F448068

General Info

Members Datasets Scaffolds Average Seq Length
457 291 914 421

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0079014|Ga0496124_0079014_1026_2507
Length 493
Sequence VEQLTCTEAVINRAEKAISLVVGWYAGMLQTTDVCNNAEAGGHFFIGRGIAFNSRNPSFVCLTIFLMKVVIVGGGFAGINLAKQLAGNSAIEVVLVDKNNYHFFPPLIYQVATSFIEASNISYPFRKMFQYKKNLRFHYGALLNIVAAESKIETTTGDVPYDRLVLALGTQTNYFGMQNVQQHALPMKTINDALDLRNHILQVLEKAALEHDAAEREKLLNIVIAGGGPTGVELAGMLAYMGKNIVAKDYPDVPDARRANIYLVDMLPVLLGPMSKKSQTEAYEVLTGMGVKVQLNQSVKDYVDGAVVFGDGSRIPTHSLIWTSGVIACEAPGLPKESVGRGRRLQVDAFNKVQGTEHIYAIGDVCVQTTDAAYPNGHPQLAQVAIQQGKLLAKNLQRELRHAPMEPFAYTDKGSMAIISKNKAVGDLPKNIFIRGFFAWLTWLFIHILPIAGFRNKLKLFNNWIVSFISNDPNLRLIIRPKNDWAAKGEEEA

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
130 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
231 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
238 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
239 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
257 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
258 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
259 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
260 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
261 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
262 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
263 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
264 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
265 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
266 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
267 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
268 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
269 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
270 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
271 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
272 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
273 2818991444 Filimonas endophytica 3197 Isolate Unclassified
274 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
275 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
276 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
277 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
278 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
279 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
280 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
281 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
282 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
283 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
284 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
285 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
286 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
287 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
288 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
289 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
290 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
291 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.47
Metatranscriptomes 0.22
Isolates 8.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 3.5
Nodule 1.09
Rhizoplane 0.66
Rhizosphere 83.59
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0079014 3300048927 Bacteria 2710
2 JGI25162J39368_1000005 3300002737 Bacteria 435925
3 JGI25406J46586_10030426 3300003203 Unclassified 2032
4 rootH1_10071545 3300003316 Unclassified 4250
5 rootH2_10001891 3300003320 Bacteria 464318
6 rootH2_10043772 3300003320 Bacteria 2127
7 rootL2_10060107 3300003322 Bacteria 7258
8 rootL2_10065114 3300003322 Bacteria 10258
9 rootL2_10284751 3300003322 Bacteria 2291
10 rootL2_10367446 3300003322 Bacteria 1639
11 rootH1_10021842 3300003323 Bacteria 49730
12 rootH1_10108082 3300003323 Bacteria 8341
13 rootH1_10186396 3300003323 Bacteria 2085
14 rootH1_10253110 3300003323 Bacteria 2345
15 rootH1_10307374 3300003323 Bacteria 2181
16 JGI25160J50197_1000376 3300003354 Bacteria 29172
17 Ga0006562J51391_1018829 3300003578 Bacteria 1306
18 Ga0055536_1007819 3300003781 Bacteria 4716
19 Ga0065165_1000145 3300005262 Bacteria 123255
20 Ga0065714_10065832 3300005288 Bacteria 8344
21 Ga0065714_10066911 3300005288 Bacteria 6110
22 Ga0065714_10067184 3300005288 Bacteria 5802
23 Ga0065712_10006089 3300005290 Bacteria 4213
24 Ga0070658_10011805 3300005327 Bacteria 7010
25 Ga0070658_10046286 3300005327 Bacteria 3520
26 Ga0070658_10268090 3300005327 Unclassified 1451
27 Ga0070683_100055678 3300005329 Bacteria 3671
28 Ga0068869_100005145 3300005334 Bacteria 8204
29 Ga0070680_100048351 3300005336 Bacteria 3466
30 Ga0070682_100002913 3300005337 Bacteria 9493
