F448047

General Info

Members Datasets Scaffolds Average Seq Length
457 293 914 399

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0053616|Ga0495638_0053616_71_1333
Length 420
Sequence MRQGPQRAAVDAQDVNQERNMTDAADGPLAGIRVVDLTRILAGPLCAMMLGDMGAEVIKVEPPEKGDDTRSWGPPFAGGEAAYFLGINRNKRSLTLNMAVPAGQKVLAGLIEKADVLIDNFRIGTLEKWGFTEAWFAQHAPRLVRCCITGYGTSGPKAALPGYDFILQAESGLMSICGEPDAGPTKYGVAIVDVCTGMLASNAILAAINARHRTGKGQKVELSLFETSLAMLINVAQNYLSAGRNGGRFGNGHPSIVPYTTYHAKDGMMAIGIGNERQFSRCADVLGHPEWAQDARFNSNRARVENRTVIDGLINEALSRDAANTWLDKLEAVGVPSGKINSVAEALDDPQTAARRMVETVEHPVIGTLKMLGIPFKFSDTACSVRRPPPTLGQHSDEILADELGLDAKAIAELRRDKIV

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
293 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.84
Nodule 0
Rhizoplane 7
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0053616 3300046460 Bacteria 2510
2 JGI24737J22298_10026275 3300001990 Bacteria 1838
3 JGI24743J22301_10002547 3300001991 Bacteria 2765
4 JGI24750J21931_1003317 3300002070 Bacteria 1929
5 JGI24744J21845_10011809 3300002077 Bacteria 1780
6 JGI24034J26672_10003798 3300002239 Bacteria 2118
7 JGI24742J22300_10001946 3300002244 Bacteria 3291
8 JGI24751J29686_10006054 3300002459 Bacteria 2462
9 Ga0070676_10057958 3300005328 Bacteria 2293
10 Ga0070670_100049225 3300005331 Bacteria 3624
11 Ga0070677_10066831 3300005333 Bacteria 1500
12 Ga0070680_100169101 3300005336 Bacteria 1839
13 Ga0068868_100008043 3300005338 Bacteria 7540
14 Ga0068868_100054962 3300005338 Bacteria 3140
15 Ga0068868_100194033 3300005338 Bacteria 1690
16 Ga0070689_100004199 3300005340 Bacteria 9718
17 Ga0070689_100078085 3300005340 Bacteria 2595
18 Ga0070689_100122826 3300005340 Bacteria 2075
19 Ga0070687_100007483 3300005343 Bacteria 4557
20 Ga0070661_100047228 3300005344 Bacteria 3150
21 Ga0070668_100083149 3300005347 Bacteria 2513
22 Ga0070669_100131187 3300005353 Bacteria 1923
23 Ga0070675_100026167 3300005354 Bacteria 4680
24 Ga0070675_100210751 3300005354 Bacteria 1689
25 Ga0070671_100000300 3300005355 Bacteria 33527
26 Ga0070674_100009612 3300005356 Bacteria 5798
27 Ga0070674_100086505 3300005356 Bacteria 2252
28 Ga0070673_100042375 3300005364 Bacteria 3509
29 Ga0070673_100113298 3300005364 Bacteria 2252
30 Ga0070688_100027992 3300005365 Bacteria 3360
31 Ga0070659_100109104 3300005366 Bacteria 2233
32 Ga0070667_100053883 3300005367 Bacteria 3395
33 Ga0070667_100302844 3300005367 Bacteria 1439
34 Ga0070709_10130827 3300005434 Bacteria 1713
35 Ga0070714_100020342 3300005435 Bacteria 5418
36 Ga0070714_100289925 3300005435 Bacteria 1523
37 Ga0070713_100001118 3300005436 Bacteria 17119
38 Ga0070713_100183461 3300005436 Bacteria 1882
39 Ga0070710_10039944 3300005437 Bacteria 2584
40 Ga0070711_100009093 3300005439 Bacteria 6106
41 Ga0070711_100298295 3300005439 Bacteria 1281
42 Ga0070705_100108875 3300005440 Bacteria 1766
43 Ga0070700_100052897 3300005441 Bacteria 2533
44 Ga0070694_100116000 3300005444 Bacteria 1915
45 Ga0070694_100156020 3300005444 Bacteria 1671
46 Ga0070694_100170459 3300005444 Bacteria 1603
47 Ga0070663_100078842 3300005455 Bacteria 2415
48 Ga0070662_100141774 3300005457 Bacteria 1863
49 Ga0070681_10076739 3300005458 Bacteria 3299
50 Ga0070685_10016429 3300005466 Bacteria 3943
51 Ga0070706_100051446 3300005467 Bacteria 3802
52 Ga0070707_100013367 3300005468 Bacteria 7677
53 Ga0070699_100001767 3300005518 Bacteria 19713
54 Ga0070699_100326070 3300005518 Bacteria 1380
55 Ga0068853_100218554 3300005539 Bacteria 1739
56 Ga0070672_100023021 3300005543 Bacteria 4586
57 Ga0070672_100040126 3300005543 Bacteria 3590
58 Ga0070672_100083663 3300005543 Bacteria 2561
59 Ga0070696_100046239 3300005546 Bacteria 3017
60 Ga0070665_100100913 3300005548 Bacteria 2890
61 Ga0070665_100278710 3300005548 Bacteria 1674
62 Ga0070664_100008885 3300005564 Bacteria 8140
63 Ga0070664_100225314 3300005564 Bacteria 1678
64 Ga0068854_100104880 3300005578 Bacteria 2124
65 Ga0070702_100031776 3300005615 Bacteria 2891
66 Ga0070702_100032552 3300005615 Bacteria 2862
67 Ga0068852_100003743 3300005616 Bacteria 10670
68 Ga0068859_100021098 3300005617 Bacteria 6536
69 Ga0068859_100113157 3300005617 Bacteria 2777
70 Ga0068859_100195415 3300005617 Bacteria 2107
71 Ga0068864_100011414 3300005618 Bacteria 7339
72 Ga0068864_100040562 3300005618 Bacteria 3982
73 Ga0068866_10033588 3300005718 Bacteria 2490
