F448058
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 457 | 224 | 457 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300046663|Ga0495635_0189881|Ga0495635_0189881_299_1294 |
| Length | 331 |
| Sequence | MIPGPFAARLGDSQRRPFCHDPRMATDLLSSFSNQLADAVSAASPSVVQVQGRRRPASGLVYADNVVLTTVRALGREDGLHVRRHDGRTLDAELAGWDPTTSLAVLRVAGLDTPPLAPAATAPRVGHLALAVARSWSNVVTASAGIVSVIGGPLPTGRRRAIDQVIRTTAPMHDGFAGGAFLDTAGGLIGIATAAAIRGLGVVIPAAIAWKTAATVLEHGSLRRGYLGLAGQPVALPEGQGGADGREQALLVVGVTSGGPASQAGVLVGDLLLEFDGHPVEAPEELLDLLLGDRVGRAVALKILRGGTVAEVTVTVGEFLASDSGGEKIEI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 142 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 143 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 153 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 173 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 174 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 212 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.44 |
| Nodule | 0 |
| Rhizoplane | 2.19 |
| Rhizosphere | 97.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10089488 | 3300005290 | Bacteria | 2467 |
| 2 | Ga0065707_10085126 | 3300005295 | Bacteria | 6432 |
| 3 | Ga0070676_10111785 | 3300005328 | Bacteria | 1702 |
| 4 | Ga0070670_100002204 | 3300005331 | Bacteria | 16016 |
| 5 | Ga0070670_100020506 | 3300005331 | Bacteria | 5683 |
| 6 | Ga0070677_10154368 | 3300005333 | Unclassified | 1071 |
| 7 | Ga0068869_100002479 | 3300005334 | Bacteria | 11131 |
| 8 | Ga0068869_100011346 | 3300005334 | Bacteria | 5839 |
| 9 | Ga0068869_100123772 | 3300005334 | Bacteria | 1981 |
| 10 | Ga0070666_10001247 | 3300005335 | Bacteria | 15395 |
| 11 | Ga0070666_10254858 | 3300005335 | Bacteria | 1243 |
| 12 | Ga0068868_100189331 | 3300005338 | Unclassified | 1711 |
| 13 | Ga0070689_100413565 | 3300005340 | Bacteria | 1142 |
| 14 | Ga0070691_10018650 | 3300005341 | Bacteria | 3199 |
| 15 | Ga0070687_100229435 | 3300005343 | Bacteria | 1142 |
| 16 | Ga0070661_100010515 | 3300005344 | Bacteria | 6434 |
| 17 | Ga0070668_100081666 | 3300005347 | Bacteria | 2534 |
| 18 | Ga0070668_100427206 | 3300005347 | Bacteria | 1135 |
| 19 | Ga0070669_100053201 | 3300005353 | Bacteria | 2963 |
| 20 | Ga0070669_100150726 | 3300005353 | Unclassified | 1800 |
| 21 | Ga0070675_100000204 | 3300005354 | Bacteria | 37628 |
| 22 | Ga0070675_100000342 | 3300005354 | Bacteria | 31497 |
| 23 | Ga0070675_100001621 | 3300005354 | Bacteria | 16598 |
| 24 | Ga0070675_100027339 | 3300005354 | Bacteria | 4583 |
| 25 | Ga0070675_100102316 | 3300005354 | Bacteria | 2414 |
| 26 | Ga0070671_100206881 | 3300005355 | Bacteria | 1664 |
| 27 | Ga0070674_100093453 | 3300005356 | Bacteria | 2176 |
| 28 | Ga0070674_100093667 | 3300005356 | Unclassified | 2174 |
| 29 | Ga0070674_100107158 | 3300005356 | Unclassified | 2046 |
| 30 | Ga0070674_100324182 | 3300005356 | Bacteria | 1236 |
| 31 | Ga0070673_100020088 | 3300005364 | Bacteria | 4810 |
| 32 | Ga0070688_100011900 | 3300005365 | Bacteria | 4857 |
| 33 | Ga0070688_100286013 | 3300005365 | Bacteria | 1187 |
| 34 | Ga0070688_100418576 | 3300005365 | Bacteria | 995 |
| 35 | Ga0070667_100025435 | 3300005367 | Bacteria | 4922 |
| 36 | Ga0070713_100034896 | 3300005436 | Bacteria | 4046 |
| 37 | Ga0070713_100122950 | 3300005436 | Bacteria | 2279 |
| 38 | Ga0070701_10009264 | 3300005438 | Bacteria | 4306 |
| 39 | Ga0070701_10064111 | 3300005438 | Unclassified | 1946 |
| 40 | Ga0070711_100076447 | 3300005439 | Bacteria | 2374 |
| 41 | Ga0070705_100005417 | 3300005440 | Bacteria | 6218 |
| 42 | Ga0070700_100053347 | 3300005441 | Bacteria | 2523 |
| 43 | Ga0070694_100004755 | 3300005444 | Bacteria | 8179 |
| 44 | Ga0070663_100142291 | 3300005455 | Unclassified | 1832 |
| 45 | Ga0070678_100054569 | 3300005456 | Unclassified | 2913 |
| 46 | Ga0070662_100081285 | 3300005457 | Bacteria | 2414 |
| 47 | Ga0070662_100271387 | 3300005457 | Unclassified | 1370 |
| 48 | Ga0070681_10058717 | 3300005458 | Bacteria | 3827 |
| 49 | Ga0068867_100005747 | 3300005459 | Bacteria | 8800 |
| 50 | Ga0068867_100015354 | 3300005459 | Bacteria | 5431 |
| 51 | Ga0070685_10076034 | 3300005466 | Bacteria | 2002 |
| 52 | Ga0070706_100116848 | 3300005467 | Bacteria | 2485 |
| 53 | Ga0070706_100395844 | 3300005467 | Bacteria | 1286 |
| 54 | Ga0070707_100045492 | 3300005468 | Bacteria | 4202 |
| 55 | Ga0070698_100127135 | 3300005471 | Bacteria | 2506 |
| 56 | Ga0070699_100037950 | 3300005518 | Bacteria | 4171 |
| 57 | Ga0070699_100183384 | 3300005518 | Bacteria | 1858 |
| 58 | Ga0070684_100105726 | 3300005535 | Bacteria | 2519 |
| 59 | Ga0070672_100143187 | 3300005543 | Bacteria | 1973 |
| 60 | Ga0070672_100188184 | 3300005543 | Bacteria | 1722 |
| 61 | Ga0070672_100275184 | 3300005543 | Unclassified | 1422 |
| 62 | Ga0070672_100278685 | 3300005543 | Bacteria | 1413 |
| 63 | Ga0070686_100001018 | 3300005544 | Bacteria | 16128 |
| 64 | Ga0070686_100060592 | 3300005544 | Bacteria | 2442 |
| 65 | Ga0070686_100085884 | 3300005544 | Bacteria | 2094 |
| 66 | Ga0070695_100006575 | 3300005545 | Bacteria | 6868 |
| 67 | Ga0070696_100096947 | 3300005546 | Bacteria | 2108 |
| 68 | Ga0070696_100097991 | 3300005546 | Bacteria | 2097 |
| 69 | Ga0070696_100145236 | 3300005546 | Bacteria | 1737 |
| 70 | Ga0070696_100276753 | 3300005546 | Unclassified | 1278 |
| 71 | Ga0070665_100029854 | 3300005548 | Bacteria | 5487 |
| 72 | Ga0070665_100039676 | 3300005548 | Bacteria | 4734 |
| 73 | Ga0070665_100105379 | 3300005548 | Bacteria | 2822 |
| 74 | Ga0070665_100188240 | 3300005548 | Bacteria | 2065 |
| 75 | Ga0070704_100040889 | 3300005549 | Bacteria | 3195 |
| 76 | Ga0070704_100127515 | 3300005549 | Bacteria | 1966 |
| 77 | Ga0070704_100203860 | 3300005549 | Bacteria | 1598 |
| 78 | Ga0070704_100305000 | 3300005549 | Bacteria | 1328 |
| 79 | Ga0070704_100335158 | 3300005549 | Bacteria | 1272 |
| 80 | Ga0070704_100470734 | 3300005549 | Bacteria | 1085 |
| 81 | Ga0068855_100303069 | 3300005563 | Bacteria | 1769 |
| 82 | Ga0070664_100047784 | 3300005564 | Bacteria | 3616 |
| 83 | Ga0070664_100210718 | 3300005564 | Bacteria | 1736 |
| 84 | Ga0068857_100207129 | 3300005577 | Unclassified | 1789 |
| 85 | Ga0068854_100005014 | 3300005578 | Bacteria | 8349 |
| 86 | Ga0068854_100037060 | 3300005578 | Bacteria | 3421 |
| 87 | Ga0068854_100059275 | 3300005578 | Bacteria | 2766 |
| 88 | Ga0070702_100098759 | 3300005615 | Bacteria | 1787 |
| 89 | Ga0070702_100199602 | 3300005615 | Bacteria | 1323 |
| 90 | Ga0068852_100544627 | 3300005616 | Bacteria | 1160 |
| 91 | Ga0068859_100045205 | 3300005617 | Bacteria | 4425 |
| 92 | Ga0068859_100185385 | 3300005617 | Unclassified | 2165 |
| 93 | Ga0068859_100213636 | 3300005617 | Bacteria | 2016 |
| 94 | Ga0068859_100235567 | 3300005617 | Unclassified | 1919 |
| 95 | Ga0068859_100670995 | 3300005617 | Bacteria | 1128 |
| 96 | Ga0068864_100012241 | 3300005618 | Bacteria | 7089 |
| 97 | Ga0068864_100071795 | 3300005618 | Bacteria | 3016 |
| 98 | Ga0068864_100137219 | 3300005618 | Bacteria | 2203 |
| 99 | Ga0068866_10086760 | 3300005718 | Bacteria | 1694 |
| 100 | Ga0068861_100014453 | 3300005719 | Bacteria | 5541 |
| 101 | Ga0068861_100161555 | 3300005719 | Bacteria | 1848 |
| 102 | Ga0068861_100169451 | 3300005719 | Unclassified | 1808 |
| 103 | Ga0068870_10007702 | 3300005840 | Bacteria | 4815 |
| 104 | Ga0068870_10079544 | 3300005840 | Bacteria | 1809 |
| 105 | Ga0068863_100001180 | 3300005841 | Bacteria | 26124 |
| 106 | Ga0068863_100095828 | 3300005841 | Unclassified | 2817 |
| 107 | Ga0068863_100118780 | 3300005841 | Unclassified | 2520 |
| 108 | Ga0068858_100003770 | 3300005842 | Bacteria | 14981 |
| 109 | Ga0068858_100041858 | 3300005842 | Bacteria | 4246 |
| 110 | Ga0068858_100117617 | 3300005842 | Bacteria | 2485 |
| 111 | Ga0068858_100240293 | 3300005842 | Bacteria | 1718 |
| 112 | Ga0068860_100028012 | 3300005843 | Bacteria | 5424 |
| 113 | Ga0068860_100081348 | 3300005843 | Bacteria | 3080 |
| 114 | Ga0068860_100366107 | 3300005843 | Unclassified | 1421 |
| 115 | Ga0068860_100486959 | 3300005843 | Bacteria | 1230 |
