F448058

General Info

Members Datasets Scaffolds Average Seq Length
457 224 457 300

Family's Representative Sequence

Representative Sequence 3300046663|Ga0495635_0189881|Ga0495635_0189881_299_1294
Length 331
Sequence MIPGPFAARLGDSQRRPFCHDPRMATDLLSSFSNQLADAVSAASPSVVQVQGRRRPASGLVYADNVVLTTVRALGREDGLHVRRHDGRTLDAELAGWDPTTSLAVLRVAGLDTPPLAPAATAPRVGHLALAVARSWSNVVTASAGIVSVIGGPLPTGRRRAIDQVIRTTAPMHDGFAGGAFLDTAGGLIGIATAAAIRGLGVVIPAAIAWKTAATVLEHGSLRRGYLGLAGQPVALPEGQGGADGREQALLVVGVTSGGPASQAGVLVGDLLLEFDGHPVEAPEELLDLLLGDRVGRAVALKILRGGTVAEVTVTVGEFLASDSGGEKIEI

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
143 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 2.19
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10089488 3300005290 Bacteria 2467
2 Ga0065707_10085126 3300005295 Bacteria 6432
3 Ga0070676_10111785 3300005328 Bacteria 1702
4 Ga0070670_100002204 3300005331 Bacteria 16016
5 Ga0070670_100020506 3300005331 Bacteria 5683
6 Ga0070677_10154368 3300005333 Unclassified 1071
7 Ga0068869_100002479 3300005334 Bacteria 11131
8 Ga0068869_100011346 3300005334 Bacteria 5839
9 Ga0068869_100123772 3300005334 Bacteria 1981
10 Ga0070666_10001247 3300005335 Bacteria 15395
11 Ga0070666_10254858 3300005335 Bacteria 1243
12 Ga0068868_100189331 3300005338 Unclassified 1711
13 Ga0070689_100413565 3300005340 Bacteria 1142
14 Ga0070691_10018650 3300005341 Bacteria 3199
15 Ga0070687_100229435 3300005343 Bacteria 1142
16 Ga0070661_100010515 3300005344 Bacteria 6434
17 Ga0070668_100081666 3300005347 Bacteria 2534
18 Ga0070668_100427206 3300005347 Bacteria 1135
19 Ga0070669_100053201 3300005353 Bacteria 2963
20 Ga0070669_100150726 3300005353 Unclassified 1800
21 Ga0070675_100000204 3300005354 Bacteria 37628
22 Ga0070675_100000342 3300005354 Bacteria 31497
23 Ga0070675_100001621 3300005354 Bacteria 16598
24 Ga0070675_100027339 3300005354 Bacteria 4583
25 Ga0070675_100102316 3300005354 Bacteria 2414
26 Ga0070671_100206881 3300005355 Bacteria 1664
27 Ga0070674_100093453 3300005356 Bacteria 2176
28 Ga0070674_100093667 3300005356 Unclassified 2174
29 Ga0070674_100107158 3300005356 Unclassified 2046
30 Ga0070674_100324182 3300005356 Bacteria 1236
31 Ga0070673_100020088 3300005364 Bacteria 4810
32 Ga0070688_100011900 3300005365 Bacteria 4857
33 Ga0070688_100286013 3300005365 Bacteria 1187
34 Ga0070688_100418576 3300005365 Bacteria 995
35 Ga0070667_100025435 3300005367 Bacteria 4922
36 Ga0070713_100034896 3300005436 Bacteria 4046
37 Ga0070713_100122950 3300005436 Bacteria 2279
38 Ga0070701_10009264 3300005438 Bacteria 4306
39 Ga0070701_10064111 3300005438 Unclassified 1946
40 Ga0070711_100076447 3300005439 Bacteria 2374
41 Ga0070705_100005417 3300005440 Bacteria 6218
42 Ga0070700_100053347 3300005441 Bacteria 2523
43 Ga0070694_100004755 3300005444 Bacteria 8179
44 Ga0070663_100142291 3300005455 Unclassified 1832
45 Ga0070678_100054569 3300005456 Unclassified 2913
46 Ga0070662_100081285 3300005457 Bacteria 2414
47 Ga0070662_100271387 3300005457 Unclassified 1370
48 Ga0070681_10058717 3300005458 Bacteria 3827
49 Ga0068867_100005747 3300005459 Bacteria 8800
50 Ga0068867_100015354 3300005459 Bacteria 5431
51 Ga0070685_10076034 3300005466 Bacteria 2002
52 Ga0070706_100116848 3300005467 Bacteria 2485
53 Ga0070706_100395844 3300005467 Bacteria 1286
54 Ga0070707_100045492 3300005468 Bacteria 4202
55 Ga0070698_100127135 3300005471 Bacteria 2506
56 Ga0070699_100037950 3300005518 Bacteria 4171
57 Ga0070699_100183384 3300005518 Bacteria 1858
58 Ga0070684_100105726 3300005535 Bacteria 2519
59 Ga0070672_100143187 3300005543 Bacteria 1973
60 Ga0070672_100188184 3300005543 Bacteria 1722
61 Ga0070672_100275184 3300005543 Unclassified 1422
62 Ga0070672_100278685 3300005543 Bacteria 1413
63 Ga0070686_100001018 3300005544 Bacteria 16128
64 Ga0070686_100060592 3300005544 Bacteria 2442
65 Ga0070686_100085884 3300005544 Bacteria 2094
66 Ga0070695_100006575 3300005545 Bacteria 6868
67 Ga0070696_100096947 3300005546 Bacteria 2108
68 Ga0070696_100097991 3300005546 Bacteria 2097
69 Ga0070696_100145236 3300005546 Bacteria 1737
70 Ga0070696_100276753 3300005546 Unclassified 1278
71 Ga0070665_100029854 3300005548 Bacteria 5487
72 Ga0070665_100039676 3300005548 Bacteria 4734
73 Ga0070665_100105379 3300005548 Bacteria 2822
74 Ga0070665_100188240 3300005548 Bacteria 2065
75 Ga0070704_100040889 3300005549 Bacteria 3195
76 Ga0070704_100127515 3300005549 Bacteria 1966
77 Ga0070704_100203860 3300005549 Bacteria 1598
78 Ga0070704_100305000 3300005549 Bacteria 1328
79 Ga0070704_100335158 3300005549 Bacteria 1272
80 Ga0070704_100470734 3300005549 Bacteria 1085
81 Ga0068855_100303069 3300005563 Bacteria 1769
82 Ga0070664_100047784 3300005564 Bacteria 3616
83 Ga0070664_100210718 3300005564 Bacteria 1736
84 Ga0068857_100207129 3300005577 Unclassified 1789
85 Ga0068854_100005014 3300005578 Bacteria 8349
86 Ga0068854_100037060 3300005578 Bacteria 3421
87 Ga0068854_100059275 3300005578 Bacteria 2766
88 Ga0070702_100098759 3300005615 Bacteria 1787
89 Ga0070702_100199602 3300005615 Bacteria 1323
90 Ga0068852_100544627 3300005616 Bacteria 1160
91 Ga0068859_100045205 3300005617 Bacteria 4425
92 Ga0068859_100185385 3300005617 Unclassified 2165
93 Ga0068859_100213636 3300005617 Bacteria 2016
94 Ga0068859_100235567 3300005617 Unclassified 1919
95 Ga0068859_100670995 3300005617 Bacteria 1128
96 Ga0068864_100012241 3300005618 Bacteria 7089
97 Ga0068864_100071795 3300005618 Bacteria 3016
98 Ga0068864_100137219 3300005618 Bacteria 2203
99 Ga0068866_10086760 3300005718 Bacteria 1694
100 Ga0068861_100014453 3300005719 Bacteria 5541
101 Ga0068861_100161555 3300005719 Bacteria 1848
102 Ga0068861_100169451 3300005719 Unclassified 1808
103 Ga0068870_10007702 3300005840 Bacteria 4815
104 Ga0068870_10079544 3300005840 Bacteria 1809
105 Ga0068863_100001180 3300005841 Bacteria 26124
106 Ga0068863_100095828 3300005841 Unclassified 2817
107 Ga0068863_100118780 3300005841 Unclassified 2520
108 Ga0068858_100003770 3300005842 Bacteria 14981
109 Ga0068858_100041858 3300005842 Bacteria 4246
110 Ga0068858_100117617 3300005842 Bacteria 2485
111 Ga0068858_100240293 3300005842 Bacteria 1718
112 Ga0068860_100028012 3300005843 Bacteria 5424
113 Ga0068860_100081348 3300005843 Bacteria 3080
114 Ga0068860_100366107 3300005843 Unclassified 1421
115 Ga0068860_100486959 3300005843 Bacteria 1230
116 Ga0068862_100015252 3300005844 Bacteria 6382
117 Ga0081455_10030864 3300005937 Bacteria 4861
118 Ga0075364_10038108 3300006051 Bacteria 3115
119 Ga0068871_100004628 3300006358 Bacteria 9607
120 Ga0068871_100061619 3300006358 Unclassified 3064
121 Ga0068871_100104825 3300006358 Bacteria 2372
122 Ga0075428_100002943 3300006844 Bacteria 18557
123 Ga0075428_100057643 3300006844 Bacteria 4252
124 Ga0075430_100493688 3300006846 Bacteria 1010
125 Ga0075431_100107539 3300006847 Bacteria 2878
126 Ga0075431_100131763 3300006847 Bacteria 2578
127 Ga0075433_10027177 3300006852 Bacteria 4851
128 Ga0075433_10034721 3300006852 Bacteria 4333
129 Ga0075433_10055303 3300006852 Bacteria 3464
130 Ga0075433_10082567 3300006852 Unclassified 2834
131 Ga0075434_100000026 3300006871 Bacteria 68165
132 Ga0075434_100010651 3300006871 Bacteria 8631
133 Ga0075434_100123878 3300006871 Bacteria 2601
134 Ga0075434_100147274 3300006871 Bacteria 2375
135 Ga0075434_100560014 3300006871 Bacteria 1163
136 Ga0075429_100008693 3300006880 Bacteria 8837
137 Ga0075429_100044176 3300006880 Bacteria 3876
138 Ga0075429_100056466 3300006880 Unclassified 3417
139 Ga0075429_100138655 3300006880 Bacteria 2129
140 Ga0075429_100355909 3300006880 Bacteria 1282
141 Ga0068865_100017560 3300006881 Bacteria 4603
142 Ga0068865_100093745 3300006881 Unclassified 2184
143 Ga0075436_100000600 3300006914 Bacteria 23619
