304 Bacteria 218126
137 Ga0209257_1000246 3300025304 Bacteria 125942
138 Ga0209257_1000427 3300025304 Bacteria 81007
139 Ga0209257_1000757 3300025304 Bacteria 48772
140 Ga0209257_1002416 3300025304 Bacteria 18671
141 Ga0209257_1012142 3300025304 Bacteria 4030
142 Ga0207696_1030365 3300025711 Bacteria 1643
143 Ga0207680_10027022 3300025903 Bacteria 3189
144 Ga0207705_10000556 3300025909 Bacteria 31398
145 Ga0207707_10021552 3300025912 Bacteria 5633
146 Ga0207707_10056462 3300025912 Bacteria 3416
147 Ga0207695_10001235 3300025913 Bacteria 43771
148 Ga0207695_10002484 3300025913 Bacteria 27149
149 Ga0207695_10012530 3300025913 Bacteria 10169
150 Ga0207695_10050413 3300025913 Bacteria 4380
151 Ga0207695_10364594 3300025913 Bacteria 1331
152 Ga0207660_10000773 3300025917 Bacteria 21298
153 Ga0207657_10000693 3300025919 Bacteria 35842
154 Ga0207657_10031284 3300025919 Bacteria 4824
155 Ga0207657_10057625 3300025919 Bacteria 3347
156 Ga0207657_10216388 3300025919 Bacteria 1536
157 Ga0207652_10019459 3300025921 Bacteria 5584
158 Ga0207681_10297952 3300025923 Bacteria 1275
159 Ga0207694_10005922 3300025924 Bacteria 9376
160 Ga0207694_10133088 3300025924 Bacteria 1994
161 Ga0207650_10000016 3300025925 Bacteria 361958
162 Ga0207644_10514682 3300025931 Bacteria 988
163 Ga0207690_10000373 3300025932 Bacteria 29751
164 Ga0207690_10006047 3300025932 Bacteria 7169
165 Ga0207706_10062893 3300025933 Bacteria 3268
166 Ga0207704_10002498 3300025938 Bacteria 8290
167 Ga0207711_10000160 3300025941 Bacteria 72317
168 Ga0207711_10019133 3300025941 Bacteria 5699
169 Ga0207711_10025271 3300025941 Bacteria 4983
170 Ga0207711_10069290 3300025941 Bacteria 3057
171 Ga0207679_10116834 3300025945 Bacteria 2116
172 Ga0207667_10006652 3300025949 Bacteria 13971
173 Ga0207667_10045108 3300025949 Bacteria 4669
174 Ga0207667_10091845 3300025949 Bacteria 3136
175 Ga0207667_10122271 3300025949 Bacteria 2682
176 Ga0207667_10238422 3300025949 Bacteria 1862
177 Ga0207667_10643135 3300025949 Bacteria 1067
178 Ga0207712_10000641 3300025961 Bacteria 27375
179 Ga0207712_10231955 3300025961 Bacteria 1482
180 Ga0207668_10000002 3300025972 Bacteria 209163
181 Ga0207668_10000401 3300025972 Bacteria 27305
182 Ga0207668_10001930 3300025972 Bacteria 12135
183 Ga0207668_10022346 3300025972 Bacteria 4048
184 Ga0207668_10246916 3300025972 Bacteria 1447
185 Ga0207658_10000399 3300025986 Bacteria 41904
186 Ga0207658_10003349 3300025986 Bacteria 11367
187 Ga0207658_10009133 3300025986 Bacteria 6724
188 Ga0207703_10000082 3300026035 Bacteria 110579
189 Ga0207703_10018799 3300026035 Bacteria 5395
190 Ga0207703_10104196 3300026035 Bacteria 2410
191 Ga0207639_10031860 3300026041 Bacteria 3877
192 Ga0207639_10055804 3300026041 Bacteria 3025
193 Ga0207639_10146673 3300026041 Bacteria 1972
194 Ga0207639_10551417 3300026041 Bacteria 1058
195 Ga0207702_10069163 3300026078 Bacteria 3035
196 Ga0207702_10105626 3300026078 Bacteria 2494
197 Ga0207641_10000007 3300026088 Bacteria 441443
198 Ga0207641_10001614 3300026088 Bacteria 21995
199 Ga0207641_10034834 3300026088 Bacteria 4190
200 Ga0207641_10499341 3300026088 Bacteria 1181
201 Ga0207676_10000191 3300026095 Bacteria 53466
202 Ga0207676_10000618 3300026095 Bacteria 29046
203 Ga0207676_10004212 3300026095 Bacteria 10160
204 Ga0207676_10114800 3300026095 Bacteria 2260
205 Ga0207675_100156846 3300026118 Bacteria 2169