| 116 | Ga0068862_100015252 | 3300005844 | Bacteria | 6382 |
| 117 | Ga0081455_10030864 | 3300005937 | Bacteria | 4861 |
| 118 | Ga0075364_10038108 | 3300006051 | Bacteria | 3115 |
| 119 | Ga0068871_100004628 | 3300006358 | Bacteria | 9607 |
| 120 | Ga0068871_100061619 | 3300006358 | Unclassified | 3064 |
| 121 | Ga0068871_100104825 | 3300006358 | Bacteria | 2372 |
| 122 | Ga0075428_100002943 | 3300006844 | Bacteria | 18557 |
| 123 | Ga0075428_100057643 | 3300006844 | Bacteria | 4252 |
| 124 | Ga0075430_100493688 | 3300006846 | Bacteria | 1010 |
| 125 | Ga0075431_100107539 | 3300006847 | Bacteria | 2878 |
| 126 | Ga0075431_100131763 | 3300006847 | Bacteria | 2578 |
| 127 | Ga0075433_10027177 | 3300006852 | Bacteria | 4851 |
| 128 | Ga0075433_10034721 | 3300006852 | Bacteria | 4333 |
| 129 | Ga0075433_10055303 | 3300006852 | Bacteria | 3464 |
| 130 | Ga0075433_10082567 | 3300006852 | Unclassified | 2834 |
| 131 | Ga0075434_100000026 | 3300006871 | Bacteria | 68165 |
| 132 | Ga0075434_100010651 | 3300006871 | Bacteria | 8631 |
| 133 | Ga0075434_100123878 | 3300006871 | Bacteria | 2601 |
| 134 | Ga0075434_100147274 | 3300006871 | Bacteria | 2375 |
| 135 | Ga0075434_100560014 | 3300006871 | Bacteria | 1163 |
| 136 | Ga0075429_100008693 | 3300006880 | Bacteria | 8837 |
| 137 | Ga0075429_100044176 | 3300006880 | Bacteria | 3876 |
| 138 | Ga0075429_100056466 | 3300006880 | Unclassified | 3417 |
| 139 | Ga0075429_100138655 | 3300006880 | Bacteria | 2129 |
| 140 | Ga0075429_100355909 | 3300006880 | Bacteria | 1282 |
| 141 | Ga0068865_100017560 | 3300006881 | Bacteria | 4603 |
| 142 | Ga0068865_100093745 | 3300006881 | Unclassified | 2184 |
| 143 | Ga0075436_100000600 | 3300006914 | Bacteria | 23619 |
| 144 | Ga0075436_100009299 | 3300006914 | Bacteria | 6724 |
| 145 | Ga0075436_100022899 | 3300006914 | Bacteria | 4291 |
| 146 | Ga0097620_100045206 | 3300006931 | Bacteria | 4425 |
| 147 | Ga0097620_100185389 | 3300006931 | Unclassified | 2165 |
| 148 | Ga0097620_100213631 | 3300006931 | Bacteria | 2016 |
| 149 | Ga0097620_100235585 | 3300006931 | Unclassified | 1919 |
| 150 | Ga0097620_100671083 | 3300006931 | Bacteria | 1128 |
| 151 | Ga0075435_100000017 | 3300007076 | Bacteria | 99666 |
| 152 | Ga0075435_100005047 | 3300007076 | Bacteria | 9169 |
| 153 | Ga0075435_100006307 | 3300007076 | Bacteria | 8375 |
| 154 | Ga0075435_100007466 | 3300007076 | Bacteria | 7794 |
| 155 | Ga0075435_100018838 | 3300007076 | Bacteria | 5260 |
| 156 | Ga0075435_100019935 | 3300007076 | Bacteria | 5128 |
| 157 | Ga0075435_100028446 | 3300007076 | Bacteria | 4385 |
| 158 | Ga0075435_100220460 | 3300007076 | Bacteria | 1611 |
| 159 | Ga0111539_10000685 | 3300009094 | Bacteria | 43832 |
| 160 | Ga0111539_10006195 | 3300009094 | Bacteria | 15435 |
| 161 | Ga0111539_10040254 | 3300009094 | Bacteria | 5627 |
| 162 | Ga0105245_10331020 | 3300009098 | Bacteria | 1503 |
| 163 | Ga0105245_10461575 | 3300009098 | Unclassified | 1280 |
| 164 | Ga0114129_10008732 | 3300009147 | Bacteria | 14448 |
| 165 | Ga0114129_10024644 | 3300009147 | Bacteria | 8527 |
| 166 | Ga0114129_10030155 | 3300009147 | Bacteria | 7682 |
| 167 | Ga0114129_10063076 | 3300009147 | Bacteria | 5176 |
| 168 | Ga0114129_10105469 | 3300009147 | Bacteria | 3895 |
| 169 | Ga0114129_10150938 | 3300009147 | Unclassified | 3180 |
| 170 | Ga0114129_10217124 | 3300009147 | Bacteria | 2582 |
| 171 | Ga0114129_10224866 | 3300009147 | Bacteria | 2530 |
| 172 | Ga0114129_10396237 | 3300009147 | Bacteria | 1820 |
| 173 | Ga0114129_10410471 | 3300009147 | Bacteria | 1783 |
| 174 | Ga0114129_10850276 | 3300009147 | Unclassified | 1160 |
| 175 | Ga0105243_10020195 | 3300009148 | Bacteria | 5051 |
| 176 | Ga0105243_10323108 | 3300009148 | Bacteria | 1407 |
| 177 | Ga0105242_10024408 | 3300009176 | Bacteria | 4775 |
| 178 | Ga0105242_10027380 | 3300009176 | Bacteria | 4526 |
| 179 | Ga0105242_10223274 | 3300009176 | Unclassified | 1685 |
| 180 | Ga0105248_10008980 | 3300009177 | Bacteria | 10988 |
| 181 | Ga0105248_10043026 | 3300009177 | Bacteria | 5065 |
| 182 | Ga0105248_10072035 | 3300009177 | Bacteria | 3883 |
| 183 | Ga0105248_10212677 | 3300009177 | Bacteria | 2178 |
| 184 | Ga0105248_10216113 | 3300009177 | Bacteria | 2159 |
| 185 | Ga0105248_10243893 | 3300009177 | Bacteria | 2022 |
| 186 | Ga0105248_10876825 | 3300009177 | Bacteria | 1013 |
| 187 | Ga0105238_10020442 | 3300009551 | Bacteria | 6740 |
| 188 | Ga0105249_10015133 | 3300009553 | Bacteria | 6826 |
| 189 | Ga0105249_10178632 | 3300009553 | Bacteria | 2064 |
| 190 | Ga0105246_10006926 | 3300011119 | Bacteria | 6936 |
| 191 | Ga0105246_10366379 | 3300011119 | Bacteria | 1186 |
| 192 | Ga0163162_10071838 | 3300013306 | Unclassified | 3515 |
| 193 | Ga0163162_10079089 | 3300013306 | Bacteria | 3354 |
| 194 | Ga0157375_10140725 | 3300013308 | Bacteria | 2540 |
| 195 | Ga0157375_10190881 | 3300013308 | Bacteria | 2203 |
| 196 | Ga0157375_10208565 | 3300013308 | Bacteria | 2111 |
| 197 | Ga0163163_10014644 | 3300014325 | Bacteria | 7212 |
| 198 | Ga0163163_10175737 | 3300014325 | Bacteria | 2188 |
| 199 | Ga0157380_10013132 | 3300014326 | Bacteria | 6029 |
| 200 | Ga0157380_10022833 | 3300014326 | Bacteria | 4717 |
| 201 | Ga0157380_10090294 | 3300014326 | Bacteria | 2527 |
| 202 | Ga0157380_10120448 | 3300014326 | Unclassified | 2222 |
| 203 | Ga0157380_10120711 | 3300014326 | Bacteria | 2220 |
| 204 | Ga0157380_10170628 | 3300014326 | Bacteria | 1901 |
| 205 | Ga0157379_10011923 | 3300014968 | Bacteria | 7595 |
| 206 | Ga0157379_10019664 | 3300014968 | Bacteria | 5966 |
| 207 | Ga0157376_10009359 | 3300014969 | Bacteria | 7119 |
| 208 | Ga0163161_10114579 | 3300017792 | Bacteria | 2019 |
| 209 | Ga0207697_10000401 | 3300025315 | Bacteria | 24402 |
| 210 | Ga0207682_10141042 | 3300025893 | Unclassified | 1081 |
| 211 | Ga0207642_10009984 | 3300025899 | Bacteria | 3326 |
| 212 | Ga0207688_10001140 | 3300025901 | Bacteria | 13699 |
| 213 | Ga0207680_10001376 | 3300025903 | Bacteria | 11507 |
| 214 | Ga0207680_10005949 | 3300025903 | Bacteria | 5863 |
| 215 | Ga0207645_10002384 | 3300025907 | Bacteria | 14794 |
| 216 | Ga0207645_10012339 | 3300025907 | Bacteria | 5799 |
| 217 | Ga0207645_10026966 | 3300025907 | Bacteria | 3712 |
| 218 | Ga0207645_10117682 | 3300025907 | Unclassified | 1724 |
| 219 | Ga0207643_10003749 | 3300025908 | Bacteria | 8164 |
| 220 | Ga0207643_10073078 | 3300025908 | Bacteria | 1976 |
| 221 | Ga0207707_10048200 | 3300025912 | Bacteria | 3711 |
| 222 | Ga0207663_10160644 | 3300025916 | Bacteria | 1586 |
| 223 | Ga0207662_10002983 | 3300025918 | Bacteria | 8619 |
| 224 | Ga0207662_10092370 | 3300025918 | Bacteria | 1863 |
| 225 | Ga0207649_10025734 | 3300025920 | Bacteria | 3434 |
| 226 | Ga0207652_10061614 | 3300025921 | Bacteria | 3240 |
| 227 | Ga0207652_10222842 | 3300025921 | Bacteria | 1699 |
| 228 | Ga0207646_10068402 | 3300025922 | Bacteria | 3171 |
| 229 | Ga0207646_10074523 | 3300025922 | Bacteria | 3032 |
| 230 | Ga0207646_10239663 | 3300025922 | Bacteria | 1638 |
| 231 | Ga0207646_10265293 | 3300025922 | Unclassified | 1552 |
| 232 | Ga0207681_10020570 | 3300025923 | Bacteria | 4184 |
| 233 | Ga0207681_10031798 | 3300025923 | Bacteria | 3449 |
| 234 | Ga0207681_10130947 | 3300025923 | Bacteria | 1854 |
| 235 | Ga0207681_10142506 | 3300025923 | Bacteria | 1786 |
| 236 | Ga0207681_10215077 | 3300025923 | Bacteria | 1484 |
| 237 | Ga0207681_10270414 | 3300025923 | Bacteria | 1334 |
| 238 | Ga0207694_10434167 | 3300025924 | Bacteria | 1095 |
| 239 | Ga0207650_10460124 | 3300025925 | Bacteria | 1060 |
| 240 | Ga0207659_10000201 | 3300025926 | Bacteria | 35674 |
| 241 | Ga0207659_10001954 | 3300025926 | Bacteria | 12238 |
| 242 | Ga0207659_10003320 | 3300025926 | Bacteria | 9641 |
| 243 | Ga0207659_10009858 | 3300025926 | Bacteria | 5979 |
| 244 | Ga0207659_10022140 | 3300025926 | Bacteria | 4229 |
| 245 | Ga0207687_10052349 | 3300025927 | Unclassified | 2849 |
| 246 | Ga0207706_10008438 | 3300025933 | Bacteria | 9507 |