144 Ga0075436_100009299 3300006914 Bacteria 6724
145 Ga0075436_100022899 3300006914 Bacteria 4291
146 Ga0097620_100045206 3300006931 Bacteria 4425
147 Ga0097620_100185389 3300006931 Unclassified 2165
148 Ga0097620_100213631 3300006931 Bacteria 2016
149 Ga0097620_100235585 3300006931 Unclassified 1919
150 Ga0097620_100671083 3300006931 Bacteria 1128
151 Ga0075435_100000017 3300007076 Bacteria 99666
152 Ga0075435_100005047 3300007076 Bacteria 9169
153 Ga0075435_100006307 3300007076 Bacteria 8375
154 Ga0075435_100007466 3300007076 Bacteria 7794
155 Ga0075435_100018838 3300007076 Bacteria 5260
156 Ga0075435_100019935 3300007076 Bacteria 5128
157 Ga0075435_100028446 3300007076 Bacteria 4385
158 Ga0075435_100220460 3300007076 Bacteria 1611
159 Ga0111539_10000685 3300009094 Bacteria 43832
160 Ga0111539_10006195 3300009094 Bacteria 15435
161 Ga0111539_10040254 3300009094 Bacteria 5627
162 Ga0105245_10331020 3300009098 Bacteria 1503
163 Ga0105245_10461575 3300009098 Unclassified 1280
164 Ga0114129_10008732 3300009147 Bacteria 14448
165 Ga0114129_10024644 3300009147 Bacteria 8527
166 Ga0114129_10030155 3300009147 Bacteria 7682
167 Ga0114129_10063076 3300009147 Bacteria 5176
168 Ga0114129_10105469 3300009147 Bacteria 3895
169 Ga0114129_10150938 3300009147 Unclassified 3180
170 Ga0114129_10217124 3300009147 Bacteria 2582
171 Ga0114129_10224866 3300009147 Bacteria 2530
172 Ga0114129_10396237 3300009147 Bacteria 1820
173 Ga0114129_10410471 3300009147 Bacteria 1783
174 Ga0114129_10850276 3300009147 Unclassified 1160
175 Ga0105243_10020195 3300009148 Bacteria 5051
176 Ga0105243_10323108 3300009148 Bacteria 1407
177 Ga0105242_10024408 3300009176 Bacteria 4775
178 Ga0105242_10027380 3300009176 Bacteria 4526
179 Ga0105242_10223274 3300009176 Unclassified 1685
180 Ga0105248_10008980 3300009177 Bacteria 10988
181 Ga0105248_10043026 3300009177 Bacteria 5065
182 Ga0105248_10072035 3300009177 Bacteria 3883
183 Ga0105248_10212677 3300009177 Bacteria 2178
184 Ga0105248_10216113 3300009177 Bacteria 2159
185 Ga0105248_10243893 3300009177 Bacteria 2022
186 Ga0105248_10876825 3300009177 Bacteria 1013
187 Ga0105238_10020442 3300009551 Bacteria 6740
188 Ga0105249_10015133 3300009553 Bacteria 6826
189 Ga0105249_10178632 3300009553 Bacteria 2064
190 Ga0105246_10006926 3300011119 Bacteria 6936
191 Ga0105246_10366379 3300011119 Bacteria 1186
192 Ga0163162_10071838 3300013306 Unclassified 3515
193 Ga0163162_10079089 3300013306 Bacteria 3354
194 Ga0157375_10140725 3300013308 Bacteria 2540
195 Ga0157375_10190881 3300013308 Bacteria 2203
196 Ga0157375_10208565 3300013308 Bacteria 2111
197 Ga0163163_10014644 3300014325 Bacteria 7212
198 Ga0163163_10175737 3300014325 Bacteria 2188
199 Ga0157380_10013132 3300014326 Bacteria 6029
200 Ga0157380_10022833 3300014326 Bacteria 4717
201 Ga0157380_10090294 3300014326 Bacteria 2527
202 Ga0157380_10120448 3300014326 Unclassified 2222
203 Ga0157380_10120711 3300014326 Bacteria 2220
204 Ga0157380_10170628 3300014326 Bacteria 1901
205 Ga0157379_10011923 3300014968 Bacteria 7595
206 Ga0157379_10019664 3300014968 Bacteria 5966
207 Ga0157376_10009359 3300014969 Bacteria 7119
208 Ga0163161_10114579 3300017792 Bacteria 2019
209 Ga0207697_10000401 3300025315 Bacteria 24402
210 Ga0207682_10141042 3300025893 Unclassified 1081
211 Ga0207642_10009984 3300025899 Bacteria 3326
212 Ga0207688_10001140 3300025901 Bacteria 13699
213 Ga0207680_10001376 3300025903 Bacteria 11507
214 Ga0207680_10005949 3300025903 Bacteria 5863
215 Ga0207645_10002384 3300025907 Bacteria 14794
216 Ga0207645_10012339 3300025907 Bacteria 5799
217 Ga0207645_10026966 3300025907 Bacteria 3712
218 Ga0207645_10117682 3300025907 Unclassified 1724
219 Ga0207643_10003749 3300025908 Bacteria 8164
220 Ga0207643_10073078 3300025908 Bacteria 1976
221 Ga0207707_10048200 3300025912 Bacteria 3711
222 Ga0207663_10160644 3300025916 Bacteria 1586
223 Ga0207662_10002983 3300025918 Bacteria 8619
224 Ga0207662_10092370 3300025918 Bacteria 1863
225 Ga0207649_10025734 3300025920 Bacteria 3434
226 Ga0207652_10061614 3300025921 Bacteria 3240
227 Ga0207652_10222842 3300025921 Bacteria 1699
228 Ga0207646_10068402 3300025922 Bacteria 3171
229 Ga0207646_10074523 3300025922 Bacteria 3032
230 Ga0207646_10239663 3300025922 Bacteria 1638
231 Ga0207646_10265293 3300025922 Unclassified 1552
232 Ga0207681_10020570 3300025923 Bacteria 4184
233 Ga0207681_10031798 3300025923 Bacteria 3449
234 Ga0207681_10130947 3300025923 Bacteria 1854
235 Ga0207681_10142506 3300025923 Bacteria 1786
236 Ga0207681_10215077 3300025923 Bacteria 1484
237 Ga0207681_10270414 3300025923 Bacteria 1334
238 Ga0207694_10434167 3300025924 Bacteria 1095
239 Ga0207650_10460124 3300025925 Bacteria 1060
240 Ga0207659_10000201 3300025926 Bacteria 35674
241 Ga0207659_10001954 3300025926 Bacteria 12238
242 Ga0207659_10003320 3300025926 Bacteria 9641
243 Ga0207659_10009858 3300025926 Bacteria 5979
244 Ga0207659_10022140 3300025926 Bacteria 4229
245 Ga0207687_10052349 3300025927 Unclassified 2849
246 Ga0207706_10008438 3300025933 Bacteria 9507
247 Ga0207706_10043039 3300025933 Bacteria 4002
248 Ga0207706_10133230 3300025933 Unclassified 2186
249 Ga0207706_10267959 3300025933 Unclassified 1491
250 Ga0207686_10179986 3300025934 Bacteria 1498
251 Ga0207686_10270106 3300025934 Unclassified 1251
252 Ga0207709_10025070 3300025935 Bacteria 3412
253 Ga0207709_10029823 3300025935 Bacteria 3168
254 Ga0207670_10090854 3300025936 Bacteria 2158
255 Ga0207670_10120022 3300025936 Bacteria 1909
256 Ga0207670_10367217 3300025936 Bacteria 1143
257 Ga0207669_10026100 3300025937 Bacteria 3171
258 Ga0207669_10043878 3300025937 Unclassified 2622
259 Ga0207669_10053151 3300025937 Bacteria 2438
260 Ga0207704_10007256 3300025938 Bacteria 5222
261 Ga0207704_10116918 3300025938 Bacteria 1815
262 Ga0207704_10197362 3300025938 Bacteria 1469
263 Ga0207691_10000953 3300025940 Bacteria 28656
264 Ga0207691_10077563 3300025940 Bacteria 2993
265 Ga0207691_10150385 3300025940 Bacteria 2047
266 Ga0207691_10265057 3300025940 Bacteria 1480
267 Ga0207711_10040086 3300025941 Unclassified 3984
268 Ga0207711_10073700 3300025941 Bacteria 2968
269 Ga0207689_10005346 3300025942 Bacteria 11500
270 Ga0207689_10008919 3300025942 Bacteria 8698
271 Ga0207689_10187395 3300025942 Bacteria 1706
272 Ga0207679_10016274 3300025945 Bacteria 4935
273 Ga0207679_10303854 3300025945 Bacteria 1376
274 Ga0207651_10028422 3300025960 Bacteria 3527
275 Ga0207712_10242383 3300025961 Unclassified 1453
276 Ga0207668_10127821 3300025972 Unclassified 1936
277 Ga0207640_10006289 3300025981 Bacteria 6510
278 Ga0207640_10035521 3300025981 Bacteria 3120
279 Ga0207640_10046287 3300025981 Bacteria 2798
280 Ga0207640_10170049 3300025981 Bacteria 1623
281 Ga0207658_10056756 3300025986 Bacteria 2907
282 Ga0207677_10139972 3300026023 Unclassified 1851
283 Ga0207677_10148564 3300026023 Unclassified 1804
284 Ga0207703_10007098 3300026035 Bacteria 8912
285 Ga0207703_10096489 3300026035 Bacteria 2496
286 Ga0207678_10043299 3300026067 Bacteria 3895
287 Ga0207708_10007036 3300026075 Bacteria 8312
288 Ga0207708_10029358 3300026075 Bacteria 4168
289 Ga0207708_10063345 3300026075 Bacteria 2825
290 Ga0207641_10003014 3300026088 Bacteria 15205
291 Ga0207641_10274473 3300026088 Bacteria 1583
292 Ga0207641_10331127 3300026088 Unclassified 1446
293 Ga0207641_10388124 3300026088 Unclassified 1339
294 Ga0207648_10004852 3300026089 Bacteria 13716
295 Ga0207676_10029891 3300026095 Bacteria 4083
296 Ga0207676_10397263 3300026095 Bacteria 1287
297 Ga0207676_10563737 3300026095 Unclassified 1090
298 Ga0207674_10165206 3300026116 Bacteria 2168
299 Ga0207675_100004887 3300026118 Bacteria 12924
300 Ga0207675_100017057 3300026118 Bacteria 6785
301 Ga0207675_100023742 3300026118 Bacteria 5705