206 Ga0207675_100453083 3300026118 Bacteria 1272
207 Ga0209981_1000327 3300027378 Bacteria 6139
208 Ga0268266_10000003 3300028379 Bacteria 1701703
209 Ga0268266_10026031 3300028379 Bacteria 4976
210 Ga0268266_10163474 3300028379 Bacteria 2015
211 Ga0268265_10000836 3300028380 Bacteria 28993
212 Ga0268265_10007741 3300028380 Bacteria 7251
213 Ga0268265_10043600 3300028380 Bacteria 3336
214 Ga0268265_10049357 3300028380 Bacteria 3165
215 Ga0268265_10065960 3300028380 Bacteria 2796
216 Ga0268264_10000008 3300028381 Bacteria 773387
217 Ga0268264_10000207 3300028381 Bacteria 120086
218 Ga0268264_10010210 3300028381 Bacteria 7772
219 Ga0307517_10019757 3300028786 Bacteria 8620
220 Ga0307517_10053033 3300028786 Bacteria 4048
221 Ga0307515_10016020 3300028794 Bacteria 13759
222 Ga0265338_10009658 3300028800 Bacteria 11448
223 Ga0265338_10066774 3300028800 Bacteria 3110
224 Ga0265338_10247495 3300028800 Bacteria 1317
225 Ga0265331_10106196 3300031250 Bacteria 1289
226 Ga0265327_10000130 3300031251 Bacteria 165066
227 Ga0265327_10003358 3300031251 Bacteria 15423
228 Ga0307513_10000077 3300031456 Bacteria 134167
229 Ga0307513_10002125 3300031456 Bacteria 27813
230 Ga0307513_10007717 3300031456 Bacteria 13899
231 Ga0307513_10009525 3300031456 Bacteria 12284
232 Ga0265314_10015084 3300031711 Bacteria 6146
233 Ga0265314_10118803 3300031711 Bacteria 1668
234 Ga0307516_10000001 3300031730 Bacteria 510338
235 Ga0307412_10004253 3300031911 Bacteria 7982
236 Ga0307409_100299140 3300031995 Bacteria 1496
237 Ga0307414_10036037 3300032004 Bacteria 3298
238 Ga0307414_10040479 3300032004 Bacteria 3148
239 Ga0307414_10067123 3300032004 Bacteria 2568
240 Ga0307414_10341769 3300032004 Bacteria 1281
241 Ga0307411_10044622 3300032005 Bacteria 2846
242 Ga0307411_10433781 3300032005 Bacteria 1095
243 Ga0373936_0015842 3300035113 Bacteria 2892
244 Ga0373943_0142122 3300035170 Bacteria 1294
245 Ga0373946_0024823 3300035171 Bacteria 2353
246 Ga0373931_0153354 3300035691 Bacteria 1345
247 Ga0373927_0003482 3300035695 Bacteria 11271
248 Ga0373925_0000257 3300037068 Bacteria 55764
249 Ga0395900_0012117 3300037418 Bacteria 8810
250 Ga0395900_0371997 3300037418 Bacteria 1398
251 Ga0395898_0008282 3300037466 Bacteria 10996
252 Ga0395898_0265474 3300037466 Bacteria 1637
253 Ga0395905_0005670 3300037471 Bacteria 12700
254 Ga0395905_0020042 3300037471 Bacteria 6337
255 Ga0395905_0102098 3300037471 Bacteria 2692
256 Ga0395905_0262364 3300037471 Bacteria 1613
257 Ga0395901_0001358 3300038443 Bacteria 25609
258 Ga0436365_0330659 3300039437 Bacteria 9341
259 Ga0436365_0966433 3300039437 Bacteria 3104
260 Ga0436365_1275470 3300039437 Bacteria 1107
261 Ga0436365_1469960 3300039437 Bacteria 1229
262 Ga0436360_0483895 3300039438 Bacteria 1150
263 Ga0436361_0323660 3300039447 Bacteria 9818
264 Ga0436363_0052288 3300039450 Bacteria 2134
265 Ga0439441_007053 3300042001 Bacteria 1799
266 Ga0450901_005497 3300042533 Bacteria 1301
267 Ga0466960_0322670 3300044901 Bacteria 875
268 Ga0495627_000923 3300046453 Bacteria 20317
269 Ga0495638_0000951 3300046460 Bacteria 29376
270 Ga0495638_0001655 3300046460 Bacteria 19739
271 Ga0495638_0002462 3300046460 Bacteria 15090
272 Ga0495638_0012523 3300046460 Bacteria 5807
273 Ga0495650_0000024 3300046471 Bacteria 496674
274 Ga0495650_0014492 3300046471 Bacteria 4098
275 Ga0495650_0032075 3300046471 Bacteria 2354
276 Ga0495583_0000003 3300046506 Bacteria 709273