| 247 | Ga0207706_10043039 | 3300025933 | Bacteria | 4002 |
| 248 | Ga0207706_10133230 | 3300025933 | Unclassified | 2186 |
| 249 | Ga0207706_10267959 | 3300025933 | Unclassified | 1491 |
| 250 | Ga0207686_10179986 | 3300025934 | Bacteria | 1498 |
| 251 | Ga0207686_10270106 | 3300025934 | Unclassified | 1251 |
| 252 | Ga0207709_10025070 | 3300025935 | Bacteria | 3412 |
| 253 | Ga0207709_10029823 | 3300025935 | Bacteria | 3168 |
| 254 | Ga0207670_10090854 | 3300025936 | Bacteria | 2158 |
| 255 | Ga0207670_10120022 | 3300025936 | Bacteria | 1909 |
| 256 | Ga0207670_10367217 | 3300025936 | Bacteria | 1143 |
| 257 | Ga0207669_10026100 | 3300025937 | Bacteria | 3171 |
| 258 | Ga0207669_10043878 | 3300025937 | Unclassified | 2622 |
| 259 | Ga0207669_10053151 | 3300025937 | Bacteria | 2438 |
| 260 | Ga0207704_10007256 | 3300025938 | Bacteria | 5222 |
| 261 | Ga0207704_10116918 | 3300025938 | Bacteria | 1815 |
| 262 | Ga0207704_10197362 | 3300025938 | Bacteria | 1469 |
| 263 | Ga0207691_10000953 | 3300025940 | Bacteria | 28656 |
| 264 | Ga0207691_10077563 | 3300025940 | Bacteria | 2993 |
| 265 | Ga0207691_10150385 | 3300025940 | Bacteria | 2047 |
| 266 | Ga0207691_10265057 | 3300025940 | Bacteria | 1480 |
| 267 | Ga0207711_10040086 | 3300025941 | Unclassified | 3984 |
| 268 | Ga0207711_10073700 | 3300025941 | Bacteria | 2968 |
| 269 | Ga0207689_10005346 | 3300025942 | Bacteria | 11500 |
| 270 | Ga0207689_10008919 | 3300025942 | Bacteria | 8698 |
| 271 | Ga0207689_10187395 | 3300025942 | Bacteria | 1706 |
| 272 | Ga0207679_10016274 | 3300025945 | Bacteria | 4935 |
| 273 | Ga0207679_10303854 | 3300025945 | Bacteria | 1376 |
| 274 | Ga0207651_10028422 | 3300025960 | Bacteria | 3527 |
| 275 | Ga0207712_10242383 | 3300025961 | Unclassified | 1453 |
| 276 | Ga0207668_10127821 | 3300025972 | Unclassified | 1936 |
| 277 | Ga0207640_10006289 | 3300025981 | Bacteria | 6510 |
| 278 | Ga0207640_10035521 | 3300025981 | Bacteria | 3120 |
| 279 | Ga0207640_10046287 | 3300025981 | Bacteria | 2798 |
| 280 | Ga0207640_10170049 | 3300025981 | Bacteria | 1623 |
| 281 | Ga0207658_10056756 | 3300025986 | Bacteria | 2907 |
| 282 | Ga0207677_10139972 | 3300026023 | Unclassified | 1851 |
| 283 | Ga0207677_10148564 | 3300026023 | Unclassified | 1804 |
| 284 | Ga0207703_10007098 | 3300026035 | Bacteria | 8912 |
| 285 | Ga0207703_10096489 | 3300026035 | Bacteria | 2496 |
| 286 | Ga0207678_10043299 | 3300026067 | Bacteria | 3895 |
| 287 | Ga0207708_10007036 | 3300026075 | Bacteria | 8312 |
| 288 | Ga0207708_10029358 | 3300026075 | Bacteria | 4168 |
| 289 | Ga0207708_10063345 | 3300026075 | Bacteria | 2825 |
| 290 | Ga0207641_10003014 | 3300026088 | Bacteria | 15205 |
| 291 | Ga0207641_10274473 | 3300026088 | Bacteria | 1583 |
| 292 | Ga0207641_10331127 | 3300026088 | Unclassified | 1446 |
| 293 | Ga0207641_10388124 | 3300026088 | Unclassified | 1339 |
| 294 | Ga0207648_10004852 | 3300026089 | Bacteria | 13716 |
| 295 | Ga0207676_10029891 | 3300026095 | Bacteria | 4083 |
| 296 | Ga0207676_10397263 | 3300026095 | Bacteria | 1287 |
| 297 | Ga0207676_10563737 | 3300026095 | Unclassified | 1090 |
| 298 | Ga0207674_10165206 | 3300026116 | Bacteria | 2168 |
| 299 | Ga0207675_100004887 | 3300026118 | Bacteria | 12924 |
| 300 | Ga0207675_100017057 | 3300026118 | Bacteria | 6785 |
| 301 | Ga0207675_100023742 | 3300026118 | Bacteria | 5705 |
| 302 | Ga0207675_100216163 | 3300026118 | Unclassified | 1845 |
| 303 | Ga0207683_10009401 | 3300026121 | Bacteria | 8330 |
| 304 | Ga0207683_10076047 | 3300026121 | Bacteria | 2973 |
| 305 | Ga0207683_10314951 | 3300026121 | Bacteria | 1433 |
| 306 | Ga0207428_10006320 | 3300027907 | Bacteria | 10954 |
| 307 | Ga0207428_10024918 | 3300027907 | Bacteria | 5016 |
| 308 | Ga0268266_10191549 | 3300028379 | Bacteria | 1867 |
| 309 | Ga0268266_10277779 | 3300028379 | Bacteria | 1556 |
| 310 | Ga0268266_10338422 | 3300028379 | Bacteria | 1412 |
| 311 | Ga0268265_10022180 | 3300028380 | Bacteria | 4457 |
| 312 | Ga0268264_10367247 | 3300028381 | Unclassified | 1374 |
| 313 | Ga0268264_10523762 | 3300028381 | Bacteria | 1159 |
| 314 | Ga0268264_10648550 | 3300028381 | Bacteria | 1045 |
| 315 | Ga0307405_10015263 | 3300031731 | Bacteria | 4156 |
| 316 | Ga0307409_100018110 | 3300031995 | Bacteria | 4720 |
| 317 | Ga0307416_100231011 | 3300032002 | Unclassified | 1783 |
| 318 | Ga0307416_100419576 | 3300032002 | Bacteria | 1382 |
| 319 | Ga0307414_10481874 | 3300032004 | Bacteria | 1094 |
| 320 | Ga0307411_10588289 | 3300032005 | Bacteria | 955 |
| 321 | Ga0307415_100153564 | 3300032126 | Bacteria | 1775 |
| 322 | Ga0373930_0003446 | 3300034816 | Bacteria | 2509 |
| 323 | Ga0373948_0015168 | 3300034817 | Bacteria | 1412 |
| 324 | Ga0373950_0000763 | 3300034818 | Bacteria | 4011 |
| 325 | Ga0373928_0010096 | 3300035084 | Bacteria | 1850 |
| 326 | Ga0373929_0001491 | 3300035085 | Bacteria | 4453 |
| 327 | Ga0373934_0000435 | 3300035086 | Bacteria | 14563 |
| 328 | Ga0373940_0002297 | 3300035088 | Bacteria | 3688 |
| 329 | Ga0373949_0001478 | 3300035090 | Bacteria | 6705 |
| 330 | Ga0373952_0000512 | 3300035092 | Bacteria | 6783 |
| 331 | Ga0373932_0001481 | 3300035112 | Bacteria | 6561 |
| 332 | Ga0373936_0060418 | 3300035113 | Bacteria | 1546 |
| 333 | Ga0373939_0000394 | 3300035114 | Bacteria | 11029 |
| 334 | Ga0373941_0001265 | 3300035115 | Bacteria | 5318 |
| 335 | Ga0373941_0048390 | 3300035115 | Bacteria | 1342 |
| 336 | Ga0373945_0017943 | 3300035116 | Unclassified | 2402 |
| 337 | Ga0373953_0019363 | 3300035117 | Unclassified | 2531 |
| 338 | Ga0373954_0033370 | 3300035118 | Unclassified | 2382 |
| 339 | Ga0373956_0005080 | 3300035119 | Bacteria | 5267 |
| 340 | Ga0373956_0054844 | 3300035119 | Bacteria | 1797 |
| 341 | Ga0373956_0068737 | 3300035119 | Unclassified | 1614 |
| 342 | Ga0373957_0045335 | 3300035120 | Unclassified | 1666 |
| 343 | Ga0373960_0000197 | 3300035121 | Bacteria | 10990 |
| 344 | Ga0373943_0010480 | 3300035170 | Bacteria | 4154 |
| 345 | Ga0373946_0012901 | 3300035171 | Bacteria | 3133 |
| 346 | Ga0373942_0002148 | 3300035207 | Bacteria | 4868 |
| 347 | Ga0373961_0001086 | 3300035241 | Bacteria | 8665 |
| 348 | Ga0373962_0002646 | 3300035242 | Bacteria | 4256 |
| 349 | Ga0373924_0045634 | 3300035410 | Bacteria | 1803 |
| 350 | Ga0373924_0077373 | 3300035410 | Unclassified | 1411 |
| 351 | Ga0373931_0005366 | 3300035691 | Bacteria | 5917 |
| 352 | Ga0373935_0029809 | 3300035692 | Bacteria | 3378 |
| 353 | Ga0373927_0133869 | 3300035695 | Bacteria | 1620 |
| 354 | Ga0373947_0063497 | 3300035725 | Bacteria | 2250 |
| 355 | Ga0373947_0135777 | 3300035725 | Bacteria | 1574 |
| 356 | Ga0373947_0136802 | 3300035725 | Bacteria | 1568 |
| 357 | Ga0373947_0211701 | 3300035725 | Bacteria | 1272 |
| 358 | Ga0373937_0000232 | 3300036401 | Bacteria | 54273 |
| 359 | Ga0373937_0010656 | 3300036401 | Bacteria | 8037 |
| 360 | Ga0373937_0054025 | 3300036401 | Bacteria | 3685 |
| 361 | Ga0373937_0392039 | 3300036401 | Bacteria | 1317 |
| 362 | Ga0373925_0001894 | 3300037068 | Bacteria | 17368 |
| 363 | Ga0373925_0017187 | 3300037068 | Bacteria | 5239 |
| 364 | Ga0373925_0045889 | 3300037068 | Bacteria | 3247 |
| 365 | Ga0373925_0116086 | 3300037068 | Bacteria | 2073 |
| 366 | Ga0439431_0027411 | 3300041997 | Unclassified | 1399 |
| 367 | Ga0439450_006629 | 3300042008 | Bacteria | 2092 |
| 368 | Ga0439434_0028487 | 3300042435 | Unclassified | 1691 |
| 369 | Ga0451576_0414552 | 3300045051 | Unclassified | 1413 |
| 370 | Ga0466967_0247692 | 3300045976 | Unclassified | 1701 |
| 371 | Ga0495651_0097652 | 3300046462 | Unclassified | 2193 |
| 372 | Ga0495580_0059543 | 3300046472 | Bacteria | 2684 |
| 373 | Ga0495664_0077226 | 3300046477 | Unclassified | 1994 |
| 374 | Ga0495664_0158816 | 3300046477 | Bacteria | 1372 |
| 375 | Ga0495608_0002090 | 3300046511 | Bacteria | 14397 |
| 376 | Ga0495630_0342535 | 3300046517 | Unclassified | 1144 |
| 377 | Ga0495630_0343913 | 3300046517 | Unclassified | 1141 |
| 378 | Ga0495652_0100733 | 3300046529 | Unclassified | 2343 |