31 Ga0068868_100025310 3300005338 Bacteria 4513
32 Ga0070660_100006247 3300005339 Bacteria 8249
33 Ga0070660_100062303 3300005339 Bacteria 2897
34 Ga0070689_100186538 3300005340 Bacteria 1687
35 Ga0070661_100130179 3300005344 Bacteria 1889
36 Ga0070668_100008443 3300005347 Bacteria 7648
37 Ga0070669_100008614 3300005353 Bacteria 7277
38 Ga0070669_100028225 3300005353 Bacteria 4041
39 Ga0070675_100002058 3300005354 Bacteria 14910
40 Ga0070675_100190142 3300005354 Unclassified 1778
41 Ga0070673_100021860 3300005364 Bacteria 4648
42 Ga0070688_100026789 3300005365 Unclassified 3428
43 Ga0070659_100015428 3300005366 Bacteria 5722
44 Ga0070659_100076996 3300005366 Bacteria 2659
45 Ga0070709_10007631 3300005434 Bacteria 5936
46 Ga0070714_100011414 3300005435 Bacteria 7047
47 Ga0070713_100000251 3300005436 Bacteria 35250
48 Ga0070713_100007891 3300005436 Bacteria 7511
49 Ga0070711_100058165 3300005439 Bacteria 2679
50 Ga0070708_100033733 3300005445 Bacteria 4448
51 Ga0070681_10087036 3300005458 Bacteria 3077
52 Ga0068867_100033309 3300005459 Bacteria 3730
53 Ga0070685_10118628 3300005466 Unclassified 1640
54 Ga0070698_100123006 3300005471 Unclassified 2553
55 Ga0070679_100003446 3300005530 Bacteria 14482
56 Ga0070684_100127625 3300005535 Bacteria 2292
57 Ga0068853_100229627 3300005539 Bacteria 1697
58 Ga0068853_100471915 3300005539 Bacteria 1182
59 Ga0070693_100024173 3300005547 Bacteria 3255
60 Ga0068855_100006274 3300005563 Bacteria 14489
61 Ga0068855_100023805 3300005563 Bacteria 7336
62 Ga0068855_100124110 3300005563 Bacteria 2954
63 Ga0068855_100374684 3300005563 Unclassified 1564
64 Ga0070664_100048964 3300005564 Bacteria 3573
65 Ga0068857_100005970 3300005577 Bacteria 10405
66 Ga0068857_100026557 3300005577 Bacteria 5104
67 Ga0068857_100035653 3300005577 Bacteria 4406
68 Ga0068857_100114550 3300005577 Bacteria 2425
69 Ga0068854_100098702 3300005578 Unclassified 2186
70 Ga0068856_100049618 3300005614 Bacteria 4137
71 Ga0068859_100090081 3300005617 Bacteria 3118
72 Ga0068864_100012517 3300005618 Bacteria 7016
73 Ga0068864_100170308 3300005618 Bacteria 1985
74 Ga0068861_100009873 3300005719 Bacteria 6604
75 Ga0068861_100080620 3300005719 Unclassified 2546
76 Ga0068870_10044802 3300005840 Bacteria 2313
77 Ga0068870_10062730 3300005840 Unclassified 2003
78 Ga0068858_100143647 3300005842 Bacteria 2241
79 Ga0068862_100027839 3300005844 Bacteria 4760
80 Ga0068862_100047367 3300005844 Bacteria 3668
81 Ga0081539_10003431 3300005985 Bacteria 19492
82 Ga0070717_10000372 3300006028 Bacteria 28578
83 Ga0070712_100010977 3300006175 Bacteria 5732
84 Ga0070712_100052145 3300006175 Bacteria 2852
85 Ga0075430_100004129 3300006846 Bacteria 12254
86 Ga0075431_100074491 3300006847 Bacteria 3503
87 Ga0075431_100147249 3300006847 Unclassified 2426
88 Ga0075429_100073353 3300006880 Bacteria 2981
89 Ga0097620_100090080 3300006931 Bacteria 3118
90 Ga0099824_1000204 3300006942 Bacteria 57939
91 Ga0079104_1001587 3300006946 Bacteria 14842
92 Ga0105244_10000058 3300009036 Bacteria 128877
93 Ga0105244_10000063 3300009036 Bacteria 122746
94 Ga0105240_10007171 3300009093 Bacteria 16232
95 Ga0105240_10243132 3300009093 Bacteria 2085
96 Ga0111539_10030967 3300009094 Bacteria 6500
97 Ga0111539_10062482 3300009094 Bacteria 4408
98 Ga0105241_10009442 3300009174 Bacteria 7164
99 Ga0105237_10000013 3300009545 Bacteria 297699
100 Ga0105237_10013166 3300009545 Bacteria 8678
101 Ga0105237_10058142 3300009545 Bacteria 3870
102 Ga0105238_10070407 3300009551 Bacteria 3497
103 Ga0105238_10204634 3300009551 Bacteria 1950
104 Ga0105249_10000075 3300009553 Bacteria 145150
105 Ga0105249_10004262 3300009553 Bacteria 12360
106 Ga0105239_10000609 3300010375 Bacteria 50949
107 Ga0105239_10004531 3300010375 Bacteria 16569
108 Ga0157373_10000002 3300013100 Bacteria 750094
109 Ga0157373_10000009 3300013100 Bacteria 201551
110 Ga0157373_10003582 3300013100 Bacteria 11731
111 Ga0157373_10004753 3300013100 Bacteria 10222
112 Ga0157373_10019316 3300013100 Bacteria 4963
113 Ga0157371_10001101 3300013102 Bacteria 29303
114 Ga0157371_10001777 3300013102 Bacteria 21790
115 Ga0157371_10003314 3300013102 Bacteria 14722
116 Ga0157371_10004025 3300013102 Bacteria 13006
117 Ga0157371_10006532 3300013102 Bacteria 9594
118 Ga0157371_10022641 3300013102 Bacteria 4599
119 Ga0157371_10056291 3300013102 Bacteria 2789
120 Ga0157371_10074445 3300013102 Bacteria 2405
121 Ga0157371_10148722 3300013102 Bacteria 1670
122 Ga0157370_10001332 3300013104 Bacteria 30666
123 Ga0157370_10001649 3300013104 Bacteria 27558
124 Ga0157370_10001675 3300013104 Bacteria 27295
125 Ga0157370_10002569 3300013104 Bacteria 21784