277 Ga0495606_0009985 3300046507 Bacteria 7938
278 Ga0495610_0000802 3300046512 Bacteria 29479
279 Ga0495610_0002149 3300046512 Bacteria 16762
280 Ga0495610_0009764 3300046512 Bacteria 6030
281 Ga0495628_0177985 3300046516 Bacteria 1610
282 Ga0495631_0004042 3300046518 Bacteria 7894
283 Ga0495632_0006611 3300046519 Bacteria 7417
284 Ga0495632_0146181 3300046519 Bacteria 1094
285 Ga0495637_0004049 3300046520 Bacteria 7655
286 Ga0495648_0000066 3300046524 Bacteria 140767
287 Ga0495648_0013634 3300046524 Bacteria 5997
288 Ga0495648_0178903 3300046524 Bacteria 1080
289 Ga0495642_0001584 3300046528 Bacteria 9972
290 Ga0495654_0000118 3300046530 Bacteria 88890
291 Ga0495645_0062316 3300046543 Bacteria 2701
292 Ga0495622_0018656 3300046557 Bacteria 3231
293 Ga0495633_0001599 3300046558 Bacteria 17165
294 Ga0495668_0000342 3300046616 Bacteria 61973
295 Ga0495668_0029861 3300046616 Bacteria 3080
296 Ga0495668_0036744 3300046616 Bacteria 2743
297 Ga0495668_0050483 3300046616 Bacteria 2305
298 Ga0495668_0072147 3300046616 Bacteria 1897
299 Ga0495611_0009790 3300046648 Bacteria 4052
300 Ga0495625_0000854 3300046660 Bacteria 41503
301 Ga0495625_0012473 3300046660 Bacteria 6885
302 Ga0495625_0014395 3300046660 Bacteria 6316
303 Ga0495625_0036019 3300046660 Bacteria 3641
304 Ga0495625_0048184 3300046660 Bacteria 3069
305 Ga0495625_0053122 3300046660 Bacteria 2899
306 Ga0495625_0062964 3300046660 Bacteria 2620
307 Ga0495625_0159468 3300046660 Bacteria 1512
308 Ga0495625_0220979 3300046660 Bacteria 1241
309 Ga0495659_0045568 3300046664 Bacteria 1581
310 Ga0495599_0246452 3300046678 Bacteria 1088
311 Ga0495669_0000002 3300046684 Bacteria 282777
312 Ga0495669_0000353 3300046684 Bacteria 23496
313 Ga0495669_0007404 3300046684 Bacteria 4604
314 Ga0495670_0078163 3300046691 Bacteria 1683
315 Ga0495649_0000089 3300046694 Bacteria 79134
316 Ga0495589_0020569 3300046794 Bacteria 3375
317 Ga0495660_0037000 3300046810 Bacteria 2720
318 Ga0495660_0107819 3300046810 Bacteria 1425
319 Ga0495636_0017989 3300047318 Bacteria 2834
320 Ga0495672_0033438 3300047320 Bacteria 3185
321 Ga0495672_0037253 3300047320 Bacteria 2978
322 Ga0495683_0038727 3300047323 Bacteria 2413
323 Ga0495677_0018180 3300047445 Bacteria 2548
324 Ga0495679_003383 3300047446 Bacteria 7688
325 Ga0495673_0000102 3300047469 Bacteria 173343
326 Ga0495673_0000710 3300047469 Bacteria 32297
327 Ga0495673_0005918 3300047469 Bacteria 7295
328 Ga0495686_0000839 3300047472 Bacteria 39457
329 Ga0495686_0003093 3300047472 Bacteria 14707
330 Ga0495686_0004374 3300047472 Bacteria 11655
331 Ga0495686_0018643 3300047472 Bacteria 4651
332 Ga0495686_0063744 3300047472 Bacteria 2283
333 Ga0495686_0102904 3300047472 Bacteria 1721
334 Ga0495593_0021131 3300047673 Bacteria 3639
335 Ga0496100_0456774 3300048903 Bacteria 980
336 Ga0496102_0020538 3300048905 Bacteria 5836
337 Ga0496102_0157360 3300048905 Bacteria 2136
338 Ga0496103_0031900 3300048906 Bacteria 3214
339 Ga0496106_0028640 3300048909 Bacteria 4149
340 Ga0496107_0000131 3300048910 Bacteria 36633
341 Ga0496108_0017861 3300048911 Bacteria 5802
342 Ga0496109_0024302 3300048912 Bacteria 5386
343 Ga0496110_0125028 3300048913 Bacteria 2320
344 Ga0496112_0052358 3300048915 Bacteria 4006
345 Ga0496112_0114898 3300048915 Bacteria 2662
346 Ga0496114_0257740 3300048917 Bacteria 1535
347 Ga0496115_0002138 3300048918 Bacteria 14127