74 Ga0068861_100101543 3300005719 Bacteria 2288
75 Ga0068851_10004587 3300005834 Bacteria 6229
76 Ga0068851_10027800 3300005834 Bacteria 2790
77 Ga0068870_10003929 3300005840 Bacteria 6343
78 Ga0068870_10057999 3300005840 Bacteria 2072
79 Ga0068863_100004195 3300005841 Bacteria 14237
80 Ga0068863_100081683 3300005841 Bacteria 3062
81 Ga0068858_100025205 3300005842 Bacteria 5534
82 Ga0068858_100110360 3300005842 Bacteria 2568
83 Ga0068858_100303818 3300005842 Bacteria 1523
84 Ga0068860_100036041 3300005843 Bacteria 4742
85 Ga0068860_100074247 3300005843 Bacteria 3233
86 Ga0068860_100088838 3300005843 Bacteria 2942
87 Ga0068862_100092349 3300005844 Bacteria 2638
88 Ga0068862_100102880 3300005844 Bacteria 2500
89 Ga0068862_100107519 3300005844 Bacteria 2446
90 Ga0081455_10003366 3300005937 Bacteria 18434
91 Ga0081455_10165239 3300005937 Bacteria 1692
92 Ga0081455_10199174 3300005937 Bacteria 1501
93 Ga0081538_10039700 3300005981 Bacteria 3014
94 Ga0081538_10068929 3300005981 Bacteria 1963
95 Ga0081540_1028458 3300005983 Bacteria 3138
96 Ga0081539_10052073 3300005985 Bacteria 2302
97 Ga0070717_10001698 3300006028 Bacteria 15327
98 Ga0070717_10187815 3300006028 Bacteria 1804
99 Ga0070717_10243950 3300006028 Bacteria 1585
100 Ga0075365_10032440 3300006038 Bacteria 3357
101 Ga0075364_10074045 3300006051 Bacteria 2245
102 Ga0070715_10000121 3300006163 Bacteria 18586
103 Ga0070715_10017913 3300006163 Bacteria 2690
104 Ga0070712_100007003 3300006175 Bacteria 7028
105 Ga0070712_100007314 3300006175 Bacteria 6891
106 Ga0070712_100050943 3300006175 Bacteria 2883
107 Ga0070712_100242564 3300006175 Bacteria 1436
108 Ga0075367_10133331 3300006178 Bacteria 1536
109 Ga0097621_100002039 3300006237 Bacteria 13826
110 Ga0097621_100134351 3300006237 Bacteria 2109
111 Ga0075370_10081835 3300006353 Bacteria 1856
112 Ga0068871_100012472 3300006358 Bacteria 6267
113 Ga0075428_100068448 3300006844 Bacteria 3883
114 Ga0075431_100286153 3300006847 Bacteria 1668
115 Ga0075433_10143168 3300006852 Bacteria 2125
116 Ga0075434_100014909 3300006871 Bacteria 7436
117 Ga0075434_100017704 3300006871 Bacteria 6869
118 Ga0075434_100066481 3300006871 Bacteria 3591
119 Ga0075434_100141092 3300006871 Bacteria 2429
120 Ga0075434_100251222 3300006871 Bacteria 1787
121 Ga0075429_100053269 3300006880 Bacteria 3521
122 Ga0075436_100014883 3300006914 Bacteria 5330
123 Ga0075436_100130245 3300006914 Bacteria 1764
124 Ga0097620_100021098 3300006931 Bacteria 6536
125 Ga0097620_100113155 3300006931 Bacteria 2777
126 Ga0097620_100195423 3300006931 Bacteria 2107
127 Ga0075435_100012478 3300007076 Bacteria 6296
128 Ga0075435_100022455 3300007076 Bacteria 4869
129 Ga0075435_100049849 3300007076 Bacteria 3369
130 Ga0075435_100311152 3300007076 Bacteria 1348
131 Ga0099795_10020323 3300007788 Bacteria 2161
132 Ga0105245_10174195 3300009098 Bacteria 2051
133 Ga0105247_10054380 3300009101 Bacteria 2470
134 Ga0114129_10425287 3300009147 Bacteria 1746
135 Ga0105243_10070355 3300009148 Bacteria 2825
136 Ga0105243_10092024 3300009148 Bacteria 2499
137 Ga0105243_10143842 3300009148 Bacteria 2038
138 Ga0105241_10296337 3300009174 Bacteria 1386
139 Ga0105242_10157185 3300009176 Bacteria 1987
140 Ga0105242_10199035 3300009176 Bacteria 1778
141 Ga0105248_10034614 3300009177 Bacteria 5650
142 Ga0105248_10069186 3300009177 Bacteria 3963
143 Ga0105237_10086091 3300009545 Bacteria 3132
144 Ga0105249_10074240 3300009553 Bacteria 3147
145 Ga0099796_10015601 3300010159 Bacteria 2224
146 Ga0105246_10051825 3300011119 Bacteria 2819
147 Ga0157374_10012872 3300013296 Bacteria 7288
148 Ga0157374_10114874 3300013296 Bacteria 2592
149 Ga0163162_10092910 3300013306 Bacteria 3101
150 Ga0163162_10204990 3300013306 Bacteria 2101
151 Ga0163162_10437770 3300013306 Bacteria 1440
152 Ga0157372_10477358 3300013307 Bacteria 1454
153 Ga0157375_10001169 3300013308 Bacteria 22673
154 Ga0157375_10120517 3300013308 Bacteria 2732
155 Ga0163163_10079409 3300014325 Bacteria 3279
156 Ga0157380_10276160 3300014326 Bacteria 1535
157 Ga0157377_10054704 3300014745 Bacteria 2260
158 Ga0157379_10114106 3300014968 Bacteria 2429
159 Ga0157376_10001887 3300014969 Bacteria 13994
160 Ga0157376_10032852 3300014969 Bacteria 4171
161 Ga0207697_10003576 3300025315 Bacteria 7633
162 Ga0207656_10018107 3300025321 Bacteria 2767
163 Ga0207682_10001511 3300025893 Bacteria 10719