| 379 | Ga0495586_0099893 | 3300046535 | Bacteria | 1610 |
| 380 | Ga0495586_0102645 | 3300046535 | Unclassified | 1588 |
| 381 | Ga0495645_0023365 | 3300046543 | Bacteria | 4476 |
| 382 | Ga0495645_0193467 | 3300046543 | Unclassified | 1384 |
| 383 | Ga0495667_0013809 | 3300046559 | Bacteria | 5455 |
| 384 | Ga0495635_0189881 | 3300046663 | Bacteria | 1395 |
| 385 | Ga0495623_0084687 | 3300046679 | Bacteria | 1956 |
| 386 | Ga0495647_0004938 | 3300046681 | Bacteria | 4368 |
| 387 | Ga0495658_0030840 | 3300046683 | Bacteria | 2915 |
| 388 | Ga0495658_0114177 | 3300046683 | Bacteria | 1627 |
| 389 | Ga0495658_0217473 | 3300046683 | Bacteria | 1195 |
| 390 | Ga0495669_0006162 | 3300046684 | Bacteria | 5002 |
| 391 | Ga0495670_0164673 | 3300046691 | Bacteria | 1166 |
| 392 | Ga0495604_0032452 | 3300047317 | Bacteria | 4138 |
| 393 | Ga0495674_0324939 | 3300047319 | Bacteria | 1253 |
| 394 | Ga0495684_0000087 | 3300047471 | Bacteria | 64920 |
| 395 | Ga0495593_0173710 | 3300047673 | Bacteria | 1086 |
| 396 | Ga0496101_0269181 | 3300048904 | Bacteria | 1330 |
| 397 | Ga0496102_0457125 | 3300048905 | Bacteria | 1198 |
| 398 | Ga0496102_0484123 | 3300048905 | Bacteria | 1159 |
| 399 | Ga0496106_0059688 | 3300048909 | Bacteria | 2890 |
| 400 | Ga0496109_0088313 | 3300048912 | Bacteria | 2865 |
| 401 | Ga0496109_0307898 | 3300048912 | Bacteria | 1494 |
| 402 | Ga0496112_0006375 | 3300048915 | Bacteria | 10356 |
| 403 | Ga0496114_0214678 | 3300048917 | Bacteria | 1688 |
| 404 | Ga0496114_0398211 | 3300048917 | Bacteria | 1219 |
| 405 | Ga0496115_0092369 | 3300048918 | Bacteria | 2474 |
| 406 | Ga0501031_0120262 | 3300049568 | Bacteria | 1716 |
| 407 | Ga0501036_0173313 | 3300049572 | Bacteria | 1817 |
| 408 | Ga0501039_0210585 | 3300049575 | Bacteria | 1529 |
| 409 | Ga0501071_0041026 | 3300049587 | Bacteria | 3314 |
| 410 | Ga0501072_0093066 | 3300049588 | Bacteria | 2394 |
| 411 | Ga0501072_0133588 | 3300049588 | Bacteria | 1979 |
| 412 | Ga0501076_0054099 | 3300049592 | Bacteria | 3181 |
| 413 | Ga0501080_0443552 | 3300049742 | Bacteria | 1164 |
| 414 | Ga0501083_0096908 | 3300049744 | Bacteria | 1946 |
| 415 | nmdc:mga00v17_61340_c1 | 3300050491 | Bacteria | 2311 |
| 416 | nmdc:mga05p37_123354_c1 | 3300050507 | Unclassified | 3182 |
| 417 | nmdc:mga05p37_150692_c1 | 3300050507 | Bacteria | 2845 |
| 418 | nmdc:mga05p37_16284_c1 | 3300050507 | Bacteria | 8950 |
| 419 | nmdc:mga05p37_171806_c1 | 3300050507 | Bacteria | 2643 |
| 420 | nmdc:mga05p37_20210_c1 | 3300050507 | Bacteria | 8060 |
| 421 | nmdc:mga05p37_26789_c1 | 3300050507 | Bacteria | 7011 |
| 422 | nmdc:mga05p37_305221_c1 | 3300050507 | Unclassified | 1889 |
| 423 | nmdc:mga05p37_8548_c1 | 3300050507 | Bacteria | 12100 |
| 424 | nmdc:mga05p37_95657_c1 | 3300050507 | Bacteria | 3659 |
| 425 | nmdc:mga09592_36456_c1 | 3300050508 | Bacteria | 4119 |
| 426 | nmdc:mga09592_38797_c1 | 3300050508 | Bacteria | 3999 |
| 427 | nmdc:mga09592_905_c1 | 3300050508 | Bacteria | 23310 |
| 428 | nmdc:mga0qj67_472008_c1 | 3300050509 | Bacteria | 1010 |
| 429 | nmdc:mga06r32_314438_c1 | 3300050510 | Bacteria | 1552 |
| 430 | nmdc:mga06r32_69693_c1 | 3300050510 | Bacteria | 3399 |
| 431 | nmdc:mga06r32_71756_c1 | 3300050510 | Bacteria | 3351 |
| 432 | nmdc:mga08y16_104463_c1 | 3300050511 | Unclassified | 2949 |
| 433 | nmdc:mga08y16_23190_c1 | 3300050511 | Bacteria | 6551 |
| 434 | nmdc:mga08y16_556937_c1 | 3300050511 | Bacteria | 1160 |
| 435 | nmdc:mga08y16_895711_c1 | 3300050511 | Unclassified | 874 |
| 436 | nmdc:mga0n895_157888_c1 | 3300050512 | Bacteria | 2299 |
| 437 | nmdc:mga0n895_234570_c1 | 3300050512 | Bacteria | 1862 |
| 438 | nmdc:mga0n895_37_c1 | 3300050512 | Bacteria | 77167 |
| 439 | nmdc:mga0n895_522124_c1 | 3300050512 | Bacteria | 1195 |
| 440 | nmdc:mga0n895_79886_c1 | 3300050512 | Bacteria | 3258 |
| 441 | nmdc:mga0n895_8171_c1 | 3300050512 | Bacteria | 9044 |
| 442 | nmdc:mga0rr50_14_c1 | 3300050513 | Bacteria | 196574 |
| 443 | nmdc:mga0rr50_1724_c1 | 3300050513 | Bacteria | 12052 |
| 444 | nmdc:mga0rr50_210485_c1 | 3300050513 | Bacteria | 1602 |
| 445 | nmdc:mga0rr50_22635_c1 | 3300050513 | Bacteria | 4317 |
| 446 | nmdc:mga0rr50_243959_c1 | 3300050513 | Bacteria | 1490 |
| 447 | nmdc:mga08x19_275_c1 | 3300050514 | Bacteria | 38855 |
| 448 | nmdc:mga08x19_7678_c1 | 3300050514 | Bacteria | 6403 |
| 449 | nmdc:mga0a205_49331_c1 | 3300050515 | Bacteria | 4063 |
| 450 | nmdc:mga0a205_505504_c1 | 3300050515 | Unclassified | 1065 |
| 451 | nmdc:mga0a205_69584_c1 | 3300050515 | Unclassified | 3398 |
| 452 | nmdc:mga0a205_72273_c1 | 3300050515 | Bacteria | 2602 |
| 453 | Ga0495601_0030442 | 3300053077 | Bacteria | 3351 |
| 454 | Ga0495601_0117828 | 3300053077 | Bacteria | 1723 |
| 455 | Ga0495619_0002209 | 3300053085 | Bacteria | 12891 |
| 456 | Ga0501082_0314255 | 3300060353 | Bacteria | 1364 |
| 457 | Ga0530510_0146118 | 3300061734 | Bacteria | 1744 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10366379 | Ga0105246_103663791 | 270 |
| 2 | 3300025921 | Ga0207652_10222842 | Ga0207652_102228421 | 273 |
| 3 | 3300046691 | Ga0495670_0164673 | Ga0495670_0164673_40_861 | 273 |
| 4 | 3300047319 | Ga0495674_0324939 | Ga0495674_0324939_413_1240 | 275 |
| 5 | 3300050511 | nmdc:mga08y16_895711_c1 | nmdc:mga08y16_895711_c1_14_844 | 275 |
| 6 | 3300006871 | Ga0075434_100000026 | Ga0075434_10000002634 | 283 |
| 7 | 3300006914 | Ga0075436_100000600 | Ga0075436_10000060011 | 283 |
| 8 | 3300007076 | Ga0075435_100000017 | Ga0075435_10000001759 | 283 |
| 9 | 3300025937 | Ga0207669_10043878 | Ga0207669_100438784 | 283 |
| 10 | 3300050512 | nmdc:mga0n895_37_c1 | nmdc:mga0n895_37_c1_37651_38589 | 283 |
| 11 | 3300050513 | nmdc:mga0rr50_14_c1 | nmdc:mga0rr50_14_c1_88898_89836 | 283 |
| 12 | 3300050514 | nmdc:mga08x19_275_c1 | nmdc:mga08x19_275_c1_10101_11039 | 283 |
| 13 | 3300005439 | Ga0070711_100076447 | Ga0070711_1000764471 | 285 |
| 14 | 3300025916 | Ga0207663_10160644 | Ga0207663_101606442 | 285 |
| 15 | 3300005331 | Ga0070670_100002204 | Ga0070670_10000220414 | 286 |
| 16 | 3300005842 | Ga0068858_100003770 | Ga0068858_1000037708 | 286 |
| 17 | 3300005564 | Ga0070664_100047784 | Ga0070664_1000477843 | 287 |
| 18 | 3300005577 | Ga0068857_100207129 | Ga0068857_1002071292 | 287 |
| 19 | 3300005841 | Ga0068863_100118780 | Ga0068863_1001187802 | 287 |
| 20 | 3300005842 | Ga0068858_100041858 | Ga0068858_1000418583 | 287 |
| 21 | 3300005843 | Ga0068860_100081348 | Ga0068860_1000813483 | 287 |
| 22 | 3300005843 | Ga0068860_100486959 | Ga0068860_1004869592 | 287 |
| 23 | 3300025903 | Ga0207680_10005949 | Ga0207680_100059492 | 287 |
| 24 | 3300025920 | Ga0207649_10025734 | Ga0207649_100257342 | 287 |
| 25 | 3300025926 | Ga0207659_10009858 | Ga0207659_100098582 | 287 |
| 26 | 3300025945 | Ga0207679_10016274 | Ga0207679_100162742 | 287 |
| 27 | 3300026116 | Ga0207674_10165206 | Ga0207674_101652062 | 287 |
| 28 | 3300026121 | Ga0207683_10009401 | Ga0207683_1000940110 | 287 |
| 29 | 3300042008 | Ga0439450_006629 | Ga0439450_006629_1218_2081 | 287 |
| 30 | 3300005544 | Ga0070686_100085884 | Ga0070686_1000858841 | 288 |
| 31 | 3300005617 | Ga0068859_100213636 | Ga0068859_1002136361 | 288 |
| 32 | 3300006931 | Ga0097620_100213631 | Ga0097620_1002136311 | 288 |
| 33 | 3300009148 | Ga0105243_10020195 | Ga0105243_100201955 | 288 |
| 34 | 3300009176 | Ga0105242_10024408 | Ga0105242_100244085 | 288 |
| 35 | 3300025981 | Ga0207640_10035521 | Ga0207640_100355212 | 288 |
| 36 | 3300036401 | Ga0373937_0054025 | Ga0373937_0054025_1721_2662 | 288 |
| 37 | 3300005617 | Ga0068859_100045205 | Ga0068859_1000452051 | 290 |
| 38 | 3300005618 | Ga0068864_100137219 | Ga0068864_1001372193 | 290 |
| 39 | 3300006931 | Ga0097620_100045206 | Ga0097620_1000452061 | 290 |
| 40 | 3300009177 | Ga0105248_10876825 | Ga0105248_108768251 | 290 |
| 41 | 3300026067 | Ga0207678_10043299 | Ga0207678_100432993 | 290 |
| 42 | 3300026095 | Ga0207676_10397263 | Ga0207676_103972632 | 290 |
| 43 | 3300026088 | Ga0207641_10388124 | Ga0207641_103881242 | 291 |