348 Ga0496115_0002497 3300048918 Bacteria 13220
349 Ga0496115_0011156 3300048918 Bacteria 6732
350 Ga0496115_0268057 3300048918 Bacteria 1403
351 Ga0496116_0021619 3300048919 Bacteria 4844
352 Ga0496117_0018025 3300048920 Bacteria 5874
353 Ga0496118_0015375 3300048921 Bacteria 7087
354 Ga0496119_0023907 3300048922 Bacteria 4317
355 Ga0496121_0000035 3300048924 Bacteria 374316
356 Ga0496121_0006185 3300048924 Bacteria 15012
357 Ga0496121_0184270 3300048924 Bacteria 1503
358 Ga0496122_0004488 3300048925 Bacteria 17259
359 Ga0496123_0003275 3300048926 Bacteria 18348
360 Ga0496124_0012278 3300048927 Bacteria 8464
361 Ga0496125_0002516 3300048928 Bacteria 23670
362 Ga0496125_0043316 3300048928 Bacteria 3823
363 Ga0496126_0001304 3300048929 Bacteria 39731
364 Ga0495678_000558 3300049459 Bacteria 35734
365 Ga0501033_0014073 3300049570 Bacteria 6084
366 Ga0501043_0373914 3300049579 Bacteria 1080
367 Ga0501047_0119071 3300049581 Bacteria 2523
368 Ga0501047_0121608 3300049581 Bacteria 2492
369 Ga0501047_0204388 3300049581 Bacteria 1835
370 Ga0501048_0218427 3300049582 Bacteria 1352
371 Ga0501072_0001474 3300049588 Bacteria 17632
372 Ga0501073_0146081 3300049589 Bacteria 1639
373 Ga0501080_0039302 3300049742 Bacteria 4416
374 Ga0501083_0002355 3300049744 Bacteria 12943
375 nmdc:mga0k408_7317_c1 3300050493 Bacteria 5897
376 nmdc:mga07m45_189688_c1 3300050496 Bacteria 1195
377 nmdc:mga07m45_69490_c1 3300050496 Bacteria 2002
378 nmdc:mga0sz30_6418_c1 3300050516 Bacteria 4364
379 Ga0500635_0000133 3300053080 Bacteria 42884
380 Ga0500578_0000737 3300053086 Bacteria 38789
381 Ga0500578_0130655 3300053086 Bacteria 1575
382 Ga0500643_005318 3300053087 Bacteria 5570
383 Ga0500644_0000084 3300053088 Bacteria 57829
384 Ga0500644_0001419 3300053088 Bacteria 6366
385 Ga0500646_0042612 3300053090 Bacteria 1283
386 Ga0500651_0003759 3300053093 Bacteria 8368
387 Ga0500651_0174963 3300053093 Bacteria 1277
388 Ga0500555_001064 3300053103 Bacteria 9234
389 Ga0500556_0002638 3300053104 Bacteria 5606
390 Ga0500562_001940 3300053108 Bacteria 5184
391 Ga0500562_002822 3300053108 Bacteria 4330
392 Ga0500569_013570 3300053109 Bacteria 1997
393 Ga0500594_0000221 3300053118 Bacteria 13834
394 Ga0500595_006607 3300053119 Bacteria 4897
395 Ga0500608_000187 3300053122 Bacteria 24884
396 Ga0500608_001063 3300053122 Bacteria 9839
397 Ga0500618_002255 3300053125 Bacteria 7500
398 Ga0500642_0024324 3300053130 Bacteria 2446
399 Ga0500642_0053055 3300053130 Bacteria 1797
400 Ga0500655_024543 3300053133 Bacteria 1142
401 Ga0500658_0014910 3300053134 Bacteria 2880
402 Ga0500559_0000212 3300053136 Bacteria 46705
403 Ga0500559_0003398 3300053136 Bacteria 7842
404 Ga0500559_0008444 3300053136 Bacteria 4512
405 Ga0500559_0018941 3300053136 Bacteria 2908
406 Ga0500559_0058687 3300053136 Bacteria 1712
407 Ga0500564_000080 3300053138 Bacteria 24788
408 Ga0500573_0029580 3300053140 Bacteria 3157
409 Ga0500577_0001991 3300053142 Bacteria 5236
410 Ga0500590_004838 3300053148 Bacteria 6422
411 Ga0500616_0066166 3300053153 Bacteria 1856
412 Ga0500619_000501 3300053154 Bacteria 6809
413 Ga0500622_0002814 3300053156 Bacteria 12208
414 Ga0500622_0082362 3300053156 Bacteria 1609
415 Ga0500622_0135390 3300053156 Bacteria 1180
416 Ga0500624_002114 3300053157 Bacteria 2764
417 Ga0500638_061866 3300053162 Bacteria 1798
418 Ga0500636_0003639 3300053177 Bacteria 8694
419 Ga0500637_0029408 3300053178 Bacteria 3047