302 Ga0207675_100216163 3300026118 Unclassified 1845
303 Ga0207683_10009401 3300026121 Bacteria 8330
304 Ga0207683_10076047 3300026121 Bacteria 2973
305 Ga0207683_10314951 3300026121 Bacteria 1433
306 Ga0207428_10006320 3300027907 Bacteria 10954
307 Ga0207428_10024918 3300027907 Bacteria 5016
308 Ga0268266_10191549 3300028379 Bacteria 1867
309 Ga0268266_10277779 3300028379 Bacteria 1556
310 Ga0268266_10338422 3300028379 Bacteria 1412
311 Ga0268265_10022180 3300028380 Bacteria 4457
312 Ga0268264_10367247 3300028381 Unclassified 1374
313 Ga0268264_10523762 3300028381 Bacteria 1159
314 Ga0268264_10648550 3300028381 Bacteria 1045
315 Ga0307405_10015263 3300031731 Bacteria 4156
316 Ga0307409_100018110 3300031995 Bacteria 4720
317 Ga0307416_100231011 3300032002 Unclassified 1783
318 Ga0307416_100419576 3300032002 Bacteria 1382
319 Ga0307414_10481874 3300032004 Bacteria 1094
320 Ga0307411_10588289 3300032005 Bacteria 955
321 Ga0307415_100153564 3300032126 Bacteria 1775
322 Ga0373930_0003446 3300034816 Bacteria 2509
323 Ga0373948_0015168 3300034817 Bacteria 1412
324 Ga0373950_0000763 3300034818 Bacteria 4011
325 Ga0373928_0010096 3300035084 Bacteria 1850
326 Ga0373929_0001491 3300035085 Bacteria 4453
327 Ga0373934_0000435 3300035086 Bacteria 14563
328 Ga0373940_0002297 3300035088 Bacteria 3688
329 Ga0373949_0001478 3300035090 Bacteria 6705
330 Ga0373952_0000512 3300035092 Bacteria 6783
331 Ga0373932_0001481 3300035112 Bacteria 6561
332 Ga0373936_0060418 3300035113 Bacteria 1546
333 Ga0373939_0000394 3300035114 Bacteria 11029
334 Ga0373941_0001265 3300035115 Bacteria 5318
335 Ga0373941_0048390 3300035115 Bacteria 1342
336 Ga0373945_0017943 3300035116 Unclassified 2402
337 Ga0373953_0019363 3300035117 Unclassified 2531
338 Ga0373954_0033370 3300035118 Unclassified 2382
339 Ga0373956_0005080 3300035119 Bacteria 5267
340 Ga0373956_0054844 3300035119 Bacteria 1797
341 Ga0373956_0068737 3300035119 Unclassified 1614
342 Ga0373957_0045335 3300035120 Unclassified 1666
343 Ga0373960_0000197 3300035121 Bacteria 10990
344 Ga0373943_0010480 3300035170 Bacteria 4154
345 Ga0373946_0012901 3300035171 Bacteria 3133
346 Ga0373942_0002148 3300035207 Bacteria 4868
347 Ga0373961_0001086 3300035241 Bacteria 8665
348 Ga0373962_0002646 3300035242 Bacteria 4256
349 Ga0373924_0045634 3300035410 Bacteria 1803
350 Ga0373924_0077373 3300035410 Unclassified 1411
351 Ga0373931_0005366 3300035691 Bacteria 5917
352 Ga0373935_0029809 3300035692 Bacteria 3378
353 Ga0373927_0133869 3300035695 Bacteria 1620
354 Ga0373947_0063497 3300035725 Bacteria 2250
355 Ga0373947_0135777 3300035725 Bacteria 1574
356 Ga0373947_0136802 3300035725 Bacteria 1568
357 Ga0373947_0211701 3300035725 Bacteria 1272
358 Ga0373937_0000232 3300036401 Bacteria 54273
359 Ga0373937_0010656 3300036401 Bacteria 8037
360 Ga0373937_0054025 3300036401 Bacteria 3685
361 Ga0373937_0392039 3300036401 Bacteria 1317
362 Ga0373925_0001894 3300037068 Bacteria 17368
363 Ga0373925_0017187 3300037068 Bacteria 5239
364 Ga0373925_0045889 3300037068 Bacteria 3247
365 Ga0373925_0116086 3300037068 Bacteria 2073
366 Ga0439431_0027411 3300041997 Unclassified 1399
367 Ga0439450_006629 3300042008 Bacteria 2092
368 Ga0439434_0028487 3300042435 Unclassified 1691
369 Ga0451576_0414552 3300045051 Unclassified 1413
370 Ga0466967_0247692 3300045976 Unclassified 1701
371 Ga0495651_0097652 3300046462 Unclassified 2193
372 Ga0495580_0059543 3300046472 Bacteria 2684
373 Ga0495664_0077226 3300046477 Unclassified 1994
374 Ga0495664_0158816 3300046477 Bacteria 1372
375 Ga0495608_0002090 3300046511 Bacteria 14397
376 Ga0495630_0342535 3300046517 Unclassified 1144
377 Ga0495630_0343913 3300046517 Unclassified 1141
378 Ga0495652_0100733 3300046529 Unclassified 2343
379 Ga0495586_0099893 3300046535 Bacteria 1610
380 Ga0495586_0102645 3300046535 Unclassified 1588
381 Ga0495645_0023365 3300046543 Bacteria 4476
382 Ga0495645_0193467 3300046543 Unclassified 1384
383 Ga0495667_0013809 3300046559 Bacteria 5455
384 Ga0495635_0189881 3300046663 Bacteria 1395
385 Ga0495623_0084687 3300046679 Bacteria 1956
386 Ga0495647_0004938 3300046681 Bacteria 4368
387 Ga0495658_0030840 3300046683 Bacteria 2915
388 Ga0495658_0114177 3300046683 Bacteria 1627
389 Ga0495658_0217473 3300046683 Bacteria 1195
390 Ga0495669_0006162 3300046684 Bacteria 5002
391 Ga0495670_0164673 3300046691 Bacteria 1166
392 Ga0495604_0032452 3300047317 Bacteria 4138
393 Ga0495674_0324939 3300047319 Bacteria 1253
394 Ga0495684_0000087 3300047471 Bacteria 64920
395 Ga0495593_0173710 3300047673 Bacteria 1086
396 Ga0496101_0269181 3300048904 Bacteria 1330
397 Ga0496102_0457125 3300048905 Bacteria 1198
398 Ga0496102_0484123 3300048905 Bacteria 1159
399 Ga0496106_0059688 3300048909 Bacteria 2890
400 Ga0496109_0088313 3300048912 Bacteria 2865
401 Ga0496109_0307898 3300048912 Bacteria 1494
402 Ga0496112_0006375 3300048915 Bacteria 10356
403 Ga0496114_0214678 3300048917 Bacteria 1688
404 Ga0496114_0398211 3300048917 Bacteria 1219
405 Ga0496115_0092369 3300048918 Bacteria 2474
406 Ga0501031_0120262 3300049568 Bacteria 1716
407 Ga0501036_0173313 3300049572 Bacteria 1817
408 Ga0501039_0210585 3300049575 Bacteria 1529
409 Ga0501071_0041026 3300049587 Bacteria 3314
410 Ga0501072_0093066 3300049588 Bacteria 2394
411 Ga0501072_0133588 3300049588 Bacteria 1979
412 Ga0501076_0054099 3300049592 Bacteria 3181
413 Ga0501080_0443552 3300049742 Bacteria 1164
414 Ga0501083_0096908 3300049744 Bacteria 1946
415 nmdc:mga00v17_61340_c1 3300050491 Bacteria 2311
416 nmdc:mga05p37_123354_c1 3300050507 Unclassified 3182
417 nmdc:mga05p37_150692_c1 3300050507 Bacteria 2845
418 nmdc:mga05p37_16284_c1 3300050507 Bacteria 8950
419 nmdc:mga05p37_171806_c1 3300050507 Bacteria 2643
420 nmdc:mga05p37_20210_c1 3300050507 Bacteria 8060
421 nmdc:mga05p37_26789_c1 3300050507 Bacteria 7011
422 nmdc:mga05p37_305221_c1 3300050507 Unclassified 1889
423 nmdc:mga05p37_8548_c1 3300050507 Bacteria 12100
424 nmdc:mga05p37_95657_c1 3300050507 Bacteria 3659
425 nmdc:mga09592_36456_c1 3300050508 Bacteria 4119
426 nmdc:mga09592_38797_c1 3300050508 Bacteria 3999
427 nmdc:mga09592_905_c1 3300050508 Bacteria 23310
428 nmdc:mga0qj67_472008_c1 3300050509 Bacteria 1010
429 nmdc:mga06r32_314438_c1 3300050510 Bacteria 1552
430 nmdc:mga06r32_69693_c1 3300050510 Bacteria 3399
431 nmdc:mga06r32_71756_c1 3300050510 Bacteria 3351
432 nmdc:mga08y16_104463_c1 3300050511 Unclassified 2949
433 nmdc:mga08y16_23190_c1 3300050511 Bacteria 6551
434 nmdc:mga08y16_556937_c1 3300050511 Bacteria 1160
435 nmdc:mga08y16_895711_c1 3300050511 Unclassified 874
436 nmdc:mga0n895_157888_c1 3300050512 Bacteria 2299
437 nmdc:mga0n895_234570_c1 3300050512 Bacteria 1862
438 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
439 nmdc:mga0n895_522124_c1 3300050512 Bacteria 1195
440 nmdc:mga0n895_79886_c1 3300050512 Bacteria 3258
441 nmdc:mga0n895_8171_c1 3300050512 Bacteria 9044
442 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
443 nmdc:mga0rr50_1724_c1 3300050513 Bacteria 12052
444 nmdc:mga0rr50_210485_c1 3300050513 Bacteria 1602
445 nmdc:mga0rr50_22635_c1 3300050513 Bacteria 4317
446 nmdc:mga0rr50_243959_c1 3300050513 Bacteria 1490
447 nmdc:mga08x19_275_c1 3300050514 Bacteria 38855
448 nmdc:mga08x19_7678_c1 3300050514 Bacteria 6403
449 nmdc:mga0a205_49331_c1 3300050515 Bacteria 4063
450 nmdc:mga0a205_505504_c1 3300050515 Unclassified 1065
451 nmdc:mga0a205_69584_c1 3300050515 Unclassified 3398
452 nmdc:mga0a205_72273_c1 3300050515 Bacteria 2602
453 Ga0495601_0030442 3300053077 Bacteria 3351
454 Ga0495601_0117828 3300053077 Bacteria 1723
455 Ga0495619_0002209 3300053085 Bacteria 12891
456 Ga0501082_0314255 3300060353 Bacteria 1364
457 Ga0530510_0146118 3300061734 Bacteria 1744