164 Ga0207692_10000094 3300025898 Bacteria 26409
165 Ga0207688_10004877 3300025901 Bacteria 7306
166 Ga0207688_10004927 3300025901 Bacteria 7268
167 Ga0207699_10001528 3300025906 Bacteria 10993
168 Ga0207645_10005074 3300025907 Bacteria 9644
169 Ga0207645_10014577 3300025907 Bacteria 5256
170 Ga0207643_10002011 3300025908 Bacteria 11215
171 Ga0207643_10009486 3300025908 Bacteria 5228
172 Ga0207643_10026005 3300025908 Bacteria 3238
173 Ga0207684_10025147 3300025910 Bacteria 5075
174 Ga0207684_10059838 3300025910 Bacteria 3234
175 Ga0207693_10028287 3300025915 Bacteria 4429
176 Ga0207663_10000575 3300025916 Bacteria 16196
177 Ga0207660_10141593 3300025917 Bacteria 1839
178 Ga0207662_10022992 3300025918 Bacteria 3577
179 Ga0207657_10011199 3300025919 Bacteria 8918
180 Ga0207650_10003884 3300025925 Bacteria 10213
181 Ga0207650_10005131 3300025925 Bacteria 8939
182 Ga0207650_10005501 3300025925 Bacteria 8646
183 Ga0207650_10114614 3300025925 Bacteria 2091
184 Ga0207659_10014324 3300025926 Bacteria 5109
185 Ga0207687_10144708 3300025927 Bacteria 1807
186 Ga0207700_10001250 3300025928 Bacteria 14470
187 Ga0207700_10157933 3300025928 Bacteria 1881
188 Ga0207664_10008766 3300025929 Bacteria 7074
189 Ga0207644_10001670 3300025931 Bacteria 14299
190 Ga0207644_10043189 3300025931 Bacteria 3198
191 Ga0207644_10103659 3300025931 Bacteria 2141
192 Ga0207706_10003946 3300025933 Bacteria 14052
193 Ga0207706_10024665 3300025933 Bacteria 5389
194 Ga0207709_10050801 3300025935 Bacteria 2538
195 Ga0207670_10002147 3300025936 Bacteria 10322
196 Ga0207670_10020217 3300025936 Bacteria 4086
197 Ga0207665_10014206 3300025939 Bacteria 5239
198 Ga0207691_10004730 3300025940 Bacteria 13163
199 Ga0207691_10013898 3300025940 Bacteria 7682
200 Ga0207711_10011553 3300025941 Bacteria 7339
201 Ga0207711_10169259 3300025941 Bacteria 1982
202 Ga0207711_10251416 3300025941 Bacteria 1623
203 Ga0207689_10053535 3300025942 Bacteria 3325
204 Ga0207661_10001569 3300025944 Bacteria 15561
205 Ga0207679_10025917 3300025945 Bacteria 4038
206 Ga0207679_10341958 3300025945 Bacteria 1301
207 Ga0207651_10031431 3300025960 Bacteria 3394
208 Ga0207651_10039235 3300025960 Bacteria 3121
209 Ga0207712_10189666 3300025961 Bacteria 1622
210 Ga0207640_10005836 3300025981 Bacteria 6715
211 Ga0207658_10202701 3300025986 Bacteria 1657
212 Ga0207677_10024864 3300026023 Bacteria 3727
213 Ga0207677_10193676 3300026023 Bacteria 1610
214 Ga0207703_10058370 3300026035 Bacteria 3149
215 Ga0207703_10140060 3300026035 Bacteria 2098
216 Ga0207639_10169306 3300026041 Bacteria 1848
217 Ga0207678_10004984 3300026067 Bacteria 11909
218 Ga0207708_10009013 3300026075 Bacteria 7383
219 Ga0207641_10159865 3300026088 Bacteria 2047
220 Ga0207648_10003508 3300026089 Bacteria 16430
221 Ga0207648_10013527 3300026089 Bacteria 7587
222 Ga0207648_10032571 3300026089 Bacteria 4601
223 Ga0207676_10002927 3300026095 Bacteria 12167
224 Ga0207676_10027913 3300026095 Bacteria 4210
225 Ga0207674_10045265 3300026116 Bacteria 4528
226 Ga0207675_100004086 3300026118 Bacteria 14123
227 Ga0207675_100040409 3300026118 Bacteria 4356
228 Ga0207683_10021311 3300026121 Bacteria 5546
229 Ga0207683_10233784 3300026121 Bacteria 1676
230 Ga0207698_10078487 3300026142 Bacteria 2651
231 Ga0209967_1003111 3300027364 Bacteria 2176
232 Ga0210000_1002424 3300027462 Bacteria 2655
233 Ga0209179_1005309 3300027512 Bacteria 2008
234 Ga0209999_1001681 3300027543 Bacteria 3824
235 Ga0209971_1007414 3300027682 Bacteria 2603
236 Ga0209974_10017255 3300027876 Bacteria 2394
237 Ga0268266_10277088 3300028379 Bacteria 1558
238 Ga0268265_10059589 3300028380 Bacteria 2921
239 Ga0268264_10027876 3300028381 Bacteria 4617
240 Ga0268264_10249110 3300028381 Bacteria 1649
241 Ga0265318_10001811 3300028577 Bacteria 12134
242 Ga0265332_10000398 3300031238 Bacteria 31536
243 Ga0265328_10000942 3300031239 Bacteria 13365
244 Ga0265320_10011094 3300031240 Bacteria 5319
245 Ga0265329_10005310 3300031242 Bacteria 5220
246 Ga0265331_10006511 3300031250 Bacteria 6890
247 Ga0265327_10017067 3300031251 Bacteria 4573
248 Ga0265313_10009534 3300031595 Bacteria 6287
249 Ga0265314_10001136 3300031711 Bacteria 30842
250 Ga0265342_10004252 3300031712 Bacteria 11345
251 Ga0307412_10048368 3300031911 Bacteria 2797
252 Ga0307416_100038676 3300032002 Bacteria 3683