420 Ga0500625_057543 3300053729 Bacteria 1776
421 Ga0500645_040824 3300053730 Bacteria 1371
422 Ga0500596_001059 3300053735 Bacteria 5540
423 Ga0501082_0002053 3300060353 Bacteria 17707
424 Ga0501082_0006037 3300060353 Bacteria 10509
425 2511121125 2510917020 Bacteria 5657507
426 2585148034 2582581279 Bacteria 4980720
427 2585153931 2582581280 Bacteria 5994497
428 2585194924 2582581293 Bacteria 5907401
429 2587915351 2585428106 Bacteria 5179711
430 2643747279 2643221545 Bacteria 5083237
431 2643882524 2643221574 Bacteria 2789653
432 2643924529 2643221583 Bacteria 5218014
433 2643929935 2643221584 Bacteria 5511711
434 2643998926 2643221598 Bacteria 4578346
435 2644087047 2643221614 Bacteria 4260023
436 2644223906 2643221640 Bacteria 5258820
437 2644232892 2643221642 Bacteria 5357871
438 2644342001 2643221661 Bacteria 4267604
439 2644353476 2643221663 Bacteria 3425771
440 2644368288 2643221666 Bacteria 4265935
441 2644507523 2643221691 Bacteria 5093099
442 2644549523 2643221699 Bacteria 5731501
443 2644550574 2643221699 Bacteria 5731501
444 2792458856 2791355048 Bacteria 5832535
445 2819540451 2818991435 Bacteria 5433759
446 2819649433 2818991454 Bacteria 5563326
447 2843745791 2843744320 Bacteria 5659202
448 2849562296 2849560528 Bacteria 5393480
449 2849577217 2849573788 Bacteria 5421256
450 2851153203 2851153111 Bacteria 5542585
451 2857508048 2857504554 Bacteria 5369913
452 2884963139 2884960567 Bacteria 5437054
453 2898330400 2898329390 Bacteria 5168154
454 2928534797 2928531327 Bacteria 5101314
455 2928973460 2928972540 Bacteria 3058286
456 2941486141 2941485952 Bacteria 3591484
457 2977240561 2977240413 Bacteria 3191065
458 Ga0466963_0328076
459 JGI25153J46596_10024978
460 JGI25153J46596_10045067
461 rootH1_10081374
462 Ga0006562J51391_1084114
463 Ga0006562J51391_1084116
464 Ga0055524_1006227
465 Ga0055536_1001011
466 Ga0055536_1001362
467 Ga0055536_1002645
468 Ga0055536_1002964
469 Ga0055536_1015837
470 Ga0055528_1003679
471 Ga0055530_10001080
472 Ga0055530_10003058
473 Ga0055531_10002770
474 Ga0065165_1000264
475 Ga0065165_1001205
476 Ga0070670_100000013
477 Ga0070670_100009610
478 Ga0070680_100023814
479 Ga0070680_100228410
480 Ga0070660_100246796
481 Ga0070661_100360119
482 Ga0070668_100000042
483 Ga0070668_100000707
484 Ga0070668_100005345
485 Ga0070668_100007523
486 Ga0070668_100009879
487 Ga0070671_100084419
488 Ga0070659_100000428
489 Ga0070659_100001301
490 Ga0070659_100067459
491 Ga0070667_100000168
492 Ga0070667_100001255
493 Ga0070667_100003824
494 Ga0070663_100038077
495 Ga0070678_100195914
496 Ga0070662_100057789
497 Ga0070681_10011298
498 Ga0070681_10117505
499 Ga0070681_10192454
500 Ga0070679_100000858
501 Ga0070679_100013292
502 Ga0068853_100033140
503 Ga0068853_100048684
504 Ga0068853_100121869
505 Ga0068853_100194710
506 Ga0070693_100192798
507 Ga0070665_100000363
508 Ga0070665_100000593
509 Ga0070665_100035716
510 Ga0070665_100709724
511 Ga0068855_100009421
512 Ga0068855_100029587
513 Ga0068855_100038442
514 Ga0068855_100152342
515 Ga0068857_100288394
516 Ga0068856_100373172
517 Ga0068856_100443989
518 Ga0068864_100000135
519 Ga0068864_100004585
520 Ga0068861_100417565
521 Ga0068863_100000735
522 Ga0068863_100003449
523 Ga0068863_100302201
524 Ga0068863_100539567
525 Ga0068858_100000020
526 Ga0068858_100006409
527 Ga0068858_100155985
528 Ga0068860_100000133
529 Ga0068860_100000382