| 44 | 3300005333 | Ga0070677_10154368 | Ga0070677_101543681 | 292 |
| 45 | 3300005334 | Ga0068869_100002479 | Ga0068869_10000247910 | 292 |
| 46 | 3300005343 | Ga0070687_100229435 | Ga0070687_1002294352 | 292 |
| 47 | 3300005354 | Ga0070675_100001621 | Ga0070675_1000016219 | 292 |
| 48 | 3300005354 | Ga0070675_100027339 | Ga0070675_1000273393 | 292 |
| 49 | 3300005364 | Ga0070673_100020088 | Ga0070673_1000200884 | 292 |
| 50 | 3300005438 | Ga0070701_10009264 | Ga0070701_100092643 | 292 |
| 51 | 3300005459 | Ga0068867_100005747 | Ga0068867_1000057475 | 292 |
| 52 | 3300005615 | Ga0070702_100098759 | Ga0070702_1000987592 | 292 |
| 53 | 3300005719 | Ga0068861_100014453 | Ga0068861_1000144535 | 292 |
| 54 | 3300005840 | Ga0068870_10079544 | Ga0068870_100795442 | 292 |
| 55 | 3300009551 | Ga0105238_10020442 | Ga0105238_100204423 | 292 |
| 56 | 3300014326 | Ga0157380_10170628 | Ga0157380_101706282 | 292 |
| 57 | 3300017792 | Ga0163161_10114579 | Ga0163161_101145792 | 292 |
| 58 | 3300025893 | Ga0207682_10141042 | Ga0207682_101410421 | 292 |
| 59 | 3300025907 | Ga0207645_10026966 | Ga0207645_100269664 | 292 |
| 60 | 3300025908 | Ga0207643_10073078 | Ga0207643_100730782 | 292 |
| 61 | 3300025923 | Ga0207681_10031798 | Ga0207681_100317983 | 292 |
| 62 | 3300025926 | Ga0207659_10003320 | Ga0207659_100033202 | 292 |
| 63 | 3300025926 | Ga0207659_10022140 | Ga0207659_100221401 | 292 |
| 64 | 3300025938 | Ga0207704_10007256 | Ga0207704_100072566 | 292 |
| 65 | 3300025942 | Ga0207689_10005346 | Ga0207689_100053469 | 292 |
| 66 | 3300026118 | Ga0207675_100017057 | Ga0207675_1000170573 | 292 |
| 67 | 3300005549 | Ga0070704_100127515 | Ga0070704_1001275152 | 293 |
| 68 | 3300005549 | Ga0070704_100305000 | Ga0070704_1003050002 | 293 |
| 69 | 3300005549 | Ga0070704_100335158 | Ga0070704_1003351581 | 293 |
| 70 | 3300006844 | Ga0075428_100002943 | Ga0075428_1000029434 | 293 |
| 71 | 3300006846 | Ga0075430_100493688 | Ga0075430_1004936881 | 293 |
| 72 | 3300006880 | Ga0075429_100044176 | Ga0075429_1000441766 | 293 |
| 73 | 3300009147 | Ga0114129_10396237 | Ga0114129_103962372 | 293 |
| 74 | 3300009177 | Ga0105248_10212677 | Ga0105248_102126773 | 293 |
| 75 | 3300025960 | Ga0207651_10028422 | Ga0207651_100284223 | 293 |
| 76 | 3300026121 | Ga0207683_10314951 | Ga0207683_103149512 | 293 |
| 77 | 3300031731 | Ga0307405_10015263 | Ga0307405_100152632 | 293 |
| 78 | 3300031995 | Ga0307409_100018110 | Ga0307409_1000181104 | 293 |
| 79 | 3300032002 | Ga0307416_100231011 | Ga0307416_1002310112 | 293 |
| 80 | 3300032126 | Ga0307415_100153564 | Ga0307415_1001535642 | 293 |
| 81 | 3300050507 | nmdc:mga05p37_95657_c1 | nmdc:mga05p37_95657_c1_763_1653 | 293 |
| 82 | 3300050508 | nmdc:mga09592_38797_c1 | nmdc:mga09592_38797_c1_3083_3973 | 293 |
| 83 | 3300050509 | nmdc:mga0qj67_472008_c1 | nmdc:mga0qj67_472008_c1_81_971 | 293 |
| 84 | 3300050510 | nmdc:mga06r32_69693_c1 | nmdc:mga06r32_69693_c1_1798_2688 | 293 |
| 85 | 3300005347 | Ga0070668_100427206 | Ga0070668_1004272061 | 294 |
| 86 | 3300005354 | Ga0070675_100000342 | Ga0070675_10000034236 | 294 |
| 87 | 3300005356 | Ga0070674_100093453 | Ga0070674_1000934532 | 294 |
| 88 | 3300005365 | Ga0070688_100418576 | Ga0070688_1004185761 | 294 |
| 89 | 3300005543 | Ga0070672_100278685 | Ga0070672_1002786851 | 294 |
| 90 | 3300006880 | Ga0075429_100355909 | Ga0075429_1003559092 | 294 |
| 91 | 3300014326 | Ga0157380_10120711 | Ga0157380_101207113 | 294 |
| 92 | 3300025926 | Ga0207659_10001954 | Ga0207659_100019547 | 294 |
| 93 | 3300025937 | Ga0207669_10026100 | Ga0207669_100261002 | 294 |
| 94 | 3300025940 | Ga0207691_10265057 | Ga0207691_102650572 | 294 |
| 95 | 3300005334 | Ga0068869_100011346 | Ga0068869_1000113462 | 295 |
| 96 | 3300005563 | Ga0068855_100303069 | Ga0068855_1003030692 | 295 |
| 97 | 3300005840 | Ga0068870_10007702 | Ga0068870_100077022 | 295 |
| 98 | 3300006880 | Ga0075429_100008693 | Ga0075429_1000086933 | 295 |
| 99 | 3300007076 | Ga0075435_100007466 | Ga0075435_1000074669 | 295 |
| 100 | 3300009094 | Ga0111539_10000685 | Ga0111539_100006856 | 295 |
| 101 | 3300009098 | Ga0105245_10461575 | Ga0105245_104615752 | 295 |
| 102 | 3300009147 | Ga0114129_10150938 | Ga0114129_101509382 | 295 |
| 103 | 3300009177 | Ga0105248_10243893 | Ga0105248_102438932 | 295 |
| 104 | 3300009553 | Ga0105249_10015133 | Ga0105249_100151331 | 295 |
| 105 | 3300011119 | Ga0105246_10006926 | Ga0105246_100069267 | 295 |
| 106 | 3300013306 | Ga0163162_10079089 | Ga0163162_100790893 | 295 |
| 107 | 3300013308 | Ga0157375_10190881 | Ga0157375_101908813 | 295 |
| 108 | 3300014326 | Ga0157380_10022833 | Ga0157380_100228332 | 295 |
| 109 | 3300014968 | Ga0157379_10011923 | Ga0157379_100119239 | 295 |
| 110 | 3300025315 | Ga0207697_10000401 | Ga0207697_1000040118 | 295 |
| 111 | 3300025901 | Ga0207688_10001140 | Ga0207688_1000114014 | 295 |
| 112 | 3300025907 | Ga0207645_10002384 | Ga0207645_100023841 | 295 |
| 113 | 3300025908 | Ga0207643_10003749 | Ga0207643_100037495 | 295 |
| 114 | 3300025918 | Ga0207662_10002983 | Ga0207662_100029839 | 295 |
| 115 | 3300025940 | Ga0207691_10000953 | Ga0207691_100009534 | 295 |
| 116 | 3300026075 | Ga0207708_10007036 | Ga0207708_1000703610 | 295 |
| 117 | 3300046517 | Ga0495630_0342535 | Ga0495630_0342535_240_1127 | 295 |
| 118 | 3300049568 | Ga0501031_0120262 | Ga0501031_0120262_767_1654 | 295 |
| 119 | 3300049572 | Ga0501036_0173313 | Ga0501036_0173313_719_1606 | 295 |
| 120 | 3300049575 | Ga0501039_0210585 | Ga0501039_0210585_622_1509 | 295 |
| 121 | 3300049587 | Ga0501071_0041026 | Ga0501071_0041026_1925_2812 | 295 |
| 122 | 3300049588 | Ga0501072_0093066 | Ga0501072_0093066_579_1466 | 295 |
| 123 | 3300049592 | Ga0501076_0054099 | Ga0501076_0054099_964_1851 | 295 |
| 124 | 3300049742 | Ga0501080_0443552 | Ga0501080_0443552_83_970 | 295 |
| 125 | 3300050507 | nmdc:mga05p37_123354_c1 | nmdc:mga05p37_123354_c1_528_1415 | 295 |
| 126 | 3300050508 | nmdc:mga09592_36456_c1 | nmdc:mga09592_36456_c1_2332_3219 | 295 |
| 127 | 3300050508 | nmdc:mga09592_905_c1 | nmdc:mga09592_905_c1_18807_19694 | 295 |
| 128 | 3300050513 | nmdc:mga0rr50_22635_c1 | nmdc:mga0rr50_22635_c1_2915_3802 | 295 |
| 129 | 3300060353 | Ga0501082_0314255 | Ga0501082_0314255_175_1062 | 295 |
| 130 | 3300061734 | Ga0530510_0146118 | Ga0530510_0146118_186_1073 | 295 |
| 131 | 3300025940 | Ga0207691_10150385 | Ga0207691_101503852 | 296 |
| 132 | 3300032002 | Ga0307416_100419576 | Ga0307416_1004195762 | 296 |
| 133 | 3300041997 | Ga0439431_0027411 | Ga0439431_0027411_336_1229 | 296 |
| 134 | 3300042435 | Ga0439434_0028487 | Ga0439434_0028487_589_1482 | 296 |
| 135 | 3300005335 | Ga0070666_10001247 | Ga0070666_100012478 | 297 |
| 136 | 3300005353 | Ga0070669_100150726 | Ga0070669_1001507261 | 297 |
| 137 | 3300005457 | Ga0070662_100081285 | Ga0070662_1000812852 | 297 |
| 138 | 3300005544 | Ga0070686_100001018 | Ga0070686_10000101810 | 297 |
| 139 | 3300005546 | Ga0070696_100097991 | Ga0070696_1000979912 | 297 |
| 140 | 3300005578 | Ga0068854_100005014 | Ga0068854_1000050146 | 297 |
| 141 | 3300005843 | Ga0068860_100366107 | Ga0068860_1003661071 | 297 |
| 142 | 3300006871 | Ga0075434_100560014 | Ga0075434_1005600142 | 297 |
| 143 | 3300007076 | Ga0075435_100006307 | Ga0075435_1000063075 | 297 |
| 144 | 3300025903 | Ga0207680_10001376 | Ga0207680_100013765 | 297 |
| 145 | 3300025912 | Ga0207707_10048200 | Ga0207707_100482003 | 297 |
| 146 | 3300025933 | Ga0207706_10267959 | Ga0207706_102679592 | 297 |
| 147 | 3300025981 | Ga0207640_10006289 | Ga0207640_100062893 | 297 |
| 148 | 3300028381 | Ga0268264_10367247 | Ga0268264_103672472 | 297 |
| 149 | 3300035170 | Ga0373943_0010480 | Ga0373943_0010480_1957_2853 | 297 |
| 150 | 3300035725 | Ga0373947_0136802 | Ga0373947_0136802_102_998 | 297 |
| 151 | 3300048909 | Ga0496106_0059688 | Ga0496106_0059688_828_1763 | 297 |
| 152 | 3300050512 | nmdc:mga0n895_234570_c1 | nmdc:mga0n895_234570_c1_106_1041 | 297 |
| 153 | 3300050513 | nmdc:mga0rr50_1724_c1 | nmdc:mga0rr50_1724_c1_4993_5928 | 297 |
| 154 | 3300005335 | Ga0070666_10254858 | Ga0070666_102548581 | 298 |