253 Ga0373944_0006545 3300035089 Bacteria 3095
254 Ga0373944_0024443 3300035089 Bacteria 1771
255 Ga0373923_0019294 3300035111 Bacteria 2638
256 Ga0373936_0003445 3300035113 Bacteria 5935
257 Ga0373945_0008127 3300035116 Bacteria 3410
258 Ga0373953_0001299 3300035117 Bacteria 7150
259 Ga0373954_0004178 3300035118 Bacteria 6187
260 Ga0373957_0005068 3300035120 Bacteria 4065
261 Ga0373943_0005632 3300035170 Bacteria 5620
262 Ga0373943_0079494 3300035170 Bacteria 1679
263 Ga0373955_0009864 3300035172 Bacteria 4492
264 Ga0373962_0020945 3300035242 Bacteria 1722
265 Ga0373935_0001178 3300035692 Bacteria 14357
266 Ga0373935_0046780 3300035692 Bacteria 2734
267 Ga0373935_0110687 3300035692 Bacteria 1822
268 Ga0373927_0005718 3300035695 Bacteria 8537
269 Ga0373927_0036247 3300035695 Bacteria 3208
270 Ga0373927_0069549 3300035695 Bacteria 2278
271 Ga0373947_0000263 3300035725 Bacteria 29768
272 Ga0373947_0055576 3300035725 Bacteria 2391
273 Ga0373937_0000079 3300036401 Bacteria 88626
274 Ga0316584_0121065 3300036712 Bacteria 1956
275 Ga0373925_0000007 3300037068 Bacteria 257023
276 Ga0373925_0088688 3300037068 Bacteria 2362
277 Ga0395898_0069497 3300037466 Bacteria 3407
278 Ga0395905_0240649 3300037471 Bacteria 1691
279 Ga0436364_0340838 3300037853 Bacteria 1880
280 Ga0436361_0966173 3300039447 Bacteria 6649
281 Ga0451853_3298148 3300041512 Bacteria 2786
282 Ga0453683_0065111 3300044673 Bacteria 2279
283 Ga0466967_0141234 3300045976 Bacteria 2243
284 Ga0495592_0000218 3300046454 Bacteria 49259
285 Ga0495603_0046787 3300046455 Bacteria 2577
286 Ga0495590_0028705 3300046457 Bacteria 1951
287 Ga0495629_0004979 3300046459 Bacteria 9966
288 Ga0495629_0057920 3300046459 Bacteria 2708
289 Ga0495651_0000435 3300046462 Bacteria 32200
290 Ga0495653_0000034 3300046463 Bacteria 131084
291 Ga0495662_0002927 3300046476 Bacteria 8619
292 Ga0495664_0000003 3300046477 Bacteria 551602
293 Ga0495584_0024250 3300046491 Bacteria 3076
294 Ga0495585_0072317 3300046492 Bacteria 1879
295 Ga0495608_0000110 3300046511 Bacteria 58344
296 Ga0495616_0093832 3300046513 Bacteria 1417
297 Ga0495618_0000018 3300046514 Bacteria 139407
298 Ga0495628_0000001 3300046516 Bacteria 917742
299 Ga0495630_0006605 3300046517 Bacteria 8267
300 Ga0495652_0000006 3300046529 Bacteria 459709
301 Ga0495640_0000002 3300046533 Bacteria 646434
302 Ga0495640_0093996 3300046533 Bacteria 1975
303 Ga0495587_0000001 3300046536 Bacteria 724132
304 Ga0495598_0004653 3300046537 Bacteria 2985
305 Ga0495645_0000009 3300046543 Bacteria 239632
306 Ga0495645_0148784 3300046543 Bacteria 1629
307 Ga0495633_0067472 3300046558 Bacteria 1670
308 Ga0495667_0000004 3300046559 Bacteria 295297
309 Ga0495656_0031450 3300046615 Bacteria 2153
310 Ga0495656_0079618 3300046615 Bacteria 1475
311 Ga0495634_0000014 3300046642 Bacteria 128091
312 Ga0495634_0074937 3300046642 Bacteria 2223
313 Ga0495635_0000001 3300046663 Bacteria 704901
314 Ga0495657_0000107 3300046675 Bacteria 74571
315 Ga0495599_0000053 3300046678 Bacteria 80559
316 Ga0495623_0000018 3300046679 Bacteria 107338
317 Ga0495646_0000020 3300046680 Bacteria 117021
318 Ga0495658_0110636 3300046683 Bacteria 1651
319 Ga0495613_0012532 3300046689 Bacteria 6301
320 Ga0495613_0049751 3300046689 Bacteria 3092
321 Ga0495613_0090437 3300046689 Bacteria 2217
322 Ga0495624_0064478 3300046690 Bacteria 2289
323 Ga0495670_0098776 3300046691 Bacteria 1502
324 Ga0495600_0000025 3300046809 Bacteria 92167
325 Ga0495581_0022639 3300047315 Bacteria 3640
326 Ga0495604_0000008 3300047317 Bacteria 341160
327 Ga0495674_0000016 3300047319 Bacteria 216763
328 Ga0495674_0307548 3300047319 Bacteria 1294
329 Ga0495680_0000146 3300047322 Bacteria 70936
330 Ga0495675_0000045 3300047444 Bacteria 82813
331 Ga0495684_0000002 3300047471 Bacteria 341216
332 Ga0495593_0002121 3300047673 Bacteria 11857
333 Ga0495602_0000022 3300048088 Bacteria 163672
334 Ga0496101_0011233 3300048904 Bacteria 5932
335 Ga0496101_0065697 3300048904 Bacteria 2645
336 Ga0496102_0029566 3300048905 Bacteria 4903
337 Ga0496103_0084485 3300048906 Bacteria 1999
338 Ga0496103_0198809 3300048906 Bacteria 1289
339 Ga0496104_0002329 3300048907 Bacteria 16416
340 Ga0496104_0007883 3300048907 Bacteria 9444
341 Ga0496104_0109415 3300048907 Bacteria 2648
342 Ga0496105_0004341 3300048908 Bacteria 10684
343 Ga0496105_0013627 3300048908 Bacteria 6455