530 Ga0068860_100022661
531 Ga0068862_100000463
532 Ga0068862_100017278
533 Ga0068862_100017936
534 Ga0075366_10017266
535 Ga0075370_10059242
536 Ga0068865_100001019
537 Ga0079104_1012955
538 Ga0105250_10008707
539 Ga0105240_10014687
540 Ga0105240_10015807
541 Ga0105240_10071922
542 Ga0105240_10393733
543 Ga0105247_10108210
544 Ga0105248_10000305
545 Ga0105248_10007895
546 Ga0105248_10044159
547 Ga0105248_10115539
548 Ga0105248_10249898
549 Ga0105248_10376092
550 Ga0105238_10010208
551 Ga0105238_10062344
552 Ga0105238_10071800
553 Ga0105238_10107471
554 Ga0105238_10390454
555 Ga0105249_10000610
556 Ga0105249_10158178
557 Ga0157373_10010029
558 Ga0157373_10011866
559 Ga0157371_10268736
560 Ga0157370_10013802
561 Ga0157370_10305478
562 Ga0157369_10002971
563 Ga0163163_10019624
564 Ga0163163_10034972
565 Ga0163163_10076982
566 Ga0163163_10119452
567 Ga0163163_10254132
568 Ga0157379_10032873
569 Ga0157379_10113097
570 Ga0163161_10248513
571 Ga0213872_10048638
572 Ga0213874_10060618
573 Ga0213876_10000081
574 Ga0209026_1010478
575 Ga0209565_1000395
576 Ga0209673_1010662
577 Ga0209676_1000213
578 Ga0209676_1000467
579 Ga0209676_1000560
580 Ga0209676_1005154
581 Ga0209564_1001381
582 Ga0209564_1017524
583 Ga0209564_1024212
584 Ga0209758_1001633
585 Ga0209758_1002447
586 Ga0209758_1005737
587 Ga0209050_1000461
588 Ga0209050_1001753
589 Ga0209050_1002433
590 Ga0209050_1003548
591 Ga0209256_1003362
592 Ga0209256_1005306
593 Ga0209257_1000125
594 Ga0209257_1000246
595 Ga0209257_1000427
596 Ga0209257_1000757
597 Ga0209257_1002416
598 Ga0209257_1012142
599 Ga0207696_1030365
600 Ga0207680_10027022
601 Ga0207705_10000556
602 Ga0207707_10021552
603 Ga0207707_10056462
604 Ga0207695_10001235
605 Ga0207695_10002484
606 Ga0207695_10012530
607 Ga0207695_10050413
608 Ga0207695_10364594
609 Ga0207660_10000773
610 Ga0207657_10000693
611 Ga0207657_10031284
612 Ga0207657_10057625
613 Ga0207657_10216388
614 Ga0207652_10019459
615 Ga0207681_10297952
616 Ga0207694_10005922
617 Ga0207694_10133088
618 Ga0207650_10000016
619 Ga0207644_10514682
620 Ga0207690_10000373
621 Ga0207690_10006047
622 Ga0207706_10062893
623 Ga0207704_10002498
624 Ga0207711_10000160
625 Ga0207711_10019133
626 Ga0207711_10025271
627 Ga0207711_10069290
628 Ga0207679_10116834
629 Ga0207667_10006652
630 Ga0207667_10045108
631 Ga0207667_10091845
632 Ga0207667_10122271
633 Ga0207667_10238422
634 Ga0207667_10643135
635 Ga0207712_10000641
636 Ga0207712_10231955
637 Ga0207668_10000002
638 Ga0207668_10000401
639 Ga0207668_10001930
640 Ga0207668_10022346
641 Ga0207668_10246916
642 Ga0207658_10000399
643 Ga0207658_10003349
644 Ga0207658_10009133
645 Ga0207703_10000082
646 Ga0207703_10018799
647 Ga0207703_10104196
648 Ga0207639_10031860
649 Ga0207639_10055804
650 Ga0207639_10146673
651 Ga0207639_10551417
652 Ga0207702_10069163
653 Ga0207702_10105626
654 Ga0207641_10000007
655 Ga0207641_10001614
656 Ga0207641_10034834
657 Ga0207641_10499341
658 Ga0207676_10000191
659 Ga0207676_10000618
660 Ga0207676_10004212
661 Ga0207676_10114800
662 Ga0207675_100156846
663 Ga0207675_100453083
664 Ga0209981_1000327
665 Ga0268266_10000003
666 Ga0268266_10026031
667 Ga0268266_10163474
668 Ga0268265_10000836
669 Ga0268265_10007741
670 Ga0268265_10043600
671 Ga0268265_10049357
672 Ga0268265_10065960
673 Ga0268264_10000008
674 Ga0268264_10000207
675 Ga0268264_10010210
676 Ga0307517_10019757
677 Ga0307517_10053033