126 Ga0157370_10006311 3300013104 Bacteria 13099
127 Ga0157370_10025287 3300013104 Bacteria 5877
128 Ga0157370_10033912 3300013104 Bacteria 4975
129 Ga0157370_10056755 3300013104 Bacteria 3726
130 Ga0157370_10059434 3300013104 Bacteria 3633
131 Ga0157370_10066143 3300013104 Bacteria 3419
132 Ga0157370_10123902 3300013104 Bacteria 2413
133 Ga0157370_10132413 3300013104 Bacteria 2325
134 Ga0157369_10007435 3300013105 Bacteria 12615
135 Ga0157369_10015073 3300013105 Bacteria 8726
136 Ga0157369_10042118 3300013105 Bacteria 4982
137 Ga0157369_10131945 3300013105 Bacteria 2646
138 Ga0157374_10000455 3300013296 Bacteria 37317
139 Ga0163162_10000608 3300013306 Bacteria 33219
140 Ga0163162_10005346 3300013306 Bacteria 12396
141 Ga0163162_10108329 3300013306 Bacteria 2874
142 Ga0163162_10245132 3300013306 Bacteria 1923
143 Ga0157372_10010829 3300013307 Bacteria 9709
144 Ga0157372_10021372 3300013307 Bacteria 6992
145 Ga0157372_10140291 3300013307 Bacteria 2784
146 Ga0157372_10181653 3300013307 Bacteria 2435
147 Ga0157375_10000313 3300013308 Bacteria 43467
148 Ga0157375_10000695 3300013308 Bacteria 29734
149 Ga0163163_10000075 3300014325 Bacteria 109545
150 Ga0157380_10036583 3300014326 Bacteria 3799
151 Ga0157380_10162269 3300014326 Bacteria 1944
152 Ga0182008_10000028 3300014497 Bacteria 176968
153 Ga0157377_10008865 3300014745 Bacteria 4920
154 Ga0157376_10020537 3300014969 Bacteria 5111
155 Ga0182006_1000016 3300015261 Bacteria 303558
156 Ga0182006_1001059 3300015261 Bacteria 17747
157 Ga0163161_10000271 3300017792 Bacteria 45502
158 Ga0163161_10004631 3300017792 Bacteria 9571
159 Ga0163161_10004844 3300017792 Bacteria 9376
160 Ga0163161_10006744 3300017792 Bacteria 7936
161 Ga0213876_10006242 3300021384 Bacteria 6502
162 Ga0209437_100043 3300025233 Bacteria 440454
163 Ga0209675_1000033 3300025291 Bacteria 271576
164 Ga0209676_1000740 3300025292 Bacteria 44339
165 Ga0209050_1001111 3300025298 Bacteria 32578
166 Ga0207655_1000608 3300025728 Bacteria 43328
167 Ga0207655_1000693 3300025728 Bacteria 39160
168 Ga0207647_10109973 3300025904 Bacteria 1629
169 Ga0207699_10032782 3300025906 Bacteria 2930
170 Ga0207643_10002082 3300025908 Bacteria 11021
171 Ga0207705_10072796 3300025909 Bacteria 2493
172 Ga0207705_10110631 3300025909 Bacteria 2029
173 Ga0207654_10115405 3300025911 Unclassified 1678
174 Ga0207707_10002978 3300025912 Bacteria 15071
175 Ga0207671_10000024 3300025914 Bacteria 274628
176 Ga0207671_10078377 3300025914 Bacteria 2474
177 Ga0207693_10034486 3300025915 Bacteria 3991
178 Ga0207693_10038724 3300025915 Bacteria 3753
179 Ga0207660_10038298 3300025917 Bacteria 3346
180 Ga0207660_10072155 3300025917 Bacteria 2514
181 Ga0207657_10034674 3300025919 Bacteria 4535
182 Ga0207652_10000159 3300025921 Bacteria 73101
183 Ga0207652_10000166 3300025921 Bacteria 71226
184 Ga0207681_10003233 3300025923 Bacteria 10219
185 Ga0207694_10019653 3300025924 Bacteria 5110
186 Ga0207659_10005720 3300025926 Bacteria 7570
187 Ga0207659_10117012 3300025926 Unclassified 2036
188 Ga0207700_10010772 3300025928 Bacteria 5795
189 Ga0207664_10008816 3300025929 Bacteria 7054
190 Ga0207690_10012516 3300025932 Bacteria 5077
191 Ga0207690_10201411 3300025932 Unclassified 1512
192 Ga0207706_10032766 3300025933 Bacteria 4625
193 Ga0207689_10143615 3300025942 Unclassified 1966
194 Ga0207661_10044898 3300025944 Bacteria 3495
195 Ga0207667_10024111 3300025949 Bacteria 6686
196 Ga0207667_10043720 3300025949 Bacteria 4752
197 Ga0207667_10151225 3300025949 Bacteria 2389
198 Ga0207651_10041289 3300025960 Unclassified 3061
199 Ga0207712_10004795 3300025961 Bacteria 8545
200 Ga0207668_10057030 3300025972 Bacteria 2723
201 Ga0207703_10265299 3300026035 Bacteria 1553
202 Ga0207678_10022022 3300026067 Bacteria 5585
203 Ga0207678_10269642 3300026067 Bacteria 1460
204 Ga0207678_10273004 3300026067 Bacteria 1450
205 Ga0207708_10124038 3300026075 Unclassified 2015
206 Ga0207708_10178021 3300026075 Bacteria 1687
207 Ga0207702_10064532 3300026078 Bacteria 3134
208 Ga0207702_10087810 3300026078 Bacteria 2716
209 Ga0207702_10180479 3300026078 Unclassified 1944
210 Ga0207676_10008113 3300026095 Bacteria 7464
211 Ga0207674_10020855 3300026116 Bacteria 7071
212 Ga0207674_10040160 3300026116 Bacteria 4849
213 Ga0207674_10052505 3300026116 Bacteria 4157
214 Ga0207674_10066598 3300026116 Bacteria 3627
215 Ga0207675_100000597 3300026118 Bacteria 35284
216 Ga0207675_100021734 3300026118 Bacteria 5972
217 Ga0209281_1000244 3300027111 Bacteria 109979
218 Ga0209489_120529 3300027361 Bacteria 1875
219 Ga0207428_10034442 3300027907 Bacteria 4149