344 Ga0496105_0016986 3300048908 Bacteria 5822
345 Ga0496106_0025581 3300048909 Bacteria 4393
346 Ga0496107_0145006 3300048910 Bacteria 1755
347 Ga0496108_0000594 3300048911 Bacteria 28348
348 Ga0496109_0001206 3300048912 Bacteria 21513
349 Ga0496109_0085846 3300048912 Bacteria 2906
350 Ga0496109_0122199 3300048912 Bacteria 2426
351 Ga0496110_0010664 3300048913 Bacteria 7481
352 Ga0496110_0043615 3300048913 Bacteria 3917
353 Ga0496110_0047417 3300048913 Bacteria 3762
354 Ga0496110_0081243 3300048913 Bacteria 2889
355 Ga0496110_0100145 3300048913 Bacteria 2597
356 Ga0496111_0003701 3300048914 Bacteria 9506
357 Ga0496111_0014201 3300048914 Bacteria 5435
358 Ga0496111_0015821 3300048914 Bacteria 5188
359 Ga0496112_0008642 3300048915 Bacteria 9130
360 Ga0496112_0174515 3300048915 Bacteria 2114
361 Ga0496112_0231137 3300048915 Bacteria 1804
362 Ga0496113_0004693 3300048916 Bacteria 8429
363 Ga0496113_0058107 3300048916 Bacteria 2909
364 Ga0496113_0231540 3300048916 Bacteria 1473
365 Ga0496114_0020604 3300048917 Bacteria 5352
366 Ga0496121_0000104 3300048924 Bacteria 192186
367 Ga0501031_0085713 3300049568 Bacteria 2054
368 Ga0501034_0057145 3300049571 Bacteria 3923
369 Ga0501034_0108166 3300049571 Bacteria 2772
370 Ga0501036_0005516 3300049572 Bacteria 10259
371 Ga0501038_0098857 3300049574 Bacteria 2433
372 Ga0501038_0285491 3300049574 Bacteria 1298
373 Ga0501039_0040654 3300049575 Bacteria 3589
374 Ga0501040_0007820 3300049576 Bacteria 6923
375 Ga0501040_0034881 3300049576 Bacteria 3409
376 Ga0501041_0002937 3300049577 Bacteria 9782
377 Ga0501041_0090051 3300049577 Bacteria 1894
378 Ga0501042_0001214 3300049578 Bacteria 14956
379 Ga0501042_0066604 3300049578 Bacteria 2575
380 Ga0501042_0079661 3300049578 Bacteria 2347
381 Ga0501043_0081842 3300049579 Bacteria 2537
382 Ga0501046_0018667 3300049580 Bacteria 5764
383 Ga0501048_0022935 3300049582 Bacteria 4562
384 Ga0501068_0008397 3300049584 Bacteria 5745
385 Ga0501071_0004305 3300049587 Bacteria 9021
386 Ga0501071_0231385 3300049587 Bacteria 1392
387 Ga0501072_0006332 3300049588 Bacteria 9014
388 Ga0501074_0151352 3300049590 Bacteria 1658
389 Ga0501075_0035193 3300049591 Bacteria 3733
390 Ga0501075_0040018 3300049591 Bacteria 3509
391 Ga0501075_0085534 3300049591 Bacteria 2389
392 Ga0501076_0009343 3300049592 Bacteria 7237
393 Ga0501076_0014540 3300049592 Bacteria 5931
394 Ga0501076_0106474 3300049592 Bacteria 2264
395 Ga0501077_0034671 3300049593 Bacteria 3212
396 Ga0501079_0012111 3300049741 Bacteria 6583
397 Ga0501079_0047220 3300049741 Bacteria 3322
398 Ga0501079_0093119 3300049741 Bacteria 2335
399 Ga0501079_0156170 3300049741 Bacteria 1778
400 Ga0501080_0015510 3300049742 Bacteria 7025
401 Ga0501080_0030310 3300049742 Bacteria 5039
402 Ga0501080_0102772 3300049742 Bacteria 2651
403 Ga0501081_0015967 3300049743 Bacteria 4958
404 Ga0501081_0024223 3300049743 Bacteria 4074
405 Ga0501081_0084341 3300049743 Bacteria 2228
406 Ga0501081_0150686 3300049743 Bacteria 1670
407 Ga0501083_0100165 3300049744 Bacteria 1910
408 Ga0501045_0006372 3300049824 Bacteria 8169
409 nmdc:mga03683_117694_c1 3300050489 Bacteria 1179
410 nmdc:mga03n38_85277_c1 3300050490 Bacteria 1493
411 nmdc:mga0yw44_15374_c1 3300050492 Bacteria 4097
412 nmdc:mga06z11_59174_c1 3300050494 Bacteria 1991
413 nmdc:mga06z11_81023_c1 3300050494 Bacteria 1742
414 nmdc:mga05p37_172218_c1 3300050507 Bacteria 2639
415 nmdc:mga05p37_207687_c1 3300050507 Bacteria 2368
416 nmdc:mga05p37_33790_c1 3300050507 Bacteria 6264
417 nmdc:mga05p37_82200_c1 3300050507 Bacteria 3969
418 nmdc:mga09592_20241_c1 3300050508 Bacteria 5468
419 nmdc:mga0qj67_24408_c2 3300050509 Bacteria 2663
420 nmdc:mga0qj67_8173_c1 3300050509 Bacteria 7754
421 nmdc:mga06r32_462207_c1 3300050510 Bacteria 1248
422 nmdc:mga06r32_6689_c1 3300050510 Bacteria 10361
423 nmdc:mga0n895_10943_c1 3300050512 Bacteria 8061
424 nmdc:mga0n895_156815_c1 3300050512 Bacteria 2307
425 nmdc:mga0n895_185510_c1 3300050512 Bacteria 2111
426 nmdc:mga0n895_311260_c1 3300050512 Bacteria 1596
427 nmdc:mga0n895_44882_c1 3300050512 Bacteria 4310
428 nmdc:mga0rr50_84003_c1 3300050513 Bacteria 2464
429 nmdc:mga0rr50_91680_c1 3300050513 Bacteria 2367
430 nmdc:mga08x19_141508_c1 3300050514 Bacteria 1625
431 nmdc:mga08x19_948_c1 3300050514 Bacteria 18250
432 nmdc:mga0a205_112056_c1 3300050515 Bacteria 2627