678 Ga0307515_10016020
679 Ga0265338_10009658
680 Ga0265338_10066774
681 Ga0265338_10247495
682 Ga0265331_10106196
683 Ga0265327_10000130
684 Ga0265327_10003358
685 Ga0307513_10000077
686 Ga0307513_10002125
687 Ga0307513_10007717
688 Ga0307513_10009525
689 Ga0265314_10015084
690 Ga0265314_10118803
691 Ga0307516_10000001
692 Ga0307412_10004253
693 Ga0307409_100299140
694 Ga0307414_10036037
695 Ga0307414_10040479
696 Ga0307414_10067123
697 Ga0307414_10341769
698 Ga0307411_10044622
699 Ga0307411_10433781
700 Ga0373936_0015842
701 Ga0373943_0142122
702 Ga0373946_0024823
703 Ga0373931_0153354
704 Ga0373927_0003482
705 Ga0373925_0000257
706 Ga0395900_0012117
707 Ga0395900_0371997
708 Ga0395898_0008282
709 Ga0395898_0265474
710 Ga0395905_0005670
711 Ga0395905_0020042
712 Ga0395905_0102098
713 Ga0395905_0262364
714 Ga0395901_0001358
715 Ga0436365_0330659
716 Ga0436365_0966433
717 Ga0436365_1275470
718 Ga0436365_1469960
719 Ga0436360_0483895
720 Ga0436361_0323660
721 Ga0436363_0052288
722 Ga0439441_007053
723 Ga0450901_005497
724 Ga0466960_0322670
725 Ga0495627_000923
726 Ga0495638_0000951
727 Ga0495638_0001655
728 Ga0495638_0002462
729 Ga0495638_0012523
730 Ga0495650_0000024
731 Ga0495650_0014492
732 Ga0495650_0032075
733 Ga0495583_0000003
734 Ga0495606_0009985
735 Ga0495610_0000802
736 Ga0495610_0002149
737 Ga0495610_0009764
738 Ga0495628_0177985
739 Ga0495631_0004042
740 Ga0495632_0006611
741 Ga0495632_0146181
742 Ga0495637_0004049
743 Ga0495648_0000066
744 Ga0495648_0013634
745 Ga0495648_0178903
746 Ga0495642_0001584
747 Ga0495654_0000118
748 Ga0495645_0062316
749 Ga0495622_0018656
750 Ga0495633_0001599
751 Ga0495668_0000342
752 Ga0495668_0029861
753 Ga0495668_0036744
754 Ga0495668_0050483
755 Ga0495668_0072147
756 Ga0495611_0009790
757 Ga0495625_0000854
758 Ga0495625_0012473
759 Ga0495625_0014395
760 Ga0495625_0036019
761 Ga0495625_0048184
762 Ga0495625_0053122
763 Ga0495625_0062964
764 Ga0495625_0159468
765 Ga0495625_0220979
766 Ga0495659_0045568
767 Ga0495599_0246452
768 Ga0495669_0000002
769 Ga0495669_0000353
770 Ga0495669_0007404
771 Ga0495670_0078163
772 Ga0495649_0000089
773 Ga0495589_0020569
774 Ga0495660_0037000
775 Ga0495660_0107819
776 Ga0495636_0017989
777 Ga0495672_0033438
778 Ga0495672_0037253
779 Ga0495683_0038727
780 Ga0495677_0018180
781 Ga0495679_003383
782 Ga0495673_0000102
783 Ga0495673_0000710
784 Ga0495673_0005918
785 Ga0495686_0000839
786 Ga0495686_0003093
787 Ga0495686_0004374
788 Ga0495686_0018643
789 Ga0495686_0063744
790 Ga0495686_0102904
791 Ga0495593_0021131
792 Ga0496100_0456774
793 Ga0496102_0020538
794 Ga0496102_0157360
795 Ga0496103_0031900
796 Ga0496106_0028640
797 Ga0496107_0000131
798 Ga0496108_0017861
799 Ga0496109_0024302
800 Ga0496110_0125028
801 Ga0496112_0052358
802 Ga0496112_0114898
803 Ga0496114_0257740
804 Ga0496115_0002138
805 Ga0496115_0002497
806 Ga0496115_0011156
807 Ga0496115_0268057
808 Ga0496116_0021619
809 Ga0496117_0018025
810 Ga0496118_0015375
811 Ga0496119_0023907
812 Ga0496121_0000035
813 Ga0496121_0006185
814 Ga0496121_0184270
815 Ga0496122_0004488
816 Ga0496123_0003275
817 Ga0496124_0012278
818 Ga0496125_0002516
819 Ga0496125_0043316
820 Ga0496126_0001304
821 Ga0495678_000558
822 Ga0501033_0014073
823 Ga0501043_0373914
824 Ga0501047_0119071
825 Ga0501047_0121608
826 Ga0501047_0204388
827 Ga0501048_0218427
828 Ga0501072_0001474
829 Ga0501073_0146081
830 Ga0501080_0039302