220 Ga0268265_10012717 3300028380 Bacteria 5711
221 Ga0268265_10013596 3300028380 Bacteria 5534
222 Ga0307517_10015766 3300028786 Bacteria 10008
223 Ga0307515_10000174 3300028794 Bacteria 157501
224 Ga0307511_10001867 3300030521 Bacteria 22132
225 Ga0316177_1134237 3300030731 Bacteria 18489
226 Ga0316176_1057051 3300030732 Bacteria 34395
227 Ga0316176_1179773 3300030732 Bacteria 7963
228 Ga0316183_1093843 3300030742 Bacteria 22860
229 Ga0316183_1116825 3300030742 Bacteria 56435
230 Ga0316181_1082642 3300030744 Bacteria 18700
231 Ga0316181_1214641 3300030744 Bacteria 2619
232 Ga0316182_1070171 3300030745 Bacteria 1996
233 Ga0265320_10053188 3300031240 Bacteria 1958
234 Ga0265339_10011914 3300031249 Bacteria 5330
235 Ga0265331_10044102 3300031250 Bacteria 2158
236 Ga0265316_10022745 3300031344 Bacteria 5277
237 Ga0265314_10032332 3300031711 Bacteria 3849
238 Ga0307405_10000392 3300031731 Bacteria 16393
239 Ga0307410_10000067 3300031852 Bacteria 37092
240 Ga0307410_10226129 3300031852 Bacteria 1442
241 Ga0307406_10000035 3300031901 Bacteria 82953
242 Ga0307406_10079708 3300031901 Bacteria 2172
243 Ga0307412_10000022 3300031911 Bacteria 241533
244 Ga0307412_10000451 3300031911 Bacteria 24824
245 Ga0307412_10048565 3300031911 Bacteria 2792
246 Ga0307412_10055509 3300031911 Bacteria 2635
247 Ga0307416_100000003 3300032002 Bacteria 509060
248 Ga0307416_100019284 3300032002 Bacteria 4831
249 Ga0307414_10000009 3300032004 Bacteria 359782
250 Ga0307414_10000063 3300032004 Bacteria 107710
251 Ga0307414_10008875 3300032004 Bacteria 5738
252 Ga0307414_10160240 3300032004 Unclassified 1786
253 Ga0307414_10236852 3300032004 Bacteria 1508
254 Ga0307411_10000001 3300032005 Bacteria 931810
255 Ga0307415_100051098 3300032126 Bacteria 2804
256 Ga0373926_0039099 3300035083 Bacteria 1690
257 Ga0373934_0033676 3300035086 Bacteria 2011
258 Ga0373944_0007642 3300035089 Bacteria 2902
259 Ga0373956_0001589 3300035119 Bacteria 9360
260 Ga0373957_0009427 3300035120 Bacteria 3194
261 Ga0373943_0007820 3300035170 Bacteria 4802
262 Ga0373955_0008426 3300035172 Bacteria 4788
263 Ga0373935_0004478 3300035692 Bacteria 8204
264 Ga0373937_0006520 3300036401 Bacteria 10076
265 Ga0373925_0009242 3300037068 Bacteria 7176
266 Ga0373925_0102394 3300037068 Bacteria 2203
267 Ga0395899_0001157 3300037312 Bacteria 23307
268 Ga0395899_0049940 3300037312 Bacteria 3107
269 Ga0395899_0052558 3300037312 Bacteria 3019
270 Ga0395900_0001840 3300037418 Bacteria 24172
271 Ga0395900_0006015 3300037418 Bacteria 12653
272 Ga0395900_0032537 3300037418 Bacteria 5363
273 Ga0395900_0051603 3300037418 Bacteria 4236
274 Ga0395900_0100672 3300037418 Bacteria 2968
275 Ga0395900_0132808 3300037418 Bacteria 2550
276 Ga0395900_0232798 3300037418 Bacteria 1852
277 Ga0395898_0000480 3300037466 Bacteria 79611
278 Ga0395898_0002406 3300037466 Bacteria 22205
279 Ga0395898_0114401 3300037466 Bacteria 2585
280 Ga0395905_0003208 3300037471 Bacteria 17617
281 Ga0395905_0014981 3300037471 Bacteria 7394
282 Ga0395905_0087706 3300037471 Bacteria 2917
283 Ga0395901_0005715 3300038443 Bacteria 12593
284 Ga0395901_0011060 3300038443 Bacteria 9145
285 Ga0395901_0020996 3300038443 Bacteria 6689
286 Ga0395901_0161484 3300038443 Bacteria 2353
287 Ga0395901_0334346 3300038443 Bacteria 1565
288 Ga0395901_0397495 3300038443 Bacteria 1416
289 Ga0436365_0301783 3300039437 Bacteria 10292
290 Ga0439466_0006343 3300041411 Bacteria 4501
291 Ga0439445_0000328 3300042004 Bacteria 9260
292 Ga0451577_0000001 3300042876 Bacteria 2461803
293 Ga0466969_0000629 3300044656 Bacteria 19111
294 Ga0466959_0000236 3300045049 Bacteria 34631
295 Ga0466959_0012697 3300045049 Bacteria 6093
296 Ga0466967_0031358 3300045976 Bacteria 4474
297 Ga0495627_000002 3300046453 Bacteria 903861
298 Ga0495592_0060396 3300046454 Bacteria 2788
299 Ga0495592_0100927 3300046454 Bacteria 2057
300 Ga0495603_0000875 3300046455 Bacteria 17301
301 Ga0495629_0004622 3300046459 Bacteria 10309
302 Ga0495629_0079396 3300046459 Bacteria 2291
303 Ga0495629_0083977 3300046459 Bacteria 2222
304 Ga0495638_0000005 3300046460 Bacteria 680627
305 Ga0495651_0010749 3300046462 Bacteria 7038
306 Ga0495653_0014535 3300046463 Bacteria 6424
307 Ga0495653_0015654 3300046463 Bacteria 6182
308 Ga0495580_0002790 3300046472 Bacteria 15025
309 Ga0495582_0000646 3300046473 Bacteria 19156
310 Ga0495639_0000028 3300046475 Bacteria 67975
311 Ga0495639_0009164 3300046475 Bacteria 4243
312 Ga0495664_0007645 3300046477 Bacteria 6009
313 Ga0495606_0019712 3300046507 Bacteria 5003
314 Ga0495606_0021092 3300046507 Bacteria 4779
315 Ga0495610_0000009 3300046512 Bacteria 554843