433 nmdc:mga0a205_153913_c1 3300050515 Bacteria 2198
434 nmdc:mga0a205_315239_c1 3300050515 Bacteria 1435
435 Ga0495601_0000001 3300053077 Bacteria 549454
436 Ga0495601_0003222 3300053077 Bacteria 9333
437 Ga0495612_0000003 3300053078 Bacteria 303629
438 Ga0495595_0000105 3300053084 Bacteria 38352
439 Ga0495595_0040604 3300053084 Bacteria 2127
440 Ga0495619_0000004 3300053085 Bacteria 500068
441 Ga0495619_0135631 3300053085 Bacteria 1693
442 Ga0495619_0226097 3300053085 Bacteria 1296
443 Ga0500641_0055296 3300053096 Bacteria 1643
444 Ga0500595_000001 3300053119 Bacteria 1088438
445 Ga0500595_003691 3300053119 Bacteria 7071
446 Ga0500645_000087 3300053730 Bacteria 74431
447 Ga0501084_0022832 3300054114 Bacteria 5220
448 Ga0501084_0122517 3300054114 Bacteria 2187
449 Ga0501082_0004689 3300060353 Bacteria 11917
450 Ga0501082_0028658 3300060353 Bacteria 4796
451 Ga0501082_0076203 3300060353 Bacteria 2891
452 Ga0530510_0000130 3300061734 Bacteria 43520
453 Ga0530510_0003152 3300061734 Bacteria 11322
454 Ga0530510_0011769 3300061734 Bacteria 6139
455 Ga0530510_0033732 3300061734 Bacteria 3685
456 2929203180 2929199973 Bacteria 7260745
457 8055916239 8055909800 Bacteria 7278581
458 Ga0495638_0053616
459 JGI24737J22298_10026275
460 JGI24743J22301_10002547
461 JGI24750J21931_1003317
462 JGI24744J21845_10011809
463 JGI24034J26672_10003798
464 JGI24742J22300_10001946
465 JGI24751J29686_10006054
466 Ga0070676_10057958
467 Ga0070670_100049225
468 Ga0070677_10066831
469 Ga0070680_100169101
470 Ga0068868_100008043
471 Ga0068868_100054962
472 Ga0068868_100194033
473 Ga0070689_100004199
474 Ga0070689_100078085
475 Ga0070689_100122826
476 Ga0070687_100007483
477 Ga0070661_100047228
478 Ga0070668_100083149
479 Ga0070669_100131187
480 Ga0070675_100026167
481 Ga0070675_100210751
482 Ga0070671_100000300
483 Ga0070674_100009612
484 Ga0070674_100086505
485 Ga0070673_100042375
486 Ga0070673_100113298
487 Ga0070688_100027992
488 Ga0070659_100109104
489 Ga0070667_100053883
490 Ga0070667_100302844
491 Ga0070709_10130827
492 Ga0070714_100020342
493 Ga0070714_100289925
494 Ga0070713_100001118
495 Ga0070713_100183461
496 Ga0070710_10039944
497 Ga0070711_100009093
498 Ga0070711_100298295
499 Ga0070705_100108875
500 Ga0070700_100052897
501 Ga0070694_100116000
502 Ga0070694_100156020
503 Ga0070694_100170459
504 Ga0070663_100078842
505 Ga0070662_100141774
506 Ga0070681_10076739
507 Ga0070685_10016429
508 Ga0070706_100051446
509 Ga0070707_100013367
510 Ga0070699_100001767
511 Ga0070699_100326070
512 Ga0068853_100218554
513 Ga0070672_100023021
514 Ga0070672_100040126
515 Ga0070672_100083663
516 Ga0070696_100046239
517 Ga0070665_100100913
518 Ga0070665_100278710
519 Ga0070664_100008885
520 Ga0070664_100225314
521 Ga0068854_100104880
522 Ga0070702_100031776
523 Ga0070702_100032552
524 Ga0068852_100003743
525 Ga0068859_100021098
526 Ga0068859_100113157
527 Ga0068859_100195415
528 Ga0068864_100011414
529 Ga0068864_100040562
530 Ga0068866_10033588
531 Ga0068861_100101543
532 Ga0068851_10004587
533 Ga0068851_10027800
534 Ga0068870_10003929
535 Ga0068870_10057999
536 Ga0068863_100004195
537 Ga0068863_100081683
538 Ga0068858_100025205
539 Ga0068858_100110360
540 Ga0068858_100303818
541 Ga0068860_100036041
542 Ga0068860_100074247
543 Ga0068860_100088838
544 Ga0068862_100092349
545 Ga0068862_100102880
546 Ga0068862_100107519
547 Ga0081455_10003366
548 Ga0081455_10165239
549 Ga0081455_10199174
550 Ga0081538_10039700
551 Ga0081538_10068929
552 Ga0081540_1028458
553 Ga0081539_10052073
554 Ga0070717_10001698
555 Ga0070717_10187815
556 Ga0070717_10243950
557 Ga0075365_10032440
558 Ga0075364_10074045
559 Ga0070715_10000121
560 Ga0070715_10017913
561 Ga0070712_100007003
562 Ga0070712_100007314
563 Ga0070712_100050943
564 Ga0070712_100242564
565 Ga0075367_10133331
566 Ga0097621_100002039
567 Ga0097621_100134351
568 Ga0075370_10081835
569 Ga0068871_100012472
570 Ga0075428_100068448
571 Ga0075431_100286153
572 Ga0075433_10143168
573 Ga0075434_100014909
574 Ga0075434_100017704
575 Ga0075434_100066481
576 Ga0075434_100141092
577 Ga0075434_100251222
578 Ga0075429_100053269
579 Ga0075436_100014883
580 Ga0075436_100130245
581 Ga0097620_100021098
582 Ga0097620_100113155
583 Ga0097620_100195423
584 Ga0075435_100012478
585 Ga0075435_100022455
586 Ga0075435_100049849
587 Ga0075435_100311152