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10366379 Ga0105246_103663791 270
2 3300025921 Ga0207652_10222842 Ga0207652_102228421 273
3 3300046691 Ga0495670_0164673 Ga0495670_0164673_40_861 273
4 3300047319 Ga0495674_0324939 Ga0495674_0324939_413_1240 275
5 3300050511 nmdc:mga08y16_895711_c1 nmdc:mga08y16_895711_c1_14_844 275
6 3300006871 Ga0075434_100000026 Ga0075434_10000002634 283
7 3300006914 Ga0075436_100000600 Ga0075436_10000060011 283
8 3300007076 Ga0075435_100000017 Ga0075435_10000001759 283
9 3300025937 Ga0207669_10043878 Ga0207669_100438784 283
10 3300050512 nmdc:mga0n895_37_c1 nmdc:mga0n895_37_c1_37651_38589 283
11 3300050513 nmdc:mga0rr50_14_c1 nmdc:mga0rr50_14_c1_88898_89836 283
12 3300050514 nmdc:mga08x19_275_c1 nmdc:mga08x19_275_c1_10101_11039 283
13 3300005439 Ga0070711_100076447 Ga0070711_1000764471 285
14 3300025916 Ga0207663_10160644 Ga0207663_101606442 285
15 3300005331 Ga0070670_100002204 Ga0070670_10000220414 286
16 3300005842 Ga0068858_100003770 Ga0068858_1000037708 286
17 3300005564 Ga0070664_100047784 Ga0070664_1000477843 287
18 3300005577 Ga0068857_100207129 Ga0068857_1002071292 287
19 3300005841 Ga0068863_100118780 Ga0068863_1001187802 287
20 3300005842 Ga0068858_100041858 Ga0068858_1000418583 287
21 3300005843 Ga0068860_100081348 Ga0068860_1000813483 287
22 3300005843 Ga0068860_100486959 Ga0068860_1004869592 287
23 3300025903 Ga0207680_10005949 Ga0207680_100059492 287
24 3300025920 Ga0207649_10025734 Ga0207649_100257342 287
25 3300025926 Ga0207659_10009858 Ga0207659_100098582 287
26 3300025945 Ga0207679_10016274 Ga0207679_100162742 287
27 3300026116 Ga0207674_10165206 Ga0207674_101652062 287
28 3300026121 Ga0207683_10009401 Ga0207683_1000940110 287
29 3300042008 Ga0439450_006629 Ga0439450_006629_1218_2081 287
30 3300005544 Ga0070686_100085884 Ga0070686_1000858841 288
31 3300005617 Ga0068859_100213636 Ga0068859_1002136361 288
32 3300006931 Ga0097620_100213631 Ga0097620_1002136311 288
33 3300009148 Ga0105243_10020195 Ga0105243_100201955 288
34 3300009176 Ga0105242_10024408 Ga0105242_100244085 288
35 3300025981 Ga0207640_10035521 Ga0207640_100355212 288
36 3300036401 Ga0373937_0054025 Ga0373937_0054025_1721_2662 288
37 3300005617 Ga0068859_100045205 Ga0068859_1000452051 290
38 3300005618 Ga0068864_100137219 Ga0068864_1001372193 290
39 3300006931 Ga0097620_100045206 Ga0097620_1000452061 290
40 3300009177 Ga0105248_10876825 Ga0105248_108768251 290
41 3300026067 Ga0207678_10043299 Ga0207678_100432993 290
42 3300026095 Ga0207676_10397263 Ga0207676_103972632 290
43 3300026088 Ga0207641_10388124 Ga0207641_103881242 291
44 3300005333 Ga0070677_10154368 Ga0070677_101543681 292
45 3300005334 Ga0068869_100002479 Ga0068869_10000247910 292
46 3300005343 Ga0070687_100229435 Ga0070687_1002294352 292
47 3300005354 Ga0070675_100001621 Ga0070675_1000016219 292
48 3300005354 Ga0070675_100027339 Ga0070675_1000273393 292
49 3300005364 Ga0070673_100020088 Ga0070673_1000200884 292
50 3300005438 Ga0070701_10009264 Ga0070701_100092643 292
51 3300005459 Ga0068867_100005747 Ga0068867_1000057475 292
52 3300005615 Ga0070702_100098759 Ga0070702_1000987592 292
53 3300005719 Ga0068861_100014453 Ga0068861_1000144535 292
54 3300005840 Ga0068870_10079544 Ga0068870_100795442 292
55 3300009551 Ga0105238_10020442 Ga0105238_100204423 292
56 3300014326 Ga0157380_10170628 Ga0157380_101706282 292
57 3300017792 Ga0163161_10114579 Ga0163161_101145792 292
58 3300025893 Ga0207682_10141042 Ga0207682_101410421 292
59 3300025907 Ga0207645_10026966 Ga0207645_100269664 292
60 3300025908 Ga0207643_10073078 Ga0207643_100730782 292
61 3300025923 Ga0207681_10031798 Ga0207681_100317983 292
62 3300025926 Ga0207659_10003320 Ga0207659_100033202 292
63 3300025926 Ga0207659_10022140 Ga0207659_100221401 292
64 3300025938 Ga0207704_10007256 Ga0207704_100072566 292
65 3300025942 Ga0207689_10005346 Ga0207689_100053469 292
66 3300026118 Ga0207675_100017057 Ga0207675_1000170573 292
67 3300005549 Ga0070704_100127515 Ga0070704_1001275152 293
68 3300005549 Ga0070704_100305000 Ga0070704_1003050002 293
69 3300005549 Ga0070704_100335158 Ga0070704_1003351581 293
70 3300006844 Ga0075428_100002943 Ga0075428_1000029434 293
71 3300006846 Ga0075430_100493688 Ga0075430_1004936881 293
72 3300006880 Ga0075429_100044176 Ga0075429_1000441766 293
73 3300009147 Ga0114129_10396237 Ga0114129_103962372 293
74 3300009177 Ga0105248_10212677 Ga0105248_102126773 293
75 3300025960 Ga0207651_10028422 Ga0207651_100284223 293
76 3300026121 Ga0207683_10314951 Ga0207683_103149512 293
77 3300031731 Ga0307405_10015263 Ga0307405_100152632 293
78 3300031995 Ga0307409_100018110 Ga0307409_1000181104 293
79 3300032002 Ga0307416_100231011 Ga0307416_1002310112 293
80 3300032126 Ga0307415_100153564 Ga0307415_1001535642 293
81 3300050507 nmdc:mga05p37_95657_c1 nmdc:mga05p37_95657_c1_763_1653 293
82 3300050508 nmdc:mga09592_38797_c1 nmdc:mga09592_38797_c1_3083_3973 293
83 3300050509 nmdc:mga0qj67_472008_c1 nmdc:mga0qj67_472008_c1_81_971 293
84 3300050510 nmdc:mga06r32_69693_c1 nmdc:mga06r32_69693_c1_1798_2688 293
85 3300005347 Ga0070668_100427206 Ga0070668_1004272061 294
86 3300005354 Ga0070675_100000342 Ga0070675_10000034236 294
87 3300005356 Ga0070674_100093453 Ga0070674_1000934532 294
88 3300005365 Ga0070688_100418576 Ga0070688_1004185761 294
89 3300005543 Ga0070672_100278685 Ga0070672_1002786851 294
90 3300006880 Ga0075429_100355909 Ga0075429_1003559092 294
91 3300014326 Ga0157380_10120711 Ga0157380_101207113 294
92 3300025926 Ga0207659_10001954 Ga0207659_100019547 294
93 3300025937 Ga0207669_10026100 Ga0207669_100261002 294
94 3300025940 Ga0207691_10265057 Ga0207691_102650572 294
95 3300005334 Ga0068869_100011346 Ga0068869_1000113462 295
96 3300005563 Ga0068855_100303069 Ga0068855_1003030692 295
97 3300005840 Ga0068870_10007702 Ga0068870_100077022 295
98 3300006880 Ga0075429_100008693 Ga0075429_1000086933 295
99 3300007076 Ga0075435_100007466 Ga0075435_1000074669 295
100 3300009094 Ga0111539_10000685 Ga0111539_100006856 295
101 3300009098 Ga0105245_10461575 Ga0105245_104615752 295
102 3300009147 Ga0114129_10150938 Ga0114129_101509382 295
103 3300009177 Ga0105248_10243893 Ga0105248_102438932 295
104 3300009553 Ga0105249_10015133 Ga0105249_100151331 295
105 3300011119 Ga0105246_10006926 Ga0105246_100069267 295
106 3300013306 Ga0163162_10079089 Ga0163162_100790893 295
107 3300013308 Ga0157375_10190881 Ga0157375_101908813 295
108 3300014326 Ga0157380_10022833 Ga0157380_100228332 295
109 3300014968 Ga0157379_10011923 Ga0157379_100119239 295
110 3300025315 Ga0207697_10000401 Ga0207697_1000040118 295
111 3300025901 Ga0207688_10001140 Ga0207688_1000114014 295
112 3300025907 Ga0207645_10002384 Ga0207645_100023841 295
113 3300025908 Ga0207643_10003749 Ga0207643_100037495 295
114 3300025918 Ga0207662_10002983 Ga0207662_100029839 295
115 3300025940 Ga0207691_10000953 Ga0207691_100009534 295
116 3300026075 Ga0207708_10007036 Ga0207708_1000703610 295
117 3300046517 Ga0495630_0342535 Ga0495630_0342535_240_1127 295
118 3300049568 Ga0501031_0120262 Ga0501031_0120262_767_1654 295