| 155 | 3300005338 | Ga0068868_100189331 | Ga0068868_1001893311 | 298 |
| 156 | 3300005340 | Ga0070689_100413565 | Ga0070689_1004135652 | 298 |
| 157 | 3300005355 | Ga0070671_100206881 | Ga0070671_1002068812 | 298 |
| 158 | 3300005365 | Ga0070688_100011900 | Ga0070688_1000119002 | 298 |
| 159 | 3300005436 | Ga0070713_100122950 | Ga0070713_1001229501 | 298 |
| 160 | 3300005456 | Ga0070678_100054569 | Ga0070678_1000545694 | 298 |
| 161 | 3300005466 | Ga0070685_10076034 | Ga0070685_100760342 | 298 |
| 162 | 3300005535 | Ga0070684_100105726 | Ga0070684_1001057263 | 298 |
| 163 | 3300005543 | Ga0070672_100143187 | Ga0070672_1001431871 | 298 |
| 164 | 3300005548 | Ga0070665_100039676 | Ga0070665_1000396763 | 298 |
| 165 | 3300005548 | Ga0070665_100105379 | Ga0070665_1001053791 | 298 |
| 166 | 3300005564 | Ga0070664_100210718 | Ga0070664_1002107183 | 298 |
| 167 | 3300005616 | Ga0068852_100544627 | Ga0068852_1005446272 | 298 |
| 168 | 3300005617 | Ga0068859_100670995 | Ga0068859_1006709951 | 298 |
| 169 | 3300005841 | Ga0068863_100095828 | Ga0068863_1000958282 | 298 |
| 170 | 3300005842 | Ga0068858_100240293 | Ga0068858_1002402931 | 298 |
| 171 | 3300006051 | Ga0075364_10038108 | Ga0075364_100381082 | 298 |
| 172 | 3300006358 | Ga0068871_100061619 | Ga0068871_1000616192 | 298 |
| 173 | 3300006871 | Ga0075434_100123878 | Ga0075434_1001238782 | 298 |
| 174 | 3300006914 | Ga0075436_100009299 | Ga0075436_1000092993 | 298 |
| 175 | 3300006931 | Ga0097620_100671083 | Ga0097620_1006710831 | 298 |
| 176 | 3300007076 | Ga0075435_100028446 | Ga0075435_1000284465 | 298 |
| 177 | 3300009098 | Ga0105245_10331020 | Ga0105245_103310202 | 298 |
| 178 | 3300009147 | Ga0114129_10008732 | Ga0114129_1000873210 | 298 |
| 179 | 3300009147 | Ga0114129_10410471 | Ga0114129_104104712 | 298 |
| 180 | 3300009147 | Ga0114129_10850276 | Ga0114129_108502761 | 298 |
| 181 | 3300009176 | Ga0105242_10027380 | Ga0105242_100273803 | 298 |
| 182 | 3300013306 | Ga0163162_10071838 | Ga0163162_100718382 | 298 |
| 183 | 3300014326 | Ga0157380_10013132 | Ga0157380_100131326 | 298 |
| 184 | 3300014968 | Ga0157379_10019664 | Ga0157379_100196642 | 298 |
| 185 | 3300014969 | Ga0157376_10009359 | Ga0157376_100093592 | 298 |
| 186 | 3300025924 | Ga0207694_10434167 | Ga0207694_104341671 | 298 |
| 187 | 3300025925 | Ga0207650_10460124 | Ga0207650_104601242 | 298 |
| 188 | 3300025927 | Ga0207687_10052349 | Ga0207687_100523492 | 298 |
| 189 | 3300025934 | Ga0207686_10179986 | Ga0207686_101799862 | 298 |
| 190 | 3300025936 | Ga0207670_10367217 | Ga0207670_103672171 | 298 |
| 191 | 3300025938 | Ga0207704_10197362 | Ga0207704_101973622 | 298 |
| 192 | 3300025941 | Ga0207711_10040086 | Ga0207711_100400863 | 298 |
| 193 | 3300026023 | Ga0207677_10139972 | Ga0207677_101399721 | 298 |
| 194 | 3300026088 | Ga0207641_10274473 | Ga0207641_102744732 | 298 |
| 195 | 3300026121 | Ga0207683_10076047 | Ga0207683_100760473 | 298 |
| 196 | 3300028379 | Ga0268266_10277779 | Ga0268266_102777792 | 298 |
| 197 | 3300028379 | Ga0268266_10338422 | Ga0268266_103384222 | 298 |
| 198 | 3300032004 | Ga0307414_10481874 | Ga0307414_104818741 | 298 |
| 199 | 3300032005 | Ga0307411_10588289 | Ga0307411_105882891 | 298 |
| 200 | 3300034816 | Ga0373930_0003446 | Ga0373930_0003446_875_1828 | 298 |
| 201 | 3300034817 | Ga0373948_0015168 | Ga0373948_0015168_221_1174 | 298 |
| 202 | 3300034818 | Ga0373950_0000763 | Ga0373950_0000763_1179_2132 | 298 |
| 203 | 3300035084 | Ga0373928_0010096 | Ga0373928_0010096_340_1293 | 298 |
| 204 | 3300035085 | Ga0373929_0001491 | Ga0373929_0001491_1998_2951 | 298 |
| 205 | 3300035088 | Ga0373940_0002297 | Ga0373940_0002297_1509_2462 | 298 |
| 206 | 3300035090 | Ga0373949_0001478 | Ga0373949_0001478_1914_2867 | 298 |
| 207 | 3300035092 | Ga0373952_0000512 | Ga0373952_0000512_4316_5269 | 298 |
| 208 | 3300035112 | Ga0373932_0001481 | Ga0373932_0001481_3945_4898 | 298 |
| 209 | 3300035114 | Ga0373939_0000394 | Ga0373939_0000394_1945_2898 | 298 |
| 210 | 3300035115 | Ga0373941_0001265 | Ga0373941_0001265_2609_3562 | 298 |
| 211 | 3300035119 | Ga0373956_0068737 | Ga0373956_0068737_643_1539 | 298 |
| 212 | 3300035121 | Ga0373960_0000197 | Ga0373960_0000197_7312_8265 | 298 |
| 213 | 3300035207 | Ga0373942_0002148 | Ga0373942_0002148_3595_4548 | 298 |
| 214 | 3300035241 | Ga0373961_0001086 | Ga0373961_0001086_2498_3451 | 298 |
| 215 | 3300035242 | Ga0373962_0002646 | Ga0373962_0002646_2722_3675 | 298 |
| 216 | 3300035691 | Ga0373931_0005366 | Ga0373931_0005366_2193_3146 | 298 |
| 217 | 3300035695 | Ga0373927_0133869 | Ga0373927_0133869_367_1284 | 298 |
| 218 | 3300035725 | Ga0373947_0063497 | Ga0373947_0063497_910_1827 | 298 |
| 219 | 3300037068 | Ga0373925_0001894 | Ga0373925_0001894_7040_7981 | 298 |
| 220 | 3300037068 | Ga0373925_0045889 | Ga0373925_0045889_963_1880 | 298 |
| 221 | 3300046477 | Ga0495664_0077226 | Ga0495664_0077226_155_1051 | 298 |
| 222 | 3300046511 | Ga0495608_0002090 | Ga0495608_0002090_2255_3151 | 298 |
| 223 | 3300046517 | Ga0495630_0343913 | Ga0495630_0343913_202_1098 | 298 |
| 224 | 3300046529 | Ga0495652_0100733 | Ga0495652_0100733_479_1375 | 298 |
| 225 | 3300046543 | Ga0495645_0023365 | Ga0495645_0023365_1124_2020 | 298 |
| 226 | 3300046559 | Ga0495667_0013809 | Ga0495667_0013809_2658_3554 | 298 |
| 227 | 3300047317 | Ga0495604_0032452 | Ga0495604_0032452_3045_3941 | 298 |
| 228 | 3300047471 | Ga0495684_0000087 | Ga0495684_0000087_62468_63364 | 298 |
| 229 | 3300048904 | Ga0496101_0269181 | Ga0496101_0269181_374_1276 | 298 |
| 230 | 3300048917 | Ga0496114_0398211 | Ga0496114_0398211_44_940 | 298 |
| 231 | 3300048918 | Ga0496115_0092369 | Ga0496115_0092369_1087_1983 | 298 |
| 232 | 3300049588 | Ga0501072_0133588 | Ga0501072_0133588_962_1864 | 298 |
| 233 | 3300049744 | Ga0501083_0096908 | Ga0501083_0096908_162_1064 | 298 |
| 234 | 3300050491 | nmdc:mga00v17_61340_c1 | nmdc:mga00v17_61340_c1_650_1552 | 298 |
| 235 | 3300050511 | nmdc:mga08y16_104463_c1 | nmdc:mga08y16_104463_c1_477_1376 | 298 |
| 236 | 3300050512 | nmdc:mga0n895_522124_c1 | nmdc:mga0n895_522124_c1_125_1063 | 298 |
| 237 | 3300050512 | nmdc:mga0n895_8171_c1 | nmdc:mga0n895_8171_c1_8037_8933 | 298 |
| 238 | 3300050513 | nmdc:mga0rr50_243959_c1 | nmdc:mga0rr50_243959_c1_51_989 | 298 |
| 239 | 3300050514 | nmdc:mga08x19_7678_c1 | nmdc:mga08x19_7678_c1_2115_3011 | 298 |
| 240 | 3300050515 | nmdc:mga0a205_505504_c1 | nmdc:mga0a205_505504_c1_13_912 | 298 |
| 241 | 3300050515 | nmdc:mga0a205_72273_c1 | nmdc:mga0a205_72273_c1_1687_2583 | 298 |
| 242 | 3300053077 | Ga0495601_0030442 | Ga0495601_0030442_1863_2759 | 298 |
| 243 | 3300053085 | Ga0495619_0002209 | Ga0495619_0002209_763_1659 | 298 |
| 244 | 3300005290 | Ga0065712_10089488 | Ga0065712_100894883 | 299 |
| 245 | 3300005295 | Ga0065707_10085126 | Ga0065707_100851265 | 299 |
| 246 | 3300005328 | Ga0070676_10111785 | Ga0070676_101117852 | 299 |
| 247 | 3300005331 | Ga0070670_100020506 | Ga0070670_1000205068 | 299 |
| 248 | 3300005334 | Ga0068869_100123772 | Ga0068869_1001237722 | 299 |
| 249 | 3300005341 | Ga0070691_10018650 | Ga0070691_100186503 | 299 |
| 250 | 3300005344 | Ga0070661_100010515 | Ga0070661_1000105154 | 299 |
| 251 | 3300005347 | Ga0070668_100081666 | Ga0070668_1000816662 | 299 |
| 252 | 3300005353 | Ga0070669_100053201 | Ga0070669_1000532013 | 299 |
| 253 | 3300005354 | Ga0070675_100000204 | Ga0070675_10000020426 | 299 |
| 254 | 3300005354 | Ga0070675_100102316 | Ga0070675_1001023163 | 299 |
| 255 | 3300005356 | Ga0070674_100093667 | Ga0070674_1000936672 | 299 |
| 256 | 3300005356 | Ga0070674_100107158 | Ga0070674_1001071581 | 299 |
| 257 | 3300005356 | Ga0070674_100324182 | Ga0070674_1003241821 | 299 |
| 258 | 3300005365 | Ga0070688_100286013 | Ga0070688_1002860131 | 299 |
| 259 | 3300005367 | Ga0070667_100025435 | Ga0070667_1000254352 | 299 |
| 260 | 3300005436 | Ga0070713_100034896 | Ga0070713_1000348963 | 299 |
| 261 | 3300005438 | Ga0070701_10064111 | Ga0070701_100641113 | 299 |
| 262 | 3300005440 | Ga0070705_100005417 | Ga0070705_1000054172 | 299 |