588 Ga0099795_10020323
589 Ga0105245_10174195
590 Ga0105247_10054380
591 Ga0114129_10425287
592 Ga0105243_10070355
593 Ga0105243_10092024
594 Ga0105243_10143842
595 Ga0105241_10296337
596 Ga0105242_10157185
597 Ga0105242_10199035
598 Ga0105248_10034614
599 Ga0105248_10069186
600 Ga0105237_10086091
601 Ga0105249_10074240
602 Ga0099796_10015601
603 Ga0105246_10051825
604 Ga0157374_10012872
605 Ga0157374_10114874
606 Ga0163162_10092910
607 Ga0163162_10204990
608 Ga0163162_10437770
609 Ga0157372_10477358
610 Ga0157375_10001169
611 Ga0157375_10120517
612 Ga0163163_10079409
613 Ga0157380_10276160
614 Ga0157377_10054704
615 Ga0157379_10114106
616 Ga0157376_10001887
617 Ga0157376_10032852
618 Ga0207697_10003576
619 Ga0207656_10018107
620 Ga0207682_10001511
621 Ga0207692_10000094
622 Ga0207688_10004877
623 Ga0207688_10004927
624 Ga0207699_10001528
625 Ga0207645_10005074
626 Ga0207645_10014577
627 Ga0207643_10002011
628 Ga0207643_10009486
629 Ga0207643_10026005
630 Ga0207684_10025147
631 Ga0207684_10059838
632 Ga0207693_10028287
633 Ga0207663_10000575
634 Ga0207660_10141593
635 Ga0207662_10022992
636 Ga0207657_10011199
637 Ga0207650_10003884
638 Ga0207650_10005131
639 Ga0207650_10005501
640 Ga0207650_10114614
641 Ga0207659_10014324
642 Ga0207687_10144708
643 Ga0207700_10001250
644 Ga0207700_10157933
645 Ga0207664_10008766
646 Ga0207644_10001670
647 Ga0207644_10043189
648 Ga0207644_10103659
649 Ga0207706_10003946
650 Ga0207706_10024665
651 Ga0207709_10050801
652 Ga0207670_10002147
653 Ga0207670_10020217
654 Ga0207665_10014206
655 Ga0207691_10004730
656 Ga0207691_10013898
657 Ga0207711_10011553
658 Ga0207711_10169259
659 Ga0207711_10251416
660 Ga0207689_10053535
661 Ga0207661_10001569
662 Ga0207679_10025917
663 Ga0207679_10341958
664 Ga0207651_10031431
665 Ga0207651_10039235
666 Ga0207712_10189666
667 Ga0207640_10005836
668 Ga0207658_10202701
669 Ga0207677_10024864
670 Ga0207677_10193676
671 Ga0207703_10058370
672 Ga0207703_10140060
673 Ga0207639_10169306
674 Ga0207678_10004984
675 Ga0207708_10009013
676 Ga0207641_10159865
677 Ga0207648_10003508
678 Ga0207648_10013527
679 Ga0207648_10032571
680 Ga0207676_10002927
681 Ga0207676_10027913
682 Ga0207674_10045265
683 Ga0207675_100004086
684 Ga0207675_100040409
685 Ga0207683_10021311
686 Ga0207683_10233784
687 Ga0207698_10078487
688 Ga0209967_1003111
689 Ga0210000_1002424
690 Ga0209179_1005309
691 Ga0209999_1001681
692 Ga0209971_1007414
693 Ga0209974_10017255
694 Ga0268266_10277088
695 Ga0268265_10059589
696 Ga0268264_10027876
697 Ga0268264_10249110
698 Ga0265318_10001811
699 Ga0265332_10000398
700 Ga0265328_10000942
701 Ga0265320_10011094
702 Ga0265329_10005310
703 Ga0265331_10006511
704 Ga0265327_10017067
705 Ga0265313_10009534
706 Ga0265314_10001136
707 Ga0265342_10004252
708 Ga0307412_10048368
709 Ga0307416_100038676
710 Ga0373944_0006545
711 Ga0373944_0024443
712 Ga0373923_0019294
713 Ga0373936_0003445
714 Ga0373945_0008127
715 Ga0373953_0001299
716 Ga0373954_0004178
717 Ga0373957_0005068
718 Ga0373943_0005632
719 Ga0373943_0079494
720 Ga0373955_0009864
721 Ga0373962_0020945
722 Ga0373935_0001178
723 Ga0373935_0046780
724 Ga0373935_0110687
725 Ga0373927_0005718
726 Ga0373927_0036247
727 Ga0373927_0069549
728 Ga0373947_0000263
729 Ga0373947_0055576
730 Ga0373937_0000079
731 Ga0316584_0121065
732 Ga0373925_0000007
733 Ga0373925_0088688
734 Ga0395898_0069497
735 Ga0395905_0240649
736 Ga0436364_0340838
737 Ga0436361_0966173
738 Ga0451853_3298148
739 Ga0453683_0065111
740 Ga0466967_0141234
741 Ga0495592_0000218
742 Ga0495603_0046787
743 Ga0495590_0028705
744 Ga0495629_0004979
745 Ga0495629_0057920
746 Ga0495651_0000435
747 Ga0495653_0000034
748 Ga0495662_0002927
749 Ga0495664_0000003
750 Ga0495584_0024250
751 Ga0495585_0072317
752 Ga0495608_0000110
753 Ga0495616_0093832
754 Ga0495618_0000018
755 Ga0495628_0000001
756 Ga0495630_0006605
757 Ga0495652_0000006
758 Ga0495640_0000002
759 Ga0495640_0093996
760 Ga0495587_0000001
761 Ga0495598_0004653
762 Ga0495645_0000009
763 Ga0495645_0148784
764 Ga0495633_0067472
765 Ga0495667_0000004
766 Ga0495656_0031450
767 Ga0495656_0079618
768 Ga0495634_0000014
769 Ga0495634_0074937
770 Ga0495635_0000001
771 Ga0495657_0000107
772 Ga0495599_0000053
773 Ga0495623_0000018
774 Ga0495646_0000020
775 Ga0495658_0110636
776 Ga0495613_0012532
777 Ga0495613_0049751
778 Ga0495613_0090437