119 3300049572 Ga0501036_0173313 Ga0501036_0173313_719_1606 295
120 3300049575 Ga0501039_0210585 Ga0501039_0210585_622_1509 295
121 3300049587 Ga0501071_0041026 Ga0501071_0041026_1925_2812 295
122 3300049588 Ga0501072_0093066 Ga0501072_0093066_579_1466 295
123 3300049592 Ga0501076_0054099 Ga0501076_0054099_964_1851 295
124 3300049742 Ga0501080_0443552 Ga0501080_0443552_83_970 295
125 3300050507 nmdc:mga05p37_123354_c1 nmdc:mga05p37_123354_c1_528_1415 295
126 3300050508 nmdc:mga09592_36456_c1 nmdc:mga09592_36456_c1_2332_3219 295
127 3300050508 nmdc:mga09592_905_c1 nmdc:mga09592_905_c1_18807_19694 295
128 3300050513 nmdc:mga0rr50_22635_c1 nmdc:mga0rr50_22635_c1_2915_3802 295
129 3300060353 Ga0501082_0314255 Ga0501082_0314255_175_1062 295
130 3300061734 Ga0530510_0146118 Ga0530510_0146118_186_1073 295
131 3300025940 Ga0207691_10150385 Ga0207691_101503852 296
132 3300032002 Ga0307416_100419576 Ga0307416_1004195762 296
133 3300041997 Ga0439431_0027411 Ga0439431_0027411_336_1229 296
134 3300042435 Ga0439434_0028487 Ga0439434_0028487_589_1482 296
135 3300005335 Ga0070666_10001247 Ga0070666_100012478 297
136 3300005353 Ga0070669_100150726 Ga0070669_1001507261 297
137 3300005457 Ga0070662_100081285 Ga0070662_1000812852 297
138 3300005544 Ga0070686_100001018 Ga0070686_10000101810 297
139 3300005546 Ga0070696_100097991 Ga0070696_1000979912 297
140 3300005578 Ga0068854_100005014 Ga0068854_1000050146 297
141 3300005843 Ga0068860_100366107 Ga0068860_1003661071 297
142 3300006871 Ga0075434_100560014 Ga0075434_1005600142 297
143 3300007076 Ga0075435_100006307 Ga0075435_1000063075 297
144 3300025903 Ga0207680_10001376 Ga0207680_100013765 297
145 3300025912 Ga0207707_10048200 Ga0207707_100482003 297
146 3300025933 Ga0207706_10267959 Ga0207706_102679592 297
147 3300025981 Ga0207640_10006289 Ga0207640_100062893 297
148 3300028381 Ga0268264_10367247 Ga0268264_103672472 297
149 3300035170 Ga0373943_0010480 Ga0373943_0010480_1957_2853 297
150 3300035725 Ga0373947_0136802 Ga0373947_0136802_102_998 297
151 3300048909 Ga0496106_0059688 Ga0496106_0059688_828_1763 297
152 3300050512 nmdc:mga0n895_234570_c1 nmdc:mga0n895_234570_c1_106_1041 297
153 3300050513 nmdc:mga0rr50_1724_c1 nmdc:mga0rr50_1724_c1_4993_5928 297
154 3300005335 Ga0070666_10254858 Ga0070666_102548581 298
155 3300005338 Ga0068868_100189331 Ga0068868_1001893311 298
156 3300005340 Ga0070689_100413565 Ga0070689_1004135652 298
157 3300005355 Ga0070671_100206881 Ga0070671_1002068812 298
158 3300005365 Ga0070688_100011900 Ga0070688_1000119002 298
159 3300005436 Ga0070713_100122950 Ga0070713_1001229501 298
160 3300005456 Ga0070678_100054569 Ga0070678_1000545694 298
161 3300005466 Ga0070685_10076034 Ga0070685_100760342 298
162 3300005535 Ga0070684_100105726 Ga0070684_1001057263 298
163 3300005543 Ga0070672_100143187 Ga0070672_1001431871 298
164 3300005548 Ga0070665_100039676 Ga0070665_1000396763 298
165 3300005548 Ga0070665_100105379 Ga0070665_1001053791 298
166 3300005564 Ga0070664_100210718 Ga0070664_1002107183 298
167 3300005616 Ga0068852_100544627 Ga0068852_1005446272 298
168 3300005617 Ga0068859_100670995 Ga0068859_1006709951 298
169 3300005841 Ga0068863_100095828 Ga0068863_1000958282 298
170 3300005842 Ga0068858_100240293 Ga0068858_1002402931 298
171 3300006051 Ga0075364_10038108 Ga0075364_100381082 298
172 3300006358 Ga0068871_100061619 Ga0068871_1000616192 298
173 3300006871 Ga0075434_100123878 Ga0075434_1001238782 298
174 3300006914 Ga0075436_100009299 Ga0075436_1000092993 298
175 3300006931 Ga0097620_100671083 Ga0097620_1006710831 298
176 3300007076 Ga0075435_100028446 Ga0075435_1000284465 298
177 3300009098 Ga0105245_10331020 Ga0105245_103310202 298
178 3300009147 Ga0114129_10008732 Ga0114129_1000873210 298
179 3300009147 Ga0114129_10410471 Ga0114129_104104712 298
180 3300009147 Ga0114129_10850276 Ga0114129_108502761 298
181 3300009176 Ga0105242_10027380 Ga0105242_100273803 298
182 3300013306 Ga0163162_10071838 Ga0163162_100718382 298
183 3300014326 Ga0157380_10013132 Ga0157380_100131326 298
184 3300014968 Ga0157379_10019664 Ga0157379_100196642 298
185 3300014969 Ga0157376_10009359 Ga0157376_100093592 298
186 3300025924 Ga0207694_10434167 Ga0207694_104341671 298
187 3300025925 Ga0207650_10460124 Ga0207650_104601242 298
188 3300025927 Ga0207687_10052349 Ga0207687_100523492 298
189 3300025934 Ga0207686_10179986 Ga0207686_101799862 298
190 3300025936 Ga0207670_10367217 Ga0207670_103672171 298
191 3300025938 Ga0207704_10197362 Ga0207704_101973622 298
192 3300025941 Ga0207711_10040086 Ga0207711_100400863 298
193 3300026023 Ga0207677_10139972 Ga0207677_101399721 298
194 3300026088 Ga0207641_10274473 Ga0207641_102744732 298
195 3300026121 Ga0207683_10076047 Ga0207683_100760473 298
196 3300028379 Ga0268266_10277779 Ga0268266_102777792 298
197 3300028379 Ga0268266_10338422 Ga0268266_103384222 298
198 3300032004 Ga0307414_10481874 Ga0307414_104818741 298
199 3300032005 Ga0307411_10588289 Ga0307411_105882891 298
200 3300034816 Ga0373930_0003446 Ga0373930_0003446_875_1828 298
201 3300034817 Ga0373948_0015168 Ga0373948_0015168_221_1174 298
202 3300034818 Ga0373950_0000763 Ga0373950_0000763_1179_2132 298
203 3300035084 Ga0373928_0010096 Ga0373928_0010096_340_1293 298
204 3300035085 Ga0373929_0001491 Ga0373929_0001491_1998_2951 298
205 3300035088 Ga0373940_0002297 Ga0373940_0002297_1509_2462 298
206 3300035090 Ga0373949_0001478 Ga0373949_0001478_1914_2867 298
207 3300035092 Ga0373952_0000512 Ga0373952_0000512_4316_5269 298
208 3300035112 Ga0373932_0001481 Ga0373932_0001481_3945_4898 298
209 3300035114 Ga0373939_0000394 Ga0373939_0000394_1945_2898 298
210 3300035115 Ga0373941_0001265 Ga0373941_0001265_2609_3562 298
211 3300035119 Ga0373956_0068737 Ga0373956_0068737_643_1539 298
212 3300035121 Ga0373960_0000197 Ga0373960_0000197_7312_8265 298
213 3300035207 Ga0373942_0002148 Ga0373942_0002148_3595_4548 298
214 3300035241 Ga0373961_0001086 Ga0373961_0001086_2498_3451 298
215 3300035242 Ga0373962_0002646 Ga0373962_0002646_2722_3675 298
216 3300035691 Ga0373931_0005366 Ga0373931_0005366_2193_3146 298
217 3300035695 Ga0373927_0133869 Ga0373927_0133869_367_1284 298
218 3300035725 Ga0373947_0063497 Ga0373947_0063497_910_1827 298
219 3300037068 Ga0373925_0001894 Ga0373925_0001894_7040_7981 298
220 3300037068 Ga0373925_0045889 Ga0373925_0045889_963_1880 298
221 3300046477 Ga0495664_0077226 Ga0495664_0077226_155_1051 298
222 3300046511 Ga0495608_0002090 Ga0495608_0002090_2255_3151 298
223 3300046517 Ga0495630_0343913 Ga0495630_0343913_202_1098 298
224 3300046529 Ga0495652_0100733 Ga0495652_0100733_479_1375 298
225 3300046543 Ga0495645_0023365 Ga0495645_0023365_1124_2020 298
226 3300046559 Ga0495667_0013809 Ga0495667_0013809_2658_3554 298
227 3300047317 Ga0495604_0032452 Ga0495604_0032452_3045_3941 298
228 3300047471 Ga0495684_0000087 Ga0495684_0000087_62468_63364 298
229 3300048904 Ga0496101_0269181 Ga0496101_0269181_374_1276 298
230 3300048917 Ga0496114_0398211 Ga0496114_0398211_44_940 298
231 3300048918 Ga0496115_0092369 Ga0496115_0092369_1087_1983 298