831 Ga0501083_0002355
832 nmdc:mga0k408_7317_c1
833 nmdc:mga07m45_189688_c1
834 nmdc:mga07m45_69490_c1
835 nmdc:mga0sz30_6418_c1
836 Ga0500635_0000133
837 Ga0500578_0000737
838 Ga0500578_0130655
839 Ga0500643_005318
840 Ga0500644_0000084
841 Ga0500644_0001419
842 Ga0500646_0042612
843 Ga0500651_0003759
844 Ga0500651_0174963
845 Ga0500555_001064
846 Ga0500556_0002638
847 Ga0500562_001940
848 Ga0500562_002822
849 Ga0500569_013570
850 Ga0500594_0000221
851 Ga0500595_006607
852 Ga0500608_000187
853 Ga0500608_001063
854 Ga0500618_002255
855 Ga0500642_0024324
856 Ga0500642_0053055
857 Ga0500655_024543
858 Ga0500658_0014910
859 Ga0500559_0000212
860 Ga0500559_0003398
861 Ga0500559_0008444
862 Ga0500559_0018941
863 Ga0500559_0058687
864 Ga0500564_000080
865 Ga0500573_0029580
866 Ga0500577_0001991
867 Ga0500590_004838
868 Ga0500616_0066166
869 Ga0500619_000501
870 Ga0500622_0002814
871 Ga0500622_0082362
872 Ga0500622_0135390
873 Ga0500624_002114
874 Ga0500638_061866
875 Ga0500636_0003639
876 Ga0500637_0029408
877 Ga0500625_057543
878 Ga0500645_040824
879 Ga0500596_001059
880 Ga0501082_0002053
881 Ga0501082_0006037
882 2511121125
883 2585148034
884 2585153931
885 2585194924
886 2587915351
887 2643747279
888 2643882524
889 2643924529
890 2643929935
891 2643998926
892 2644087047
893 2644223906
894 2644232892
895 2644342001
896 2644353476
897 2644368288
898 2644507523
899 2644549523
900 2644550574
901 2792458856
902 2819540451
903 2819649433
904 2843745791
905 2849562296
906 2849577217
907 2851153203
908 2857508048
909 2884963139
910 2898330400
911 2928534797
912 2928973460
913 2941486141
914 2977240561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00682

HMGL-like

HMGL-like

20

295

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mp5-assembly2.cif.gz_C crystal structure of human lyase r41m in complex with hmg-coa 0.9538 1 296
1ydo-assembly1.cif.gz_A crystal structure of the bacillis subtilis hmg-coa lyase, northeast structural genomics target sr181. 0.9535 3 290
3mp3-assembly2.cif.gz_D crystal structure of human lyase in complex with inhibitor hg-coa 0.9534 1 294
2cw6-assembly1.cif.gz_A crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria 0.9528 1 294
3mp4-assembly3.cif.gz_F crystal structure of human lyase r41m mutant 0.9522 1 294
ID Description Score Start End Superfamily
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9559 3 294 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9458 3 290 3.20.20.70
af_Q0JNR8_151_451_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.928 3 294 3.20.20.70
1ydoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9114 3 290 3.20.20.70
af_Q4DIQ4_8_322_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9015 1 284 3.20.20.70
ID Description Score Start End GO Terms
AF-D5VHR3-F1-model_v4 Pyruvate carboxyltransferase 0.9951 1 299 GO:0004419
GO:0006552
GO:0016740
GO:0046872
GO:0046951
AF-A0A7C1APX4-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9851 5 233 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A2E4CTX6-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9814 5 294 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A074MT89-F1-model_v4 3-hydroxy-3-methylglutaryl-CoA lyase 0.9789 1 295 GO:0004419
GO:0006552
GO:0046872
GO:0046951
AF-A0A7Y3C014-F1-model_v4 Hydroxymethylglutaryl-CoA lyase 0.9784 1 255 GO:0004419
GO:0006552
GO:0046872
GO:0046951

Map