779 Ga0495624_0064478
780 Ga0495670_0098776
781 Ga0495600_0000025
782 Ga0495581_0022639
783 Ga0495604_0000008
784 Ga0495674_0000016
785 Ga0495674_0307548
786 Ga0495680_0000146
787 Ga0495675_0000045
788 Ga0495684_0000002
789 Ga0495593_0002121
790 Ga0495602_0000022
791 Ga0496101_0011233
792 Ga0496101_0065697
793 Ga0496102_0029566
794 Ga0496103_0084485
795 Ga0496103_0198809
796 Ga0496104_0002329
797 Ga0496104_0007883
798 Ga0496104_0109415
799 Ga0496105_0004341
800 Ga0496105_0013627
801 Ga0496105_0016986
802 Ga0496106_0025581
803 Ga0496107_0145006
804 Ga0496108_0000594
805 Ga0496109_0001206
806 Ga0496109_0085846
807 Ga0496109_0122199
808 Ga0496110_0010664
809 Ga0496110_0043615
810 Ga0496110_0047417
811 Ga0496110_0081243
812 Ga0496110_0100145
813 Ga0496111_0003701
814 Ga0496111_0014201
815 Ga0496111_0015821
816 Ga0496112_0008642
817 Ga0496112_0174515
818 Ga0496112_0231137
819 Ga0496113_0004693
820 Ga0496113_0058107
821 Ga0496113_0231540
822 Ga0496114_0020604
823 Ga0496121_0000104
824 Ga0501031_0085713
825 Ga0501034_0057145
826 Ga0501034_0108166
827 Ga0501036_0005516
828 Ga0501038_0098857
829 Ga0501038_0285491
830 Ga0501039_0040654
831 Ga0501040_0007820
832 Ga0501040_0034881
833 Ga0501041_0002937
834 Ga0501041_0090051
835 Ga0501042_0001214
836 Ga0501042_0066604
837 Ga0501042_0079661
838 Ga0501043_0081842
839 Ga0501046_0018667
840 Ga0501048_0022935
841 Ga0501068_0008397
842 Ga0501071_0004305
843 Ga0501071_0231385
844 Ga0501072_0006332
845 Ga0501074_0151352
846 Ga0501075_0035193
847 Ga0501075_0040018
848 Ga0501075_0085534
849 Ga0501076_0009343
850 Ga0501076_0014540
851 Ga0501076_0106474
852 Ga0501077_0034671
853 Ga0501079_0012111
854 Ga0501079_0047220
855 Ga0501079_0093119
856 Ga0501079_0156170
857 Ga0501080_0015510
858 Ga0501080_0030310
859 Ga0501080_0102772
860 Ga0501081_0015967
861 Ga0501081_0024223
862 Ga0501081_0084341
863 Ga0501081_0150686
864 Ga0501083_0100165
865 Ga0501045_0006372
866 nmdc:mga03683_117694_c1
867 nmdc:mga03n38_85277_c1
868 nmdc:mga0yw44_15374_c1
869 nmdc:mga06z11_59174_c1
870 nmdc:mga06z11_81023_c1
871 nmdc:mga05p37_172218_c1
872 nmdc:mga05p37_207687_c1
873 nmdc:mga05p37_33790_c1
874 nmdc:mga05p37_82200_c1
875 nmdc:mga09592_20241_c1
876 nmdc:mga0qj67_24408_c2
877 nmdc:mga0qj67_8173_c1
878 nmdc:mga06r32_462207_c1
879 nmdc:mga06r32_6689_c1
880 nmdc:mga0n895_10943_c1
881 nmdc:mga0n895_156815_c1
882 nmdc:mga0n895_185510_c1
883 nmdc:mga0n895_311260_c1
884 nmdc:mga0n895_44882_c1
885 nmdc:mga0rr50_84003_c1
886 nmdc:mga0rr50_91680_c1
887 nmdc:mga08x19_141508_c1
888 nmdc:mga08x19_948_c1
889 nmdc:mga0a205_112056_c1
890 nmdc:mga0a205_153913_c1
891 nmdc:mga0a205_315239_c1
892 Ga0495601_0000001
893 Ga0495601_0003222
894 Ga0495612_0000003
895 Ga0495595_0000105
896 Ga0495595_0040604
897 Ga0495619_0000004
898 Ga0495619_0135631
899 Ga0495619_0226097
900 Ga0500641_0055296
901 Ga0500595_000001
902 Ga0500595_003691
903 Ga0500645_000087
904 Ga0501084_0022832
905 Ga0501084_0122517
906 Ga0501082_0004689
907 Ga0501082_0028658
908 Ga0501082_0076203
909 Ga0530510_0000130
910 Ga0530510_0003152
911 Ga0530510_0011769
912 Ga0530510_0033732
913 2929203180
914 8055916239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

29

396

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9521 7 383
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9449 7 377
5yit-assembly3.cif.gz_E-2 crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.9441 7 376
5yx6-assembly1.cif.gz_B crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9423 7 376
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9423 7 383
ID Description Score Start End Superfamily
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9838 230 321 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9828 230 321 3.30.1540.10
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9785 233 318 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9734 230 321 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9724 230 321 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A1F9DFM9-F1-model_v4 Formyl-CoA transferase 0.9842 7 400 GO:0008410
AF-A0A497KNB9-F1-model_v4 CoA transferase 0.9837 7 399 GO:0008410
AF-A0A7C7GAT2-F1-model_v4 CoA transferase 0.9814 46 399 GO:0008410
AF-A0A6P7MCU2-F1-model_v4 deleted 0.9812 7 334
AF-A0A838J8D2-F1-model_v4 CoA transferase 0.9809 7 384 GO:0008410

Map