232 3300049588 Ga0501072_0133588 Ga0501072_0133588_962_1864 298
233 3300049744 Ga0501083_0096908 Ga0501083_0096908_162_1064 298
234 3300050491 nmdc:mga00v17_61340_c1 nmdc:mga00v17_61340_c1_650_1552 298
235 3300050511 nmdc:mga08y16_104463_c1 nmdc:mga08y16_104463_c1_477_1376 298
236 3300050512 nmdc:mga0n895_522124_c1 nmdc:mga0n895_522124_c1_125_1063 298
237 3300050512 nmdc:mga0n895_8171_c1 nmdc:mga0n895_8171_c1_8037_8933 298
238 3300050513 nmdc:mga0rr50_243959_c1 nmdc:mga0rr50_243959_c1_51_989 298
239 3300050514 nmdc:mga08x19_7678_c1 nmdc:mga08x19_7678_c1_2115_3011 298
240 3300050515 nmdc:mga0a205_505504_c1 nmdc:mga0a205_505504_c1_13_912 298
241 3300050515 nmdc:mga0a205_72273_c1 nmdc:mga0a205_72273_c1_1687_2583 298
242 3300053077 Ga0495601_0030442 Ga0495601_0030442_1863_2759 298
243 3300053085 Ga0495619_0002209 Ga0495619_0002209_763_1659 298
244 3300005290 Ga0065712_10089488 Ga0065712_100894883 299
245 3300005295 Ga0065707_10085126 Ga0065707_100851265 299
246 3300005328 Ga0070676_10111785 Ga0070676_101117852 299
247 3300005331 Ga0070670_100020506 Ga0070670_1000205068 299
248 3300005334 Ga0068869_100123772 Ga0068869_1001237722 299
249 3300005341 Ga0070691_10018650 Ga0070691_100186503 299
250 3300005344 Ga0070661_100010515 Ga0070661_1000105154 299
251 3300005347 Ga0070668_100081666 Ga0070668_1000816662 299
252 3300005353 Ga0070669_100053201 Ga0070669_1000532013 299
253 3300005354 Ga0070675_100000204 Ga0070675_10000020426 299
254 3300005354 Ga0070675_100102316 Ga0070675_1001023163 299
255 3300005356 Ga0070674_100093667 Ga0070674_1000936672 299
256 3300005356 Ga0070674_100107158 Ga0070674_1001071581 299
257 3300005356 Ga0070674_100324182 Ga0070674_1003241821 299
258 3300005365 Ga0070688_100286013 Ga0070688_1002860131 299
259 3300005367 Ga0070667_100025435 Ga0070667_1000254352 299
260 3300005436 Ga0070713_100034896 Ga0070713_1000348963 299
261 3300005438 Ga0070701_10064111 Ga0070701_100641113 299
262 3300005440 Ga0070705_100005417 Ga0070705_1000054172 299
263 3300005441 Ga0070700_100053347 Ga0070700_1000533472 299
264 3300005444 Ga0070694_100004755 Ga0070694_1000047555 299
265 3300005455 Ga0070663_100142291 Ga0070663_1001422911 299
266 3300005457 Ga0070662_100271387 Ga0070662_1002713872 299
267 3300005458 Ga0070681_10058717 Ga0070681_100587173 299
268 3300005459 Ga0068867_100015354 Ga0068867_1000153542 299
269 3300005467 Ga0070706_100116848 Ga0070706_1001168483 299
270 3300005467 Ga0070706_100395844 Ga0070706_1003958441 299
271 3300005468 Ga0070707_100045492 Ga0070707_1000454924 299
272 3300005471 Ga0070698_100127135 Ga0070698_1001271352 299
273 3300005518 Ga0070699_100037950 Ga0070699_1000379502 299
274 3300005518 Ga0070699_100183384 Ga0070699_1001833843 299
275 3300005543 Ga0070672_100188184 Ga0070672_1001881842 299
276 3300005543 Ga0070672_100275184 Ga0070672_1002751842 299
277 3300005544 Ga0070686_100060592 Ga0070686_1000605922 299
278 3300005545 Ga0070695_100006575 Ga0070695_1000065755 299
279 3300005546 Ga0070696_100096947 Ga0070696_1000969472 299
280 3300005546 Ga0070696_100145236 Ga0070696_1001452363 299
281 3300005546 Ga0070696_100276753 Ga0070696_1002767531 299
282 3300005548 Ga0070665_100029854 Ga0070665_1000298543 299
283 3300005548 Ga0070665_100188240 Ga0070665_1001882403 299
284 3300005549 Ga0070704_100040889 Ga0070704_1000408893 299
285 3300005549 Ga0070704_100203860 Ga0070704_1002038602 299
286 3300005549 Ga0070704_100470734 Ga0070704_1004707341 299
287 3300005578 Ga0068854_100037060 Ga0068854_1000370603 299
288 3300005578 Ga0068854_100059275 Ga0068854_1000592753 299
289 3300005615 Ga0070702_100199602 Ga0070702_1001996021 299
290 3300005617 Ga0068859_100185385 Ga0068859_1001853852 299
291 3300005617 Ga0068859_100235567 Ga0068859_1002355672 299
292 3300005618 Ga0068864_100012241 Ga0068864_1000122412 299
293 3300005618 Ga0068864_100071795 Ga0068864_1000717952 299
294 3300005718 Ga0068866_10086760 Ga0068866_100867601 299
295 3300005719 Ga0068861_100161555 Ga0068861_1001615552 299
296 3300005719 Ga0068861_100169451 Ga0068861_1001694512 299
297 3300005841 Ga0068863_100001180 Ga0068863_10000118010 299
298 3300005842 Ga0068858_100117617 Ga0068858_1001176173 299
299 3300005843 Ga0068860_100028012 Ga0068860_1000280123 299
300 3300005844 Ga0068862_100015252 Ga0068862_1000152524 299
301 3300005937 Ga0081455_10030864 Ga0081455_100308643 299
302 3300006358 Ga0068871_100004628 Ga0068871_1000046287 299
303 3300006358 Ga0068871_100104825 Ga0068871_1001048253 299
304 3300006844 Ga0075428_100057643 Ga0075428_1000576435 299
305 3300006847 Ga0075431_100107539 Ga0075431_1001075392 299
306 3300006847 Ga0075431_100131763 Ga0075431_1001317633 299
307 3300006852 Ga0075433_10027177 Ga0075433_100271774 299
308 3300006852 Ga0075433_10034721 Ga0075433_100347213 299
309 3300006852 Ga0075433_10055303 Ga0075433_100553032 299
310 3300006852 Ga0075433_10082567 Ga0075433_100825671 299
311 3300006871 Ga0075434_100010651 Ga0075434_1000106512 299
312 3300006871 Ga0075434_100147274 Ga0075434_1001472741 299
313 3300006880 Ga0075429_100056466 Ga0075429_1000564664 299
314 3300006880 Ga0075429_100138655 Ga0075429_1001386552 299
315 3300006881 Ga0068865_100017560 Ga0068865_1000175604 299
316 3300006881 Ga0068865_100093745 Ga0068865_1000937452 299
317 3300006914 Ga0075436_100022899 Ga0075436_1000228994 299
318 3300006931 Ga0097620_100185389 Ga0097620_1001853892 299
319 3300006931 Ga0097620_100235585 Ga0097620_1002355851 299
320 3300007076 Ga0075435_100005047 Ga0075435_1000050474 299
321 3300007076 Ga0075435_100018838 Ga0075435_1000188381 299
322 3300007076 Ga0075435_100019935 Ga0075435_1000199353 299
323 3300007076 Ga0075435_100220460 Ga0075435_1002204602 299
324 3300009094 Ga0111539_10006195 Ga0111539_1000619510 299
325 3300009094 Ga0111539_10040254 Ga0111539_100402543 299
326 3300009147 Ga0114129_10024644 Ga0114129_100246447 299
327 3300009147 Ga0114129_10030155 Ga0114129_100301551 299
328 3300009147 Ga0114129_10063076 Ga0114129_100630765 299
329 3300009147 Ga0114129_10105469 Ga0114129_101054693 299
330 3300009147 Ga0114129_10217124 Ga0114129_102171242 299
331 3300009147 Ga0114129_10224866 Ga0114129_102248662 299
332 3300009148 Ga0105243_10323108 Ga0105243_103231081 299
333 3300009176 Ga0105242_10223274 Ga0105242_102232741 299
334 3300009177 Ga0105248_10008980 Ga0105248_100089808 299
335 3300009177 Ga0105248_10043026 Ga0105248_100430262 299
336 3300009177 Ga0105248_10072035 Ga0105248_100720353 299
337 3300009177 Ga0105248_10216113 Ga0105248_102161132 299
338 3300009553 Ga0105249_10178632 Ga0105249_101786323 299
339 3300013308 Ga0157375_10140725 Ga0157375_101407251 299
340 3300013308 Ga0157375_10208565 Ga0157375_102085652 299
341 3300014325 Ga0163163_10014644 Ga0163163_100146443 299
342 3300014325 Ga0163163_10175737 Ga0163163_101757373 299
343 3300014326 Ga0157380_10090294 Ga0157380_100902943 299
344 3300014326 Ga0157380_10120448 Ga0157380_101204481 299
345 3300025899 Ga0207642_10009984 Ga0207642_100099843 299
346 3300025907 Ga0207645_10012339 Ga0207645_100123393 299