316 Ga0495628_0071858 3300046516 Bacteria 2697
317 Ga0495628_0104270 3300046516 Bacteria 2185
318 Ga0495630_0000452 3300046517 Bacteria 31051
319 Ga0495643_0057029 3300046522 Bacteria 2083
320 Ga0495652_0043188 3300046529 Bacteria 3884
321 Ga0495654_0000001 3300046530 Bacteria 1513197
322 Ga0495665_0001779 3300046531 Bacteria 11591
323 Ga0495609_0004547 3300046538 Bacteria 7540
324 Ga0495645_0008059 3300046543 Bacteria 7339
325 Ga0495645_0023980 3300046543 Bacteria 4422
326 Ga0495633_0001799 3300046558 Bacteria 15821
327 Ga0495667_0009250 3300046559 Bacteria 6682
328 Ga0495667_0012355 3300046559 Bacteria 5788
329 Ga0495668_0000639 3300046616 Bacteria 42159
330 Ga0495668_0007378 3300046616 Bacteria 7039
331 Ga0495634_0014442 3300046642 Bacteria 5694
332 Ga0495588_0000686 3300046674 Bacteria 15594
333 Ga0495599_0006014 3300046678 Bacteria 7303
334 Ga0495623_0022183 3300046679 Bacteria 4101
335 Ga0495623_0037498 3300046679 Bacteria 3101
336 Ga0495658_0000525 3300046683 Bacteria 20888
337 Ga0495613_0089041 3300046689 Bacteria 2236
338 Ga0495613_0096782 3300046689 Bacteria 2134
339 Ga0495600_0069346 3300046809 Unclassified 2304
340 Ga0495581_0000676 3300047315 Bacteria 17862
341 Ga0495581_0034750 3300047315 Bacteria 2917
342 Ga0495604_0006639 3300047317 Bacteria 9170
343 Ga0495604_0023554 3300047317 Bacteria 4912
344 Ga0495674_0039053 3300047319 Bacteria 4256
345 Ga0495674_0081033 3300047319 Bacteria 2785
346 Ga0495686_0000086 3300047472 Bacteria 197490
347 Ga0495686_0001041 3300047472 Bacteria 33277
348 Ga0495686_0011234 3300047472 Bacteria 6315
349 Ga0495593_0000015 3300047673 Bacteria 80492
350 Ga0495602_0044348 3300048088 Bacteria 4035
351 Ga0495614_0001287 3300048089 Bacteria 10804
352 Ga0496102_0007635 3300048905 Bacteria 9243
353 Ga0496113_0033785 3300048916 Bacteria 3727
354 Ga0496114_0000437 3300048917 Bacteria 30764
355 Ga0496116_0000032 3300048919 Bacteria 419997
356 Ga0496116_0000053 3300048919 Bacteria 291837
357 Ga0496117_0000089 3300048920 Bacteria 210551
358 Ga0496118_0000221 3300048921 Bacteria 99682
359 Ga0496118_0109301 3300048921 Bacteria 1841
360 Ga0496119_0000038 3300048922 Bacteria 209546
361 Ga0496122_0000465 3300048925 Bacteria 84396
362 Ga0496122_0000700 3300048925 Bacteria 66410
363 Ga0496122_0002035 3300048925 Bacteria 30015
364 Ga0496122_0020942 3300048925 Bacteria 5876
365 Ga0496123_0000930 3300048926 Bacteria 45779
366 Ga0496123_0006125 3300048926 Bacteria 11794
367 Ga0496124_0001049 3300048927 Bacteria 43602
368 Ga0496124_0014102 3300048927 Bacteria 7748
369 Ga0496125_0000059 3300048928 Bacteria 264149
370 Ga0496125_0000547 3300048928 Bacteria 64865
371 Ga0496125_0017073 3300048928 Bacteria 6935
372 Ga0496126_0135247 3300048929 Bacteria 2127
373 Ga0496126_0156224 3300048929 Bacteria 1952
374 Ga0501300_005309 3300049523 Bacteria 1902
375 Ga0501033_0083716 3300049570 Unclassified 2338
376 Ga0501034_0046485 3300049571 Bacteria 4385
377 Ga0501034_0059935 3300049571 Unclassified 3823
378 Ga0501037_0038929 3300049573 Unclassified 3502
379 Ga0501047_0121072 3300049581 Bacteria 2499
380 Ga0501070_0117991 3300049586 Unclassified 2192
381 Ga0501071_0204287 3300049587 Unclassified 1485
382 Ga0501073_0039574 3300049589 Unclassified 3339
383 Ga0501076_0253477 3300049592 Bacteria 1440
384 Ga0501217_008812 3300049661 Bacteria 2186
385 Ga0501238_000571 3300049671 Bacteria 4227
386 Ga0501249_000009 3300049679 Bacteria 173938
387 Ga0501249_001009 3300049679 Bacteria 6048
388 Ga0501257_014364 3300049686 Bacteria 1820
389 Ga0501219_000364 3300049703 Bacteria 7608
390 Ga0501225_0025872 3300049705 Bacteria 1614
391 Ga0501079_0091867 3300049741 Bacteria 2352
392 Ga0501080_0083336 3300049742 Bacteria 2970
393 Ga0501081_0044054 3300049743 Bacteria 3062
394 Ga0501083_0006687 3300049744 Bacteria 8179
395 Ga0501241_000019 3300049758 Bacteria 88612
396 Ga0501264_000151 3300049761 Bacteria 11113
397 Ga0501266_000039 3300049763 Bacteria 26126
398 Ga0501035_0088175 3300049822 Unclassified 2734
399 Ga0501035_0139711 3300049822 Bacteria 2107
400 Ga0501044_0051861 3300049823 Bacteria 4230
401 Ga0501044_0227505 3300049823 Unclassified 1814
402 Ga0501284_00013 3300050005 Bacteria 115944
403 nmdc:mga09592_11461_c1 3300050508 Bacteria 7213
404 nmdc:mga09592_1424_c1 3300050508 Bacteria 19204
405 nmdc:mga0qj67_19054_c1 3300050509 Bacteria 5239
406 nmdc:mga0qj67_25885_c1 3300050509 Bacteria 4538
407 nmdc:mga06r32_64932_c1 3300050510 Bacteria 3520
408 nmdc:mga08y16_18443_c1 3300050511 Bacteria 7353
409 Ga0495601_0063401 3300053077 Bacteria 2349
410 Ga0495595_0057572 3300053084 Bacteria 1813
411 Ga0500646_0000495 3300053090 Bacteria 11533
412 Ga0500641_0000019 3300053096 Bacteria 123198
413 Ga0500641_0000554 3300053096 Bacteria 13497
414 Ga0500658_0000003 3300053134 Bacteria 512506
415 Ga0500568_0002111 3300053139 Bacteria 12003
416 Ga0500616_0000003 3300053153 Bacteria 1220687
417 Ga0500622_0000640 3300053156 Bacteria 31322
418 Ga0500622_0000986 3300053156 Bacteria 24174
419 Ga0501082_0280538 3300060353 Unclassified 1450
420 2511231251 2511231000 Bacteria 4488346
421 2522551707 2522125168 Bacteria 7376607
422 2585141490 2582581278 Bacteria 5296881
423 2585156713 2582581281 Bacteria 4487904
424 2585160984 2582581282 Bacteria 4495830
425 2587677540 2585428045 Bacteria 5203023
426 2587751251 2585428061 Bacteria 3939663
427 2588208093 2585428182 Bacteria 5007281
428 2588218592 2585428184 Bacteria 4978681
429 2588219946 2585428184 Bacteria 4978681
430 2588233374 2585428187 Bacteria 4629388
431 2590612624 2588254257 Bacteria 5436094
432 2729198719 2728369107 Bacteria 5082720
433 2740057776 2739367874 Bacteria 4872888
434 2753671096 2751185877 Bacteria 4921427
435 2765573399 2765235839 Bacteria 5314748
436 2772606033 2772190705 Bacteria 4666226
437 2816873071 2816332188 Bacteria 5133218
438 2819586434 2818991444 Bacteria 6968812
439 2842084892 2842083920 Bacteria 4857652
440 2842908319 2842903701 Bacteria 6986368
441 2842908459 2842903701 Bacteria 6986368
442 2871723884 2871720351 Bacteria 4862476
443 2881955679 2881955468 Bacteria 3545609
444 2889291553 2889290771 Bacteria 5530962
445 2896317669 2896317667 Bacteria 4606601
446 2906000173 2905999023 Bacteria 4591259
447 2929159047 2929154850 Bacteria 6753285
448 2929182517 2929177148 Bacteria 7883697
449 2945927198 2945924605 Bacteria 4296724
450 2945978442 2945977869 Bacteria 7777518
451 2946015694 2946013367 Bacteria 7766675
452 2946021547 2946019816 Bacteria 4621265
453 2977246123 2977243572 Bacteria 4374394
454 2984576021 2984572630 Bacteria 4186940
455 2984609476 2984606641 Bacteria 4186971
456 2993484122 2993480792 Bacteria 4022225
457 3003236443 3003233435 Bacteria 4458031
458 Ga0496124_0079014
459 JGI25162J39368_1000005
460 JGI25406J46586_10030426
461 rootH1_10071545
462 rootH2_10001891
463 rootH2_10043772
464 rootL2_10060107
465 rootL2_10065114
466 rootL2_10284751
467 rootL2_10367446
468 rootH1_10021842
469 rootH1_10108082
470 rootH1_10186396
471 rootH1_10253110
472 rootH1_10307374
473 JGI25160J50197_1000376
474 Ga0006562J51391_1018829
475 Ga0055536_1007819
476 Ga0065165_1000145
477 Ga0065714_10065832
478 Ga0065714_10066911
479 Ga0065714_10067184
480 Ga0065712_10006089
481 Ga0070658_10011805
482 Ga0070658_10046286
483 Ga0070658_10268090
484 Ga0070683_100055678
485 Ga0068869_100005145
486 Ga0070680_100048351
487 Ga0070682_100002913
488 Ga0068868_100025310
489 Ga0070660_100006247
490 Ga0070660_100062303
491 Ga0070689_100186538
492 Ga0070661_100130179
493 Ga0070668_100008443
494 Ga0070669_100008614
495 Ga0070669_100028225
496 Ga0070675_100002058
497 Ga0070675_100190142
498 Ga0070673_100021860
499 Ga0070688_100026789
500 Ga0070659_100015428
501 Ga0070659_100076996
502 Ga0070709_10007631
503 Ga0070714_100011414
504 Ga0070713_100000251
505 Ga0070713_100007891
506 Ga0070711_100058165
507 Ga0070708_100033733
508 Ga0070681_10087036
509 Ga0068867_100033309
510 Ga0070685_10118628
511 Ga0070698_100123006
512 Ga0070679_100003446
513 Ga0070684_100127625
514 Ga0068853_100229627
515 Ga0068853_100471915
516 Ga0070693_100024173
517 Ga0068855_100006274
518 Ga0068855_100023805
519 Ga0068855_100124110
520 Ga0068855_100374684
521 Ga0070664_100048964
522 Ga0068857_100005970
523 Ga0068857_100026557
524 Ga0068857_100035653
525 Ga0068857_100114550
526 Ga0068854_100098702
527 Ga0068856_100049618
528 Ga0068859_100090081
529 Ga0068864_100012517
530 Ga0068864_100170308
531 Ga0068861_100009873
532 Ga0068861_100080620
533 Ga0068870_10044802
534 Ga0068870_10062730
535 Ga0068858_100143647
536 Ga0068862_100027839
537 Ga0068862_100047367
538 Ga0081539_10003431
539 Ga0070717_10000372
540 Ga0070712_100010977
541 Ga0070712_100052145
542 Ga0075430_100004129
543 Ga0075431_100074491
544 Ga0075431_100147249
545 Ga0075429_100073353
546 Ga0097620_100090080
547 Ga0099824_1000204
548 Ga0079104_1001587
549 Ga0105244_10000058
550 Ga0105244_10000063
551 Ga0105240_10007171
552 Ga0105240_10243132
553 Ga0111539_10030967
554 Ga0111539_10062482
555 Ga0105241_10009442
556 Ga0105237_10000013
557 Ga0105237_10013166
558 Ga0105237_10058142
559 Ga0105238_10070407
560 Ga0105238_10204634
561 Ga0105249_10000075
562 Ga0105249_10004262
563 Ga0105239_10000609
564 Ga0105239_10004531
565 Ga0157373_10000002
566 Ga0157373_10000009
567 Ga0157373_10003582
568 Ga0157373_10004753
569 Ga0157373_10019316
570 Ga0157371_10001101
571 Ga0157371_10001777
572 Ga0157371_10003314
573 Ga0157371_10004025
574 Ga0157371_10006532
575 Ga0157371_10022641
576 Ga0157371_10056291
577 Ga0157371_10074445
578 Ga0157371_10148722
579 Ga0157370_10001332
580 Ga0157370_10001649
581 Ga0157370_10001675
582 Ga0157370_10002569
583 Ga0157370_10006311
584 Ga0157370_10025287
585 Ga0157370_10033912
586 Ga0157370_10056755
587 Ga0157370_10059434
588 Ga0157370_10066143
589 Ga0157370_10123902
590 Ga0157370_10132413
591 Ga0157369_10007435
592 Ga0157369_10015073
593 Ga0157369_10042118
594 Ga0157369_10131945
595 Ga0157374_10000455
596 Ga0163162_10000608
597 Ga0163162_10005346
598 Ga0163162_10108329
599 Ga0163162_10245132
600 Ga0157372_10010829
601 Ga0157372_10021372
602 Ga0157372_10140291
603 Ga0157372_10181653
604 Ga0157375_10000313
605 Ga0157375_10000695
606 Ga0163163_10000075
607 Ga0157380_10036583
608 Ga0157380_10162269
609 Ga0182008_10000028
610 Ga0157377_10008865
611 Ga0157376_10020537
612 Ga0182006_1000016
613 Ga0182006_1001059
614 Ga0163161_10000271
615 Ga0163161_10004631
616 Ga0163161_10004844
617 Ga0163161_10006744
618 Ga0213876_10006242
619 Ga0209437_100043
620 Ga0209675_1000033
621 Ga0209676_1000740
622 Ga0209050_1001111
623 Ga0207655_1000608
624 Ga0207655_1000693
625 Ga0207647_10109973
626 Ga0207699_10032782
627 Ga0207643_10002082
628 Ga0207705_10072796
629 Ga0207705_10110631
630 Ga0207654_10115405
631 Ga0207707_10002978
632 Ga0207671_10000024
633 Ga0207671_10078377
634 Ga0207693_10034486
635 Ga0207693_10038724
636 Ga0207660_10038298
637 Ga0207660_10072155
638 Ga0207657_10034674
639 Ga0207652_10000159
640 Ga0207652_10000166
641 Ga0207681_10003233
642 Ga0207694_10019653
643 Ga0207659_10005720
644 Ga0207659_10117012
645 Ga0207700_10010772
646 Ga0207664_10008816
647 Ga0207690_10012516
648 Ga0207690_10201411
649 Ga0207706_10032766
650 Ga0207689_10143615
651 Ga0207661_10044898
652 Ga0207667_10024111
653 Ga0207667_10043720
654 Ga0207667_10151225
655 Ga0207651_10041289
656 Ga0207712_10004795
657 Ga0207668_10057030
658 Ga0207703_10265299
659 Ga0207678_10022022
660 Ga0207678_10269642
661 Ga0207678_10273004
662 Ga0207708_10124038
663 Ga0207708_10178021
664 Ga0207702_10064532
665 Ga0207702_10087810
666 Ga0207702_10180479
667 Ga0207676_10008113
668 Ga0207674_10020855
669 Ga0207674_10040160
670 Ga0207674_10052505
671 Ga0207674_10066598
672 Ga0207675_100000597
673 Ga0207675_100021734
674 Ga0209281_1000244
675 Ga0209489_120529
676 Ga0207428_10034442
677 Ga0268265_10012717
678 Ga0268265_10013596
679 Ga0307517_10015766
680 Ga0307515_10000174
681 Ga0307511_10001867
682 Ga0316177_1134237
683 Ga0316176_1057051
684 Ga0316176_1179773
685 Ga0316183_1093843
686 Ga0316183_1116825
687 Ga0316181_1082642
688 Ga0316181_1214641
689 Ga0316182_1070171
690 Ga0265320_10053188
691 Ga0265339_10011914
692 Ga0265331_10044102
693 Ga0265316_10022745
694 Ga0265314_10032332
695 Ga0307405_10000392
696 Ga0307410_10000067
697 Ga0307410_10226129
698 Ga0307406_10000035
699 Ga0307406_10079708
700 Ga0307412_10000022
701 Ga0307412_10000451
702 Ga0307412_10048565
703 Ga0307412_10055509
704 Ga0307416_100000003
705 Ga0307416_100019284
706 Ga0307414_10000009
707 Ga0307414_10000063
708 Ga0307414_10008875
709 Ga0307414_10160240
710 Ga0307414_10236852
711 Ga0307411_10000001
712 Ga0307415_100051098
713 Ga0373926_0039099
714 Ga0373934_0033676
715 Ga0373944_0007642
716 Ga0373956_0001589
717 Ga0373957_0009427
718 Ga0373943_0007820
719 Ga0373955_0008426
720 Ga0373935_0004478
721 Ga0373937_0006520
722 Ga0373925_0009242
723 Ga0373925_0102394
724 Ga0395899_0001157
725 Ga0395899_0049940
726 Ga0395899_0052558
727 Ga0395900_0001840
728 Ga0395900_0006015
729 Ga0395900_0032537
730 Ga0395900_0051603
731 Ga0395900_0100672
732 Ga0395900_0132808
733 Ga0395900_0232798
734 Ga0395898_0000480
735 Ga0395898_0002406
736 Ga0395898_0114401
737 Ga0395905_0003208
738 Ga0395905_0014981
739 Ga0395905_0087706
740 Ga0395901_0005715
741 Ga0395901_0011060
742 Ga0395901_0020996
743 Ga0395901_0161484
744 Ga0395901_0334346
745 Ga0395901_0397495
746 Ga0436365_0301783
747 Ga0439466_0006343
748 Ga0439445_0000328
749 Ga0451577_0000001
750 Ga0466969_0000629
751 Ga0466959_0000236
752 Ga0466959_0012697
753 Ga0466967_0031358
754 Ga0495627_000002
755 Ga0495592_0060396
756 Ga0495592_0100927
757 Ga0495603_0000875
758 Ga0495629_0004622
759 Ga0495629_0079396
760 Ga0495629_0083977
761 Ga0495638_0000005
762 Ga0495651_0010749
763 Ga0495653_0014535
764 Ga0495653_0015654
765 Ga0495580_0002790
766 Ga0495582_0000646
767 Ga0495639_0000028
768 Ga0495639_0009164
769 Ga0495664_0007645
770 Ga0495606_0019712
771 Ga0495606_0021092
772 Ga0495610_0000009
773 Ga0495628_0071858
774 Ga0495628_0104270
775 Ga0495630_0000452
776 Ga0495643_0057029
777 Ga0495652_0043188
778 Ga0495654_0000001
779 Ga0495665_0001779
780 Ga0495609_0004547
781 Ga0495645_0008059
782 Ga0495645_0023980
783 Ga0495633_0001799
784 Ga0495667_0009250
785 Ga0495667_0012355
786 Ga0495668_0000639
787 Ga0495668_0007378
788 Ga0495634_0014442
789 Ga0495588_0000686
790 Ga0495599_0006014
791 Ga0495623_0022183
792 Ga0495623_0037498
793 Ga0495658_0000525
794 Ga0495613_0089041
795 Ga0495613_0096782
796 Ga0495600_0069346
797 Ga0495581_0000676
798 Ga0495581_0034750
799 Ga0495604_0006639
800 Ga0495604_0023554
801 Ga0495674_0039053
802 Ga0495674_0081033
803 Ga0495686_0000086
804 Ga0495686_0001041
805 Ga0495686_0011234
806 Ga0495593_0000015
807 Ga0495602_0044348
808 Ga0495614_0001287
809 Ga0496102_0007635
810 Ga0496113_0033785
811 Ga0496114_0000437
812 Ga0496116_0000032
813 Ga0496116_0000053
814 Ga0496117_0000089
815 Ga0496118_0000221
816 Ga0496118_0109301
817 Ga0496119_0000038
818 Ga0496122_0000465
819 Ga0496122_0000700
820 Ga0496122_0002035
821 Ga0496122_0020942
822 Ga0496123_0000930
823 Ga0496123_0006125
824 Ga0496124_0001049
825 Ga0496124_0014102
826 Ga0496125_0000059
827 Ga0496125_0000547
828 Ga0496125_0017073
829 Ga0496126_0135247
830 Ga0496126_0156224
831 Ga0501300_005309
832 Ga0501033_0083716
833 Ga0501034_0046485
834 Ga0501034_0059935
835 Ga0501037_0038929
836 Ga0501047_0121072
837 Ga0501070_0117991
838 Ga0501071_0204287
839 Ga0501073_0039574
840 Ga0501076_0253477
841 Ga0501217_008812
842 Ga0501238_000571
843 Ga0501249_000009
844 Ga0501249_001009
845 Ga0501257_014364
846 Ga0501219_000364
847 Ga0501225_0025872
848 Ga0501079_0091867
849 Ga0501080_0083336
850 Ga0501081_0044054
851 Ga0501083_0006687
852 Ga0501241_000019
853 Ga0501264_000151
854 Ga0501266_000039
855 Ga0501035_0088175
856 Ga0501035_0139711
857 Ga0501044_0051861
858 Ga0501044_0227505
859 Ga0501284_00013
860 nmdc:mga09592_11461_c1
861 nmdc:mga09592_1424_c1
862 nmdc:mga0qj67_19054_c1
863 nmdc:mga0qj67_25885_c1
864 nmdc:mga06r32_64932_c1
865 nmdc:mga08y16_18443_c1
866 Ga0495601_0063401
867 Ga0495595_0057572
868 Ga0500646_0000495
869 Ga0500641_0000019
870 Ga0500641_0000554
871 Ga0500658_0000003
872 Ga0500568_0002111
873 Ga0500616_0000003
874 Ga0500622_0000640
875 Ga0500622_0000986
876 Ga0501082_0280538
877 2511231251
878 2522551707
879 2585141490
880 2585156713
881 2585160984
882 2587677540
883 2587751251
884 2588208093
885 2588218592
886 2588219946
887 2588233374
888 2590612624
889 2729198719
890 2740057776
891 2753671096
892 2765573399
893 2772606033
894 2816873071
895 2819586434
896 2842084892
897 2842908319
898 2842908459
899 2871723884
900 2881955679
901 2889291553
902 2896317669
903 2906000173
904 2929159047
905 2929182517
906 2945927198
907 2945978442
908 2946015694
909 2946021547
910 2977246123
911 2984576021
912 2984609476
913 2993484122
914 3003236443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22366

NDH2_C

NDH2 C-terminal domain

413

471

0.96

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

67

389

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9038 9 403
3ax6-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima 0.9037 10 42
5kmq-assembly2.cif.gz_C the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9019 9 403
5kmp-assembly1.cif.gz_A the structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9001 9 403
5kmq-assembly1.cif.gz_B the structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.8994 9 403
ID Description Score Start End Superfamily
af_Q6YZ09_48_354_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9412 8 270 3.50.50.100
af_I1KLC9_45_406_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9274 7 309 3.50.50.100
af_P95200_9_428_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9257 7 413 3.50.50.100
af_I1KF65_1_317_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9229 35 314 3.50.50.100
af_Q54GF3_119_512_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.914 7 314 3.50.50.100
ID Description Score Start End GO Terms
AF-A0A519NLH7-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9893 10 387 GO:0003954
GO:0006116
AF-A0A519NLH7-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9816 10 387 GO:0003954
GO:0006116
AF-A0A7C4Y5C3-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9812 10 274 GO:0003954
GO:0006116
AF-A0A352MBF9-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.9804 9 305 GO:0003954
GO:0006116
AF-A0A4Q5WU76-F1-model_v4 NADH:ubiquinone reductase (non-electrogenic) (EC 1.6.5.9) 0.978 10 222 GO:0003954
GO:0006116

Map