| 263 | 3300005441 | Ga0070700_100053347 | Ga0070700_1000533472 | 299 |
| 264 | 3300005444 | Ga0070694_100004755 | Ga0070694_1000047555 | 299 |
| 265 | 3300005455 | Ga0070663_100142291 | Ga0070663_1001422911 | 299 |
| 266 | 3300005457 | Ga0070662_100271387 | Ga0070662_1002713872 | 299 |
| 267 | 3300005458 | Ga0070681_10058717 | Ga0070681_100587173 | 299 |
| 268 | 3300005459 | Ga0068867_100015354 | Ga0068867_1000153542 | 299 |
| 269 | 3300005467 | Ga0070706_100116848 | Ga0070706_1001168483 | 299 |
| 270 | 3300005467 | Ga0070706_100395844 | Ga0070706_1003958441 | 299 |
| 271 | 3300005468 | Ga0070707_100045492 | Ga0070707_1000454924 | 299 |
| 272 | 3300005471 | Ga0070698_100127135 | Ga0070698_1001271352 | 299 |
| 273 | 3300005518 | Ga0070699_100037950 | Ga0070699_1000379502 | 299 |
| 274 | 3300005518 | Ga0070699_100183384 | Ga0070699_1001833843 | 299 |
| 275 | 3300005543 | Ga0070672_100188184 | Ga0070672_1001881842 | 299 |
| 276 | 3300005543 | Ga0070672_100275184 | Ga0070672_1002751842 | 299 |
| 277 | 3300005544 | Ga0070686_100060592 | Ga0070686_1000605922 | 299 |
| 278 | 3300005545 | Ga0070695_100006575 | Ga0070695_1000065755 | 299 |
| 279 | 3300005546 | Ga0070696_100096947 | Ga0070696_1000969472 | 299 |
| 280 | 3300005546 | Ga0070696_100145236 | Ga0070696_1001452363 | 299 |
| 281 | 3300005546 | Ga0070696_100276753 | Ga0070696_1002767531 | 299 |
| 282 | 3300005548 | Ga0070665_100029854 | Ga0070665_1000298543 | 299 |
| 283 | 3300005548 | Ga0070665_100188240 | Ga0070665_1001882403 | 299 |
| 284 | 3300005549 | Ga0070704_100040889 | Ga0070704_1000408893 | 299 |
| 285 | 3300005549 | Ga0070704_100203860 | Ga0070704_1002038602 | 299 |
| 286 | 3300005549 | Ga0070704_100470734 | Ga0070704_1004707341 | 299 |
| 287 | 3300005578 | Ga0068854_100037060 | Ga0068854_1000370603 | 299 |
| 288 | 3300005578 | Ga0068854_100059275 | Ga0068854_1000592753 | 299 |
| 289 | 3300005615 | Ga0070702_100199602 | Ga0070702_1001996021 | 299 |
| 290 | 3300005617 | Ga0068859_100185385 | Ga0068859_1001853852 | 299 |
| 291 | 3300005617 | Ga0068859_100235567 | Ga0068859_1002355672 | 299 |
| 292 | 3300005618 | Ga0068864_100012241 | Ga0068864_1000122412 | 299 |
| 293 | 3300005618 | Ga0068864_100071795 | Ga0068864_1000717952 | 299 |
| 294 | 3300005718 | Ga0068866_10086760 | Ga0068866_100867601 | 299 |
| 295 | 3300005719 | Ga0068861_100161555 | Ga0068861_1001615552 | 299 |
| 296 | 3300005719 | Ga0068861_100169451 | Ga0068861_1001694512 | 299 |
| 297 | 3300005841 | Ga0068863_100001180 | Ga0068863_10000118010 | 299 |
| 298 | 3300005842 | Ga0068858_100117617 | Ga0068858_1001176173 | 299 |
| 299 | 3300005843 | Ga0068860_100028012 | Ga0068860_1000280123 | 299 |
| 300 | 3300005844 | Ga0068862_100015252 | Ga0068862_1000152524 | 299 |
| 301 | 3300005937 | Ga0081455_10030864 | Ga0081455_100308643 | 299 |
| 302 | 3300006358 | Ga0068871_100004628 | Ga0068871_1000046287 | 299 |
| 303 | 3300006358 | Ga0068871_100104825 | Ga0068871_1001048253 | 299 |
| 304 | 3300006844 | Ga0075428_100057643 | Ga0075428_1000576435 | 299 |
| 305 | 3300006847 | Ga0075431_100107539 | Ga0075431_1001075392 | 299 |
| 306 | 3300006847 | Ga0075431_100131763 | Ga0075431_1001317633 | 299 |
| 307 | 3300006852 | Ga0075433_10027177 | Ga0075433_100271774 | 299 |
| 308 | 3300006852 | Ga0075433_10034721 | Ga0075433_100347213 | 299 |
| 309 | 3300006852 | Ga0075433_10055303 | Ga0075433_100553032 | 299 |
| 310 | 3300006852 | Ga0075433_10082567 | Ga0075433_100825671 | 299 |
| 311 | 3300006871 | Ga0075434_100010651 | Ga0075434_1000106512 | 299 |
| 312 | 3300006871 | Ga0075434_100147274 | Ga0075434_1001472741 | 299 |
| 313 | 3300006880 | Ga0075429_100056466 | Ga0075429_1000564664 | 299 |
| 314 | 3300006880 | Ga0075429_100138655 | Ga0075429_1001386552 | 299 |
| 315 | 3300006881 | Ga0068865_100017560 | Ga0068865_1000175604 | 299 |
| 316 | 3300006881 | Ga0068865_100093745 | Ga0068865_1000937452 | 299 |
| 317 | 3300006914 | Ga0075436_100022899 | Ga0075436_1000228994 | 299 |
| 318 | 3300006931 | Ga0097620_100185389 | Ga0097620_1001853892 | 299 |
| 319 | 3300006931 | Ga0097620_100235585 | Ga0097620_1002355851 | 299 |
| 320 | 3300007076 | Ga0075435_100005047 | Ga0075435_1000050474 | 299 |
| 321 | 3300007076 | Ga0075435_100018838 | Ga0075435_1000188381 | 299 |
| 322 | 3300007076 | Ga0075435_100019935 | Ga0075435_1000199353 | 299 |
| 323 | 3300007076 | Ga0075435_100220460 | Ga0075435_1002204602 | 299 |
| 324 | 3300009094 | Ga0111539_10006195 | Ga0111539_1000619510 | 299 |
| 325 | 3300009094 | Ga0111539_10040254 | Ga0111539_100402543 | 299 |
| 326 | 3300009147 | Ga0114129_10024644 | Ga0114129_100246447 | 299 |
| 327 | 3300009147 | Ga0114129_10030155 | Ga0114129_100301551 | 299 |
| 328 | 3300009147 | Ga0114129_10063076 | Ga0114129_100630765 | 299 |
| 329 | 3300009147 | Ga0114129_10105469 | Ga0114129_101054693 | 299 |
| 330 | 3300009147 | Ga0114129_10217124 | Ga0114129_102171242 | 299 |
| 331 | 3300009147 | Ga0114129_10224866 | Ga0114129_102248662 | 299 |
| 332 | 3300009148 | Ga0105243_10323108 | Ga0105243_103231081 | 299 |
| 333 | 3300009176 | Ga0105242_10223274 | Ga0105242_102232741 | 299 |
| 334 | 3300009177 | Ga0105248_10008980 | Ga0105248_100089808 | 299 |
| 335 | 3300009177 | Ga0105248_10043026 | Ga0105248_100430262 | 299 |
| 336 | 3300009177 | Ga0105248_10072035 | Ga0105248_100720353 | 299 |
| 337 | 3300009177 | Ga0105248_10216113 | Ga0105248_102161132 | 299 |
| 338 | 3300009553 | Ga0105249_10178632 | Ga0105249_101786323 | 299 |
| 339 | 3300013308 | Ga0157375_10140725 | Ga0157375_101407251 | 299 |
| 340 | 3300013308 | Ga0157375_10208565 | Ga0157375_102085652 | 299 |
| 341 | 3300014325 | Ga0163163_10014644 | Ga0163163_100146443 | 299 |
| 342 | 3300014325 | Ga0163163_10175737 | Ga0163163_101757373 | 299 |
| 343 | 3300014326 | Ga0157380_10090294 | Ga0157380_100902943 | 299 |
| 344 | 3300014326 | Ga0157380_10120448 | Ga0157380_101204481 | 299 |
| 345 | 3300025899 | Ga0207642_10009984 | Ga0207642_100099843 | 299 |
| 346 | 3300025907 | Ga0207645_10012339 | Ga0207645_100123393 | 299 |
| 347 | 3300025907 | Ga0207645_10117682 | Ga0207645_101176822 | 299 |
| 348 | 3300025918 | Ga0207662_10092370 | Ga0207662_100923702 | 299 |
| 349 | 3300025921 | Ga0207652_10061614 | Ga0207652_100616143 | 299 |
| 350 | 3300025922 | Ga0207646_10068402 | Ga0207646_100684022 | 299 |
| 351 | 3300025922 | Ga0207646_10074523 | Ga0207646_100745232 | 299 |
| 352 | 3300025922 | Ga0207646_10239663 | Ga0207646_102396632 | 299 |
| 353 | 3300025922 | Ga0207646_10265293 | Ga0207646_102652931 | 299 |
| 354 | 3300025923 | Ga0207681_10020570 | Ga0207681_100205703 | 299 |
| 355 | 3300025923 | Ga0207681_10130947 | Ga0207681_101309472 | 299 |
| 356 | 3300025923 | Ga0207681_10142506 | Ga0207681_101425061 | 299 |
| 357 | 3300025923 | Ga0207681_10215077 | Ga0207681_102150771 | 299 |
| 358 | 3300025923 | Ga0207681_10270414 | Ga0207681_102704142 | 299 |
| 359 | 3300025926 | Ga0207659_10000201 | Ga0207659_100002017 | 299 |
| 360 | 3300025933 | Ga0207706_10008438 | Ga0207706_100084383 | 299 |
| 361 | 3300025933 | Ga0207706_10043039 | Ga0207706_100430392 | 299 |
| 362 | 3300025933 | Ga0207706_10133230 | Ga0207706_101332303 | 299 |
| 363 | 3300025934 | Ga0207686_10270106 | Ga0207686_102701062 | 299 |
| 364 | 3300025935 | Ga0207709_10025070 | Ga0207709_100250703 | 299 |
| 365 | 3300025935 | Ga0207709_10029823 | Ga0207709_100298232 | 299 |
| 366 | 3300025936 | Ga0207670_10090854 | Ga0207670_100908541 | 299 |
| 367 | 3300025936 | Ga0207670_10120022 | Ga0207670_101200222 | 299 |
| 368 | 3300025937 | Ga0207669_10053151 | Ga0207669_100531513 | 299 |
| 369 | 3300025938 | Ga0207704_10116918 | Ga0207704_101169181 | 299 |
| 370 | 3300025940 | Ga0207691_10077563 | Ga0207691_100775633 | 299 |
| 371 | 3300025941 | Ga0207711_10073700 | Ga0207711_100737003 | 299 |
| 372 | 3300025942 | Ga0207689_10008919 | Ga0207689_100089199 | 299 |
| 373 | 3300025942 | Ga0207689_10187395 | Ga0207689_101873952 | 299 |
| 374 | 3300025945 | Ga0207679_10303854 | Ga0207679_103038541 | 299 |