347 3300025907 Ga0207645_10117682 Ga0207645_101176822 299
348 3300025918 Ga0207662_10092370 Ga0207662_100923702 299
349 3300025921 Ga0207652_10061614 Ga0207652_100616143 299
350 3300025922 Ga0207646_10068402 Ga0207646_100684022 299
351 3300025922 Ga0207646_10074523 Ga0207646_100745232 299
352 3300025922 Ga0207646_10239663 Ga0207646_102396632 299
353 3300025922 Ga0207646_10265293 Ga0207646_102652931 299
354 3300025923 Ga0207681_10020570 Ga0207681_100205703 299
355 3300025923 Ga0207681_10130947 Ga0207681_101309472 299
356 3300025923 Ga0207681_10142506 Ga0207681_101425061 299
357 3300025923 Ga0207681_10215077 Ga0207681_102150771 299
358 3300025923 Ga0207681_10270414 Ga0207681_102704142 299
359 3300025926 Ga0207659_10000201 Ga0207659_100002017 299
360 3300025933 Ga0207706_10008438 Ga0207706_100084383 299
361 3300025933 Ga0207706_10043039 Ga0207706_100430392 299
362 3300025933 Ga0207706_10133230 Ga0207706_101332303 299
363 3300025934 Ga0207686_10270106 Ga0207686_102701062 299
364 3300025935 Ga0207709_10025070 Ga0207709_100250703 299
365 3300025935 Ga0207709_10029823 Ga0207709_100298232 299
366 3300025936 Ga0207670_10090854 Ga0207670_100908541 299
367 3300025936 Ga0207670_10120022 Ga0207670_101200222 299
368 3300025937 Ga0207669_10053151 Ga0207669_100531513 299
369 3300025938 Ga0207704_10116918 Ga0207704_101169181 299
370 3300025940 Ga0207691_10077563 Ga0207691_100775633 299
371 3300025941 Ga0207711_10073700 Ga0207711_100737003 299
372 3300025942 Ga0207689_10008919 Ga0207689_100089199 299
373 3300025942 Ga0207689_10187395 Ga0207689_101873952 299
374 3300025945 Ga0207679_10303854 Ga0207679_103038541 299
375 3300025961 Ga0207712_10242383 Ga0207712_102423832 299
376 3300025972 Ga0207668_10127821 Ga0207668_101278213 299
377 3300025981 Ga0207640_10046287 Ga0207640_100462873 299
378 3300025981 Ga0207640_10170049 Ga0207640_101700492 299
379 3300025986 Ga0207658_10056756 Ga0207658_100567563 299
380 3300026023 Ga0207677_10148564 Ga0207677_101485642 299
381 3300026035 Ga0207703_10007098 Ga0207703_100070989 299
382 3300026035 Ga0207703_10096489 Ga0207703_100964892 299
383 3300026075 Ga0207708_10029358 Ga0207708_100293583 299
384 3300026075 Ga0207708_10063345 Ga0207708_100633452 299
385 3300026088 Ga0207641_10003014 Ga0207641_1000301411 299
386 3300026088 Ga0207641_10331127 Ga0207641_103311272 299
387 3300026089 Ga0207648_10004852 Ga0207648_100048527 299
388 3300026095 Ga0207676_10029891 Ga0207676_100298912 299
389 3300026095 Ga0207676_10563737 Ga0207676_105637371 299
390 3300026118 Ga0207675_100004887 Ga0207675_10000488711 299
391 3300026118 Ga0207675_100023742 Ga0207675_1000237421 299
392 3300026118 Ga0207675_100216163 Ga0207675_1002161632 299
393 3300027907 Ga0207428_10006320 Ga0207428_100063204 299
394 3300027907 Ga0207428_10024918 Ga0207428_100249183 299
395 3300028379 Ga0268266_10191549 Ga0268266_101915493 299
396 3300028380 Ga0268265_10022180 Ga0268265_100221801 299
397 3300028381 Ga0268264_10523762 Ga0268264_105237622 299
398 3300028381 Ga0268264_10648550 Ga0268264_106485501 299
399 3300035086 Ga0373934_0000435 Ga0373934_0000435_7375_8274 299
400 3300035113 Ga0373936_0060418 Ga0373936_0060418_344_1243 299
401 3300035115 Ga0373941_0048390 Ga0373941_0048390_327_1280 299
402 3300035116 Ga0373945_0017943 Ga0373945_0017943_190_1089 299
403 3300035117 Ga0373953_0019363 Ga0373953_0019363_692_1591 299
404 3300035118 Ga0373954_0033370 Ga0373954_0033370_295_1194 299
405 3300035119 Ga0373956_0005080 Ga0373956_0005080_2822_3721 299
406 3300035119 Ga0373956_0054844 Ga0373956_0054844_485_1384 299
407 3300035120 Ga0373957_0045335 Ga0373957_0045335_268_1167 299
408 3300035171 Ga0373946_0012901 Ga0373946_0012901_1659_2558 299
409 3300035410 Ga0373924_0045634 Ga0373924_0045634_180_1079 299
410 3300035410 Ga0373924_0077373 Ga0373924_0077373_68_997 299
411 3300035692 Ga0373935_0029809 Ga0373935_0029809_1104_2003 299
412 3300035725 Ga0373947_0135777 Ga0373947_0135777_375_1274 299
413 3300035725 Ga0373947_0211701 Ga0373947_0211701_256_1155 299
414 3300036401 Ga0373937_0000232 Ga0373937_0000232_16982_17881 299
415 3300036401 Ga0373937_0010656 Ga0373937_0010656_1424_2353 299
416 3300036401 Ga0373937_0392039 Ga0373937_0392039_330_1229 299
417 3300037068 Ga0373925_0017187 Ga0373925_0017187_3766_4665 299
418 3300037068 Ga0373925_0116086 Ga0373925_0116086_1003_1902 299
419 3300045051 Ga0451576_0414552 Ga0451576_0414552_280_1194 299
420 3300045976 Ga0466967_0247692 Ga0466967_0247692_760_1680 299
421 3300046462 Ga0495651_0097652 Ga0495651_0097652_500_1399 299
422 3300046472 Ga0495580_0059543 Ga0495580_0059543_40_939 299
423 3300046477 Ga0495664_0158816 Ga0495664_0158816_243_1151 299
424 3300046535 Ga0495586_0099893 Ga0495586_0099893_241_1149 299
425 3300046535 Ga0495586_0102645 Ga0495586_0102645_632_1531 299
426 3300046543 Ga0495645_0193467 Ga0495645_0193467_420_1349 299
427 3300046663 Ga0495635_0189881 Ga0495635_0189881_299_1294 299
428 3300046679 Ga0495623_0084687 Ga0495623_0084687_229_1158 299
429 3300046681 Ga0495647_0004938 Ga0495647_0004938_2298_3197 299
430 3300046683 Ga0495658_0030840 Ga0495658_0030840_632_1531 299
431 3300046683 Ga0495658_0114177 Ga0495658_0114177_440_1339 299
432 3300046683 Ga0495658_0217473 Ga0495658_0217473_267_1166 299
433 3300046684 Ga0495669_0006162 Ga0495669_0006162_766_1665 299
434 3300047673 Ga0495593_0173710 Ga0495593_0173710_30_929 299
435 3300048905 Ga0496102_0457125 Ga0496102_0457125_44_943 299
436 3300048905 Ga0496102_0484123 Ga0496102_0484123_102_1022 299
437 3300048912 Ga0496109_0088313 Ga0496109_0088313_1454_2359 299
438 3300048912 Ga0496109_0307898 Ga0496109_0307898_519_1418 299
439 3300048915 Ga0496112_0006375 Ga0496112_0006375_8395_9294 299
440 3300048917 Ga0496114_0214678 Ga0496114_0214678_630_1529 299
441 3300050507 nmdc:mga05p37_150692_c1 nmdc:mga05p37_150692_c1_40_939 299
442 3300050507 nmdc:mga05p37_16284_c1 nmdc:mga05p37_16284_c1_4632_5531 299
443 3300050507 nmdc:mga05p37_171806_c1 nmdc:mga05p37_171806_c1_1014_1934 299
444 3300050507 nmdc:mga05p37_20210_c1 nmdc:mga05p37_20210_c1_4606_5505 299
445 3300050507 nmdc:mga05p37_26789_c1 nmdc:mga05p37_26789_c1_194_1093 299
446 3300050507 nmdc:mga05p37_305221_c1 nmdc:mga05p37_305221_c1_112_1098 299
447 3300050507 nmdc:mga05p37_8548_c1 nmdc:mga05p37_8548_c1_6643_7542 299
448 3300050510 nmdc:mga06r32_314438_c1 nmdc:mga06r32_314438_c1_422_1321 299
449 3300050510 nmdc:mga06r32_71756_c1 nmdc:mga06r32_71756_c1_663_1586 299
450 3300050511 nmdc:mga08y16_23190_c1 nmdc:mga08y16_23190_c1_4534_5433 299
451 3300050511 nmdc:mga08y16_556937_c1 nmdc:mga08y16_556937_c1_118_1029 299
452 3300050512 nmdc:mga0n895_157888_c1 nmdc:mga0n895_157888_c1_121_1020 299
453 3300050512 nmdc:mga0n895_79886_c1 nmdc:mga0n895_79886_c1_499_1398 299
454 3300050513 nmdc:mga0rr50_210485_c1 nmdc:mga0rr50_210485_c1_498_1397 299
455 3300050515 nmdc:mga0a205_49331_c1 nmdc:mga0a205_49331_c1_2607_3506 299
456 3300050515 nmdc:mga0a205_69584_c1 nmdc:mga0a205_69584_c1_37_936 299
457 3300053077 Ga0495601_0117828 Ga0495601_0117828_719_1687 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13180

PDZ_2

PDZ domain

226

316

0.94

PF13365

Trypsin_2

Trypsin-like peptidase domain

57

191

0.91

PF17820

PDZ_6

PDZ domain

251

305

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lgt-assembly1.cif.gz_A y162a/h198p double mutant of degs-deltapdz protease 0.8925 16 197
3k6y-assembly1.cif.gz_A crystal structure of rv3671c protease from m. tuberculosis, active form 0.8911 16 191
3k6z-assembly1.cif.gz_B crystal structure of rv3671c protease, inactive form 0.8896 16 193
3b8j-assembly1.cif.gz_A q191a mutant of degs-deltapdz 0.8885 16 194
2qgr-assembly1.cif.gz_A structure of the r178a mutant of delta pdz degs protease 0.8872 16 194
ID Description Score Start End Superfamily
3gdvC03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9343 201 299 2.30.42.10
3gdvC03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9149 201 299 2.30.42.10
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9059 22 94 2.40.10.10
af_F1QL69_2_87_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9037 226 292 2.30.42.10
3stiA01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.8955 13 87 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A2V8E7W3-F1-model_v4 Uncharacterized protein 0.9718 1 115
AF-A0A3N5VEM7-F1-model_v4 Serine protease 0.9411 5 165 GO:0004252
GO:0005886
GO:0006515
GO:0042597
AF-A0A3M1SQ67-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9358 201 296 GO:0004177
GO:0006508
GO:0008235
AF-A0A535PW73-F1-model_v4 PDZ domain-containing protein 0.9353 205 292
AF-A0A3E1NPQ3-F1-model_v4 PDZ domain-containing protein 0.9335 200 295 GO:0006515
GO:0042597

Feature Viewer

pLDDT pTM Quality
89.63 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map