| 375 | 3300025961 | Ga0207712_10242383 | Ga0207712_102423832 | 299 |
| 376 | 3300025972 | Ga0207668_10127821 | Ga0207668_101278213 | 299 |
| 377 | 3300025981 | Ga0207640_10046287 | Ga0207640_100462873 | 299 |
| 378 | 3300025981 | Ga0207640_10170049 | Ga0207640_101700492 | 299 |
| 379 | 3300025986 | Ga0207658_10056756 | Ga0207658_100567563 | 299 |
| 380 | 3300026023 | Ga0207677_10148564 | Ga0207677_101485642 | 299 |
| 381 | 3300026035 | Ga0207703_10007098 | Ga0207703_100070989 | 299 |
| 382 | 3300026035 | Ga0207703_10096489 | Ga0207703_100964892 | 299 |
| 383 | 3300026075 | Ga0207708_10029358 | Ga0207708_100293583 | 299 |
| 384 | 3300026075 | Ga0207708_10063345 | Ga0207708_100633452 | 299 |
| 385 | 3300026088 | Ga0207641_10003014 | Ga0207641_1000301411 | 299 |
| 386 | 3300026088 | Ga0207641_10331127 | Ga0207641_103311272 | 299 |
| 387 | 3300026089 | Ga0207648_10004852 | Ga0207648_100048527 | 299 |
| 388 | 3300026095 | Ga0207676_10029891 | Ga0207676_100298912 | 299 |
| 389 | 3300026095 | Ga0207676_10563737 | Ga0207676_105637371 | 299 |
| 390 | 3300026118 | Ga0207675_100004887 | Ga0207675_10000488711 | 299 |
| 391 | 3300026118 | Ga0207675_100023742 | Ga0207675_1000237421 | 299 |
| 392 | 3300026118 | Ga0207675_100216163 | Ga0207675_1002161632 | 299 |
| 393 | 3300027907 | Ga0207428_10006320 | Ga0207428_100063204 | 299 |
| 394 | 3300027907 | Ga0207428_10024918 | Ga0207428_100249183 | 299 |
| 395 | 3300028379 | Ga0268266_10191549 | Ga0268266_101915493 | 299 |
| 396 | 3300028380 | Ga0268265_10022180 | Ga0268265_100221801 | 299 |
| 397 | 3300028381 | Ga0268264_10523762 | Ga0268264_105237622 | 299 |
| 398 | 3300028381 | Ga0268264_10648550 | Ga0268264_106485501 | 299 |
| 399 | 3300035086 | Ga0373934_0000435 | Ga0373934_0000435_7375_8274 | 299 |
| 400 | 3300035113 | Ga0373936_0060418 | Ga0373936_0060418_344_1243 | 299 |
| 401 | 3300035115 | Ga0373941_0048390 | Ga0373941_0048390_327_1280 | 299 |
| 402 | 3300035116 | Ga0373945_0017943 | Ga0373945_0017943_190_1089 | 299 |
| 403 | 3300035117 | Ga0373953_0019363 | Ga0373953_0019363_692_1591 | 299 |
| 404 | 3300035118 | Ga0373954_0033370 | Ga0373954_0033370_295_1194 | 299 |
| 405 | 3300035119 | Ga0373956_0005080 | Ga0373956_0005080_2822_3721 | 299 |
| 406 | 3300035119 | Ga0373956_0054844 | Ga0373956_0054844_485_1384 | 299 |
| 407 | 3300035120 | Ga0373957_0045335 | Ga0373957_0045335_268_1167 | 299 |
| 408 | 3300035171 | Ga0373946_0012901 | Ga0373946_0012901_1659_2558 | 299 |
| 409 | 3300035410 | Ga0373924_0045634 | Ga0373924_0045634_180_1079 | 299 |
| 410 | 3300035410 | Ga0373924_0077373 | Ga0373924_0077373_68_997 | 299 |
| 411 | 3300035692 | Ga0373935_0029809 | Ga0373935_0029809_1104_2003 | 299 |
| 412 | 3300035725 | Ga0373947_0135777 | Ga0373947_0135777_375_1274 | 299 |
| 413 | 3300035725 | Ga0373947_0211701 | Ga0373947_0211701_256_1155 | 299 |
| 414 | 3300036401 | Ga0373937_0000232 | Ga0373937_0000232_16982_17881 | 299 |
| 415 | 3300036401 | Ga0373937_0010656 | Ga0373937_0010656_1424_2353 | 299 |
| 416 | 3300036401 | Ga0373937_0392039 | Ga0373937_0392039_330_1229 | 299 |
| 417 | 3300037068 | Ga0373925_0017187 | Ga0373925_0017187_3766_4665 | 299 |
| 418 | 3300037068 | Ga0373925_0116086 | Ga0373925_0116086_1003_1902 | 299 |
| 419 | 3300045051 | Ga0451576_0414552 | Ga0451576_0414552_280_1194 | 299 |
| 420 | 3300045976 | Ga0466967_0247692 | Ga0466967_0247692_760_1680 | 299 |
| 421 | 3300046462 | Ga0495651_0097652 | Ga0495651_0097652_500_1399 | 299 |
| 422 | 3300046472 | Ga0495580_0059543 | Ga0495580_0059543_40_939 | 299 |
| 423 | 3300046477 | Ga0495664_0158816 | Ga0495664_0158816_243_1151 | 299 |
| 424 | 3300046535 | Ga0495586_0099893 | Ga0495586_0099893_241_1149 | 299 |
| 425 | 3300046535 | Ga0495586_0102645 | Ga0495586_0102645_632_1531 | 299 |
| 426 | 3300046543 | Ga0495645_0193467 | Ga0495645_0193467_420_1349 | 299 |
| 427 | 3300046663 | Ga0495635_0189881 | Ga0495635_0189881_299_1294 | 299 |
| 428 | 3300046679 | Ga0495623_0084687 | Ga0495623_0084687_229_1158 | 299 |
| 429 | 3300046681 | Ga0495647_0004938 | Ga0495647_0004938_2298_3197 | 299 |
| 430 | 3300046683 | Ga0495658_0030840 | Ga0495658_0030840_632_1531 | 299 |
| 431 | 3300046683 | Ga0495658_0114177 | Ga0495658_0114177_440_1339 | 299 |
| 432 | 3300046683 | Ga0495658_0217473 | Ga0495658_0217473_267_1166 | 299 |
| 433 | 3300046684 | Ga0495669_0006162 | Ga0495669_0006162_766_1665 | 299 |
| 434 | 3300047673 | Ga0495593_0173710 | Ga0495593_0173710_30_929 | 299 |
| 435 | 3300048905 | Ga0496102_0457125 | Ga0496102_0457125_44_943 | 299 |
| 436 | 3300048905 | Ga0496102_0484123 | Ga0496102_0484123_102_1022 | 299 |
| 437 | 3300048912 | Ga0496109_0088313 | Ga0496109_0088313_1454_2359 | 299 |
| 438 | 3300048912 | Ga0496109_0307898 | Ga0496109_0307898_519_1418 | 299 |
| 439 | 3300048915 | Ga0496112_0006375 | Ga0496112_0006375_8395_9294 | 299 |
| 440 | 3300048917 | Ga0496114_0214678 | Ga0496114_0214678_630_1529 | 299 |
| 441 | 3300050507 | nmdc:mga05p37_150692_c1 | nmdc:mga05p37_150692_c1_40_939 | 299 |
| 442 | 3300050507 | nmdc:mga05p37_16284_c1 | nmdc:mga05p37_16284_c1_4632_5531 | 299 |
| 443 | 3300050507 | nmdc:mga05p37_171806_c1 | nmdc:mga05p37_171806_c1_1014_1934 | 299 |
| 444 | 3300050507 | nmdc:mga05p37_20210_c1 | nmdc:mga05p37_20210_c1_4606_5505 | 299 |
| 445 | 3300050507 | nmdc:mga05p37_26789_c1 | nmdc:mga05p37_26789_c1_194_1093 | 299 |
| 446 | 3300050507 | nmdc:mga05p37_305221_c1 | nmdc:mga05p37_305221_c1_112_1098 | 299 |
| 447 | 3300050507 | nmdc:mga05p37_8548_c1 | nmdc:mga05p37_8548_c1_6643_7542 | 299 |
| 448 | 3300050510 | nmdc:mga06r32_314438_c1 | nmdc:mga06r32_314438_c1_422_1321 | 299 |
| 449 | 3300050510 | nmdc:mga06r32_71756_c1 | nmdc:mga06r32_71756_c1_663_1586 | 299 |
| 450 | 3300050511 | nmdc:mga08y16_23190_c1 | nmdc:mga08y16_23190_c1_4534_5433 | 299 |
| 451 | 3300050511 | nmdc:mga08y16_556937_c1 | nmdc:mga08y16_556937_c1_118_1029 | 299 |
| 452 | 3300050512 | nmdc:mga0n895_157888_c1 | nmdc:mga0n895_157888_c1_121_1020 | 299 |
| 453 | 3300050512 | nmdc:mga0n895_79886_c1 | nmdc:mga0n895_79886_c1_499_1398 | 299 |
| 454 | 3300050513 | nmdc:mga0rr50_210485_c1 | nmdc:mga0rr50_210485_c1_498_1397 | 299 |
| 455 | 3300050515 | nmdc:mga0a205_49331_c1 | nmdc:mga0a205_49331_c1_2607_3506 | 299 |
| 456 | 3300050515 | nmdc:mga0a205_69584_c1 | nmdc:mga0a205_69584_c1_37_936 | 299 |
| 457 | 3300053077 | Ga0495601_0117828 | Ga0495601_0117828_719_1687 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lgt-assembly1.cif.gz_A | y162a/h198p double mutant of degs-deltapdz protease | 0.8925 | 16 | 197 |
| 3k6y-assembly1.cif.gz_A | crystal structure of rv3671c protease from m. tuberculosis, active form | 0.8911 | 16 | 191 |
| 3k6z-assembly1.cif.gz_B | crystal structure of rv3671c protease, inactive form | 0.8896 | 16 | 193 |
| 3b8j-assembly1.cif.gz_A | q191a mutant of degs-deltapdz | 0.8885 | 16 | 194 |
| 2qgr-assembly1.cif.gz_A | structure of the r178a mutant of delta pdz degs protease | 0.8872 | 16 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gdvC03 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9343 | 201 | 299 | 2.30.42.10 |
| 3gdvC03 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9149 | 201 | 299 | 2.30.42.10 |
| 3mh4B01 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.9059 | 22 | 94 | 2.40.10.10 |
| af_F1QL69_2_87_2.30.42.10 | Mainly Beta;Roll;Pdz3 Domain;PDZ domain | 0.9037 | 226 | 292 | 2.30.42.10 |
| 3stiA01 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.8955 | 13 | 87 | 2.40.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8E7W3-F1-model_v4 | Uncharacterized protein | 0.9718 | 1 | 115 |
|
| AF-A0A3N5VEM7-F1-model_v4 | Serine protease | 0.9411 | 5 | 165 |
GO:0004252
GO:0005886 GO:0006515 GO:0042597 |
| AF-A0A3M1SQ67-F1-model_v4 | M20/M25/M40 family metallo-hydrolase | 0.9358 | 201 | 296 |
GO:0004177
GO:0006508 GO:0008235 |
| AF-A0A535PW73-F1-model_v4 | PDZ domain-containing protein | 0.9353 | 205 | 292 |
|
| AF-A0A3E1NPQ3-F1-model_v4 | PDZ domain-containing protein | 0.9335 | 200 | 295 |
GO:0006515
GO:0042597 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar