F448076

General Info

Members Datasets Scaffolds Average Seq Length
457 237 457 198

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0177728|Ga0501040_0177728_674_1321
Length 215
Sequence MRRYDTQGEKSIYEERVIAINRVAKVVKGGRRFSFAALVVVGDGAGRVGLGYGKAKEVPAAIAKGVEEAKRKMFEVPMMGTTIPHQVLGEDGAGVVLLKPAAPGTGVIAGGPVRALIECAGIKDILSKSLGSSNGINIVKAAMAGLKSLKRPEDVARLRGRDVREVAPKPMLEAVTAAQERMQAARAAKLEEVYGDQAEARPDGPRRDGPPRGRR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
113 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
119 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
151 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
152 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
231 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 5.03
Rhizosphere 86.21
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000650 3300002459 Bacteria 8778
2 JGI24751J29686_10003292 3300002459 Unclassified 3252
3 Ga0070683_100265522 3300005329 Bacteria 1633
4 Ga0070670_100211244 3300005331 Bacteria 1687
5 Ga0070670_100353015 3300005331 Bacteria 1292
6 Ga0070677_10017280 3300005333 Bacteria 2581
7 Ga0070689_100600956 3300005340 Bacteria 953
8 Ga0070661_100020772 3300005344 Bacteria 4684
9 Ga0070661_100103545 3300005344 Bacteria 2120
10 Ga0070668_100034448 3300005347 Bacteria 3858
11 Ga0070669_100180100 3300005353 Bacteria 1653
12 Ga0070675_100017277 3300005354 Bacteria 5731
13 Ga0070675_100046841 3300005354 Bacteria 3542
14 Ga0070671_100145747 3300005355 Bacteria 1998
15 Ga0070674_100211113 3300005356 Bacteria 1505
16 Ga0070667_100252409 3300005367 Bacteria 1577
17 Ga0070713_100060396 3300005436 Bacteria 3169
18 Ga0070700_100037510 3300005441 Bacteria 2948
19 Ga0070700_100354742 3300005441 Bacteria 1088
20 Ga0070663_100114935 3300005455 Bacteria 2027
21 Ga0070663_100651500 3300005455 Bacteria 891
22 Ga0070681_10394276 3300005458 Bacteria 1295
23 Ga0070685_10243073 3300005466 Bacteria 1189
24 Ga0070685_10723163 3300005466 Bacteria 728
25 Ga0070706_100148861 3300005467 Bacteria 2186
26 Ga0070706_100309684 3300005467 Bacteria 1473
27 Ga0070699_100157536 3300005518 Bacteria 2009
28 Ga0070684_100032950 3300005535 Bacteria 4420
29 Ga0070672_100151494 3300005543 Bacteria 1919
30 Ga0070664_100023793 3300005564 Bacteria 5060
31 Ga0068857_100222221 3300005577 Bacteria 1725
32 Ga0068856_100052395 3300005614 Bacteria 4024
33 Ga0070702_100052749 3300005615 Bacteria 2333
34 Ga0068852_101304803 3300005616 Bacteria 747
35 Ga0068859_100935050 3300005617 Bacteria 951
36 Ga0068861_100008806 3300005719 Bacteria 6950
37 Ga0068861_100157413 3300005719 Bacteria 1870
38 Ga0068870_10000375 3300005840 Bacteria 16758
39 Ga0068863_100013521 3300005841 Bacteria 7874
40 Ga0068863_100520490 3300005841 Bacteria 1173
41 Ga0068860_100049813 3300005843 Bacteria 3988
42 Ga0068860_100080554 3300005843 Bacteria 3096
43 Ga0068860_100349414 3300005843 Bacteria 1455
44 Ga0068860_100778047 3300005843 Bacteria 970
45 Ga0068862_100053766 3300005844 Bacteria 3447
46 Ga0081455_10001246 3300005937 Bacteria 31840
47 Ga0081455_10006029 3300005937 Bacteria 13133
48 Ga0081455_10019312 3300005937 Bacteria 6452
49 Ga0081455_10073568 3300005937 Bacteria 2825
50 Ga0081455_10228915 3300005937 Bacteria 1373
51 Ga0081538_10027452 3300005981 Bacteria 3946
52 Ga0075365_10473357 3300006038 Bacteria 885
53 Ga0075365_10590500 3300006038 Bacteria 785
54 Ga0075363_100079405 3300006048 Bacteria 1792
55 Ga0075363_100417217 3300006048 Bacteria 790
56 Ga0075363_100576973 3300006048 Bacteria 672
57 Ga0075364_10069582 3300006051 Bacteria 2316
58 Ga0075364_10119664 3300006051 Bacteria 1762
59 Ga0075364_10183516 3300006051 Bacteria 1416
60 Ga0075364_10203693 3300006051 Bacteria 1341
61 Ga0075364_10699965 3300006051 Bacteria 691
62 Ga0075432_10002848 3300006058 Bacteria 5807
63 Ga0075432_10060883 3300006058 Bacteria 1344
64 Ga0075362_10068155 3300006177 Bacteria 1620
65 Ga0075367_10207925 3300006178 Bacteria 1223
66 Ga0075367_10458981 3300006178 Bacteria 807
67 Ga0075369_10085041 3300006186 Bacteria 1406
68 Ga0075366_10185048 3300006195 Bacteria 1265
69 Ga0097621_101258818 3300006237 Bacteria 698
70 Ga0075370_10277994 3300006353 Bacteria 994
71 Ga0075428_100007971 3300006844 Bacteria 11750
72 Ga0075428_100010442 3300006844 Bacteria 10313
73 Ga0075428_100050387 3300006844 Bacteria 4567
74 Ga0075428_100142831 3300006844 Bacteria 2602
75 Ga0075428_100679155 3300006844 Bacteria 1097
76 Ga0075430_100000285 3300006846 Bacteria 35539
77 Ga0075430_100004496 3300006846 Bacteria 11750
78 Ga0075430_100006208 3300006846 Bacteria 10075
79 Ga0075430_100018701 3300006846 Bacteria 5896
80 Ga0075431_100000899 3300006847 Bacteria 26201
81 Ga0075431_100014147 3300006847 Bacteria 8068
82 Ga0075431_100021761 3300006847 Bacteria 6556
83 Ga0075431_100034918 3300006847 Bacteria 5179
84 Ga0075431_100039453 3300006847 Bacteria 4864
85 Ga0075433_10051351 3300006852 Bacteria 3590
86 Ga0075433_10324294 3300006852 Bacteria 1362
87 Ga0075434_100025716 3300006871 Bacteria 5762
88 Ga0075434_100027895 3300006871 Bacteria 5543
89 Ga0075429_100000228 3300006880 Bacteria 38162
90 Ga0075429_100001166 3300006880 Bacteria 21212
91 Ga0075429_100004700 3300006880 Bacteria 11750
92 Ga0075429_100118891 3300006880 Bacteria 2309
93 Ga0075429_100127604 3300006880 Bacteria 2224
94 Ga0075429_100275140 3300006880 Bacteria 1474
95 Ga0075429_100461167 3300006880 Bacteria 1113
96 Ga0068865_100379067 3300006881 Bacteria 1153
97 Ga0097620_100493310 3300006931 Bacteria 1320
98 Ga0097620_100934962 3300006931 Bacteria 951
99 Ga0111539_10028860 3300009094 Bacteria 6766
100 Ga0111539_10036756 3300009094 Bacteria 5918
101 Ga0111539_10174198 3300009094 Bacteria 2513
102 Ga0111539_10232698 3300009094 Bacteria 2146
103 Ga0105245_10022916 3300009098 Bacteria 5479
104 Ga0105245_10511606 3300009098 Bacteria 1218
105 Ga0114129_10013234 3300009147 Bacteria 11750
106 Ga0114129_10039220 3300009147 Bacteria 6678
107 Ga0114129_10039268 3300009147 Bacteria 6674
108 Ga0114129_10156852 3300009147 Bacteria 3112
109 Ga0114129_11564087 3300009147 Bacteria 808
110 Ga0105243_10004735 3300009148 Bacteria 10703
111 Ga0105243_10006064 3300009148 Bacteria 9346
112 Ga0105243_10456296 3300009148 Bacteria 1200
113 Ga0105248_10124853 3300009177 Bacteria 2903
114 Ga0105239_10505228 3300010375 Bacteria 1374
115 Ga0157369_10288257 3300013105 Bacteria 1709
116 Ga0157374_10753677 3300013296 Bacteria 988
117 Ga0157374_10869214 3300013296 Bacteria 919
118 Ga0157378_10081782 3300013297 Bacteria 2920
119 Ga0157375_10008438 3300013308 Bacteria 9023
120 Ga0157375_10247308 3300013308 Bacteria 1944
121 Ga0157375_10634625 3300013308 Bacteria 1225
122 Ga0157375_11034862 3300013308 Bacteria 959
123 Ga0163163_10006685 3300014325 Bacteria 10104
124 Ga0163163_10031271 3300014325 Bacteria 5137
125 Ga0163163_10680232 3300014325 Bacteria 1092
126 Ga0157380_10067605 3300014326 Bacteria 2878
127 Ga0157380_11676651 3300014326 Bacteria 693
128 Ga0182008_10013172 3300014497 Bacteria 4349
129 Ga0157379_10555321 3300014968 Bacteria 1069
130 Ga0157376_10714614 3300014969 Bacteria 1008
131 Ga0163161_10016026 3300017792 Bacteria 5231
132 Ga0206350_10800340 3300020080 Bacteria 736
133 Ga0213876_10169304 3300021384 Bacteria 1162
134 Ga0224572_1022914 3300024225 Bacteria 1200
135 Ga0207642_10070001 3300025899 Bacteria 1666
136 Ga0207688_10254436 3300025901 Bacteria 1064
137 Ga0207647_10006436 3300025904 Bacteria 8538
138 Ga0207645_10094364 3300025907 Bacteria 1926
139 Ga0207643_10000118 3300025908 Bacteria 53785
140 Ga0207684_10569888 3300025910 Bacteria 968
141 Ga0207707_10129024 3300025912 Bacteria 2211
142 Ga0207707_10266805 3300025912 Bacteria 1484
143 Ga0207649_10079383 3300025920 Bacteria 2120
144 Ga0207650_10002395 3300025925 Bacteria 13056
145 Ga0207650_10345626 3300025925 Bacteria 1223
146 Ga0207650_10469253 3300025925 Bacteria 1049
147 Ga0207659_10201067 3300025926 Bacteria 1591
148 Ga0207687_10078809 3300025927 Bacteria 2373
149 Ga0207687_10374566 3300025927 Bacteria 1165
150 Ga0207687_10733796 3300025927 Bacteria 840
151 Ga0207700_10379775 3300025928 Bacteria 1235
152 Ga0207644_10113690 3300025931 Bacteria 2050
153 Ga0207709_10091647 3300025935 Bacteria 1988
154 Ga0207709_10213924 3300025935 Bacteria 1385
155 Ga0207670_10138422 3300025936 Bacteria 1793
156 Ga0207669_10491005 3300025937 Bacteria 981
157 Ga0207691_10007702 3300025940 Bacteria 10364
158 Ga0207661_10173715 3300025944 Bacteria 1877
159 Ga0207679_10003258 3300025945 Bacteria 10029
160 Ga0207668_10361787 3300025972 Bacteria 1216
161 Ga0207668_10373508 3300025972 Bacteria 1198
162 Ga0207668_10423389 3300025972 Bacteria 1131
163 Ga0207658_10180622 3300025986 Bacteria 1746
164 Ga0207658_10399100 3300025986 Bacteria 1208
165 Ga0207703_10598697 3300026035 Bacteria 1043
166 Ga0207678_10008107 3300026067 Bacteria 9264
167 Ga0207708_10030576 3300026075 Bacteria 4083
168 Ga0207708_10750454 3300026075 Bacteria 837
169 Ga0207702_10094514 3300026078 Bacteria 2624
170 Ga0207702_10183444 3300026078 Bacteria 1929
171 Ga0207641_10085368 3300026088 Bacteria 2750
172 Ga0207648_10071203 3300026089 Bacteria 3030
173 Ga0207676_10000647 3300026095 Bacteria 27890
174 Ga0207676_10150304 3300026095 Bacteria 2005
175 Ga0207676_10815698 3300026095 Bacteria 911
176 Ga0207674_10019413 3300026116 Bacteria 7361
177 Ga0207675_100006310 3300026118 Bacteria 11252
178 Ga0207675_100177243 3300026118 Bacteria 2040
179 Ga0207675_100199739 3300026118 Bacteria 1920
180 Ga0207683_10271393 3300026121 Bacteria 1549
181 Ga0207683_10838882 3300026121 Bacteria 853
182 Ga0207698_10701952 3300026142 Bacteria 1007
183 Ga0207428_10000755 3300027907 Bacteria 36919
184 Ga0207428_10029499 3300027907 Bacteria 4546
185 Ga0268265_10071252 3300028380 Bacteria 2706
186 Ga0268264_10013231 3300028381 Bacteria 6791
187 Ga0268264_10034621 3300028381 Bacteria 4156
188 Ga0268264_10036210 3300028381 Bacteria 4064
189 Ga0268264_10182181 3300028381 Bacteria 1908
190 Ga0268264_10363733 3300028381 Bacteria 1381
191 Ga0268264_10408924 3300028381 Bacteria 1306
192 Ga0307517_10200393 3300028786 Bacteria 1249
193 Ga0265338_10033562 3300028800 Bacteria 4977
194 Ga0265338_10618612 3300028800 Bacteria 753
195 Ga0265770_1013611 3300030878 Bacteria 1219
196 Ga0265760_10034268 3300031090 Bacteria 1502
197 Ga0265327_10035923 3300031251 Bacteria 2731
198 Ga0316575_10023255 3300031665 Bacteria 2395
199 Ga0316579_10044489 3300031691 Bacteria 2068
200 Ga0316576_10037669 3300031727 Bacteria 3463
201 Ga0316578_10000790 3300031728 Bacteria 11689
202 Ga0316578_10004574 3300031728 Bacteria 6556
203 Ga0316577_10050872 3300031733 Bacteria 2313
204 Ga0316577_10066828 3300031733 Bacteria 2007
205 Ga0307416_101488321 3300032002 Bacteria 783
206 Ga0316580_10007998 3300032139 Bacteria 3161
207 Ga0316593_10004257 3300032168 Bacteria 3657
208 Ga0316586_1057154 3300033527 Bacteria 705
209 Ga0316596_1002269 3300033541 Bacteria 4079
210 Ga0373948_0004143 3300034817 Bacteria 2276
211 Ga0373944_0009816 3300035089 Bacteria 2602
212 Ga0373949_0011265 3300035090 Bacteria 1968
213 Ga0373951_0040210 3300035091 Bacteria 1126
214 Ga0373941_0061372 3300035115 Bacteria 1224
215 Ga0373943_0154181 3300035170 Bacteria 1246
216 Ga0373961_0018327 3300035241 Bacteria 1827
217 Ga0373962_0014564 3300035242 Bacteria 2005
218 Ga0316574_0010480 3300035398 Bacteria 5242
219 Ga0316574_0057335 3300035398 Bacteria 2438
220 Ga0373927_0000686 3300035695 Bacteria 25824
221 Ga0316582_0068021 3300036647 Bacteria 2299
222 Ga0316584_0004117 3300036712 Bacteria 9591
223 Ga0316584_0016208 3300036712 Bacteria 5342
224 Ga0373925_0005035 3300037068 Bacteria 9915
225 Ga0395899_0047414 3300037312 Bacteria 3199
226 Ga0395900_0759476 3300037418 Bacteria 899
227 Ga0395898_0037450 3300037466 Bacteria 4811
228 Ga0395905_0025006 3300037471 Bacteria 5632
229 Ga0395905_0090297 3300037471 Bacteria 2872
230 Ga0400485_01890 3300038735 Bacteria 4701
231 Ga0400483_076338 3300039062 Bacteria 1243
232 Ga0400483_122812 3300039062 Bacteria 1939
233 Ga0400483_217638 3300039062 Bacteria 24445
234 Ga0400483_218418 3300039062 Bacteria 42144
235 Ga0436365_1863882 3300039437 Bacteria 6798
236 Ga0436365_1909981 3300039437 Bacteria 2497
237 Ga0436360_0735077 3300039438 Bacteria 673
238 Ga0436362_0092792 3300039453 Bacteria 1387
239 Ga0436362_0296838 3300039453 Bacteria 4604
240 Ga0439466_0089179 3300041411 Bacteria 968
241 Ga0451802_0458473 3300041460 Bacteria 1006
242 Ga0451807_0095516 3300041486 Bacteria 677
243 Ga0451837_0071548 3300041494 Bacteria 1420
244 Ga0451837_0714092 3300041494 Bacteria 1561
245 Ga0439448_0005269 3300042005 Bacteria 3684
246 Ga0439448_0033463 3300042005 Bacteria 1640
247 Ga0439450_067765 3300042008 Bacteria 872
248 Ga0439456_060187 3300042013 Bacteria 834
249 Ga0439463_001342 3300042016 Bacteria 6565
250 Ga0439444_0027279 3300042437 Bacteria 1050
251 Ga0439464_0000848 3300042439 Bacteria 6778
252 Ga0451577_0007199 3300042876 Bacteria 10963
253 Ga0453684_0017333 3300044712 Bacteria 11163
254 Ga0495592_0364133 3300046454 Bacteria 924
255 Ga0495603_0033810 3300046455 Bacteria 3076
256 Ga0495591_024796 3300046458 Bacteria 1893
257 Ga0495664_0214813 3300046477 Bacteria 1165
258 Ga0495584_0139862 3300046491 Bacteria 1229
259 Ga0495594_0006316 3300046499 Bacteria 6095
260 Ga0495596_0086585 3300046500 Bacteria 1216
261 Ga0495607_0190881 3300046501 Bacteria 1020
262 Ga0495628_0310808 3300046516 Bacteria 1165
263 Ga0495631_0175170 3300046518 Bacteria 919
264 Ga0495642_0089116 3300046528 Bacteria 1305
265 Ga0495587_0150847 3300046536 Bacteria 1325
266 Ga0495645_0431335 3300046543 Bacteria 835
267 Ga0495659_0022021 3300046664 Bacteria 2151
268 Ga0495658_0150496 3300046683 Bacteria 1429
269 Ga0495669_0083899 3300046684 Bacteria 1465
270 Ga0495670_0134029 3300046691 Bacteria 1292
271 Ga0495581_0476617 3300047315 Bacteria 726
272 Ga0495679_055452 3300047446 Bacteria 1177
273 Ga0495681_0116579 3300047470 Bacteria 1151
274 Ga0495614_0327784 3300048089 Bacteria 711
275 Ga0496100_0615710 3300048903 Bacteria 844
276 Ga0496102_0534751 3300048905 Bacteria 1095
277 Ga0496102_0605003 3300048905 Bacteria 1019
278 Ga0496104_0337624 3300048907 Bacteria 1420
279 Ga0496108_0009206 3300048911 Bacteria 7994
280 Ga0496108_0032489 3300048911 Bacteria 4335
281 Ga0496108_1359662 3300048911 Bacteria 595
282 Ga0496109_0010105 3300048912 Bacteria 8051
283 Ga0496109_0127108 3300048912 Bacteria 2377
284 Ga0496109_0165488 3300048912 Bacteria 2073
285 Ga0496109_0674954 3300048912 Bacteria 971
286 Ga0496110_0075013 3300048913 Bacteria 3005
287 Ga0496110_0093866 3300048913 Bacteria 2686
288 Ga0496110_0670647 3300048913 Bacteria 937
289 Ga0496111_0302296 3300048914 Bacteria 1186
290 Ga0496113_0010377 3300048916 Bacteria 6157
291 Ga0496113_0244863 3300048916 Bacteria 1431
292 Ga0496113_0572054 3300048916 Bacteria 906
293 Ga0496114_0042364 3300048917 Bacteria 3774
294 Ga0496114_0161467 3300048917 Bacteria 1949
295 Ga0496114_0329143 3300048917 Bacteria 1350
296 Ga0501031_0020256 3300049568 Bacteria 4337
297 Ga0501031_0175867 3300049568 Bacteria 1398
298 Ga0501032_0002622 3300049569 Bacteria 14061
299 Ga0501033_0007082 3300049570 Bacteria 8756
300 Ga0501033_0065847 3300049570 Bacteria 2665
301 Ga0501033_0467551 3300049570 Bacteria 875
302 Ga0501034_0003206 3300049571 Bacteria 18765
303 Ga0501034_0004900 3300049571 Bacteria 14756
304 Ga0501034_0051197 3300049571 Bacteria 4164
305 Ga0501034_0126128 3300049571 Bacteria 2545
306 Ga0501034_0821187 3300049571 Bacteria 821
307 Ga0501036_0014785 3300049572 Bacteria 6510
308 Ga0501036_0016080 3300049572 Bacteria 6252
309 Ga0501036_0043183 3300049572 Bacteria 3817
310 Ga0501036_0140310 3300049572 Bacteria 2039
311 Ga0501036_0386938 3300049572 Bacteria 1167
312 Ga0501037_0003123 3300049573 Bacteria 12009
313 Ga0501037_0277045 3300049573 Bacteria 1169
314 Ga0501038_0018247 3300049574 Bacteria 6334
315 Ga0501038_0038011 3300049574 Bacteria 4217
316 Ga0501038_0119136 3300049574 Bacteria 2179
317 Ga0501038_0171112 3300049574 Bacteria 1758
318 Ga0501038_0326395 3300049574 Bacteria 1200
319 Ga0501039_0002563 3300049575 Bacteria 13562
320 Ga0501039_0013552 3300049575 Bacteria 6235
321 Ga0501039_0178474 3300049575 Bacteria 1670
322 Ga0501040_0002053 3300049576 Bacteria 12978
323 Ga0501040_0011866 3300049576 Bacteria 5701
324 Ga0501040_0013956 3300049576 Bacteria 5290
325 Ga0501040_0031261 3300049576 Bacteria 3597
326 Ga0501040_0177728 3300049576 Bacteria 1508
327 Ga0501041_0009630 3300049577 Bacteria 5696
328 Ga0501041_0018833 3300049577 Bacteria 4111
329 Ga0501041_0025638 3300049577 Bacteria 3543
330 Ga0501041_0092489 3300049577 Bacteria 1867
331 Ga0501042_0004476 3300049578 Bacteria 8913
332 Ga0501042_0012903 3300049578 Bacteria 5675
333 Ga0501042_0013371 3300049578 Bacteria 5584
334 Ga0501042_0064752 3300049578 Bacteria 2612
335 Ga0501042_0176214 3300049578 Bacteria 1542
336 Ga0501043_0057348 3300049579 Bacteria 3059
337 Ga0501043_0066703 3300049579 Bacteria 2826
338 Ga0501043_0223516 3300049579 Bacteria 1456
339 Ga0501046_0030593 3300049580 Bacteria 4368
340 Ga0501046_0046282 3300049580 Bacteria 3453
341 Ga0501047_0144851 3300049581 Bacteria 2253
342 Ga0501047_0435056 3300049581 Bacteria 1142
343 Ga0501047_0732298 3300049581 Bacteria 805
344 Ga0501048_0004571 3300049582 Bacteria 10528
345 Ga0501048_0007798 3300049582 Bacteria 8118
346 Ga0501048_0030590 3300049582 Bacteria 3895
347 Ga0501048_0053488 3300049582 Bacteria 2871
348 Ga0501048_0367333 3300049582 Bacteria 1027
349 Ga0501067_0214756 3300049583 Bacteria 1071
350 Ga0501068_0005345 3300049584 Bacteria 7020
351 Ga0501068_0050905 3300049584 Bacteria 2505
352 Ga0501068_0053272 3300049584 Bacteria 2449
353 Ga0501068_0159931 3300049584 Bacteria 1419
354 Ga0501068_0252665 3300049584 Bacteria 1124
355 Ga0501070_0078524 3300049586 Bacteria 2731
356 Ga0501070_0151858 3300049586 Bacteria 1911
357 Ga0501071_0005915 3300049587 Bacteria 7914
358 Ga0501071_0018369 3300049587 Bacteria 4840
359 Ga0501071_0059569 3300049587 Bacteria 2762
360 Ga0501072_0000404 3300049588 Bacteria 30870
361 Ga0501072_0015537 3300049588 Bacteria 5832
362 Ga0501072_0015662 3300049588 Bacteria 5811
363 Ga0501072_0215624 3300049588 Bacteria 1530
364 Ga0501072_0645641 3300049588 Bacteria 833
365 Ga0501074_0042273 3300049590 Bacteria 3298
366 Ga0501074_0101434 3300049590 Bacteria 2060
367 Ga0501074_0312170 3300049590 Bacteria 1117
368 Ga0501075_0002249 3300049591 Bacteria 12793
369 Ga0501075_0003133 3300049591 Bacteria 11058
370 Ga0501075_0004688 3300049591 Bacteria 9283
371 Ga0501076_0002476 3300049592 Bacteria 12692
372 Ga0501076_0007602 3300049592 Bacteria 7891
373 Ga0501076_0012269 3300049592 Bacteria 6408
374 Ga0501076_0148865 3300049592 Bacteria 1904
375 Ga0501077_0006635 3300049593 Bacteria 7107
376 Ga0501077_0010895 3300049593 Bacteria 5665
377 Ga0501077_0077464 3300049593 Bacteria 2106
378 Ga0501079_0016993 3300049741 Bacteria 5557
379 Ga0501079_0017365 3300049741 Bacteria 5495
380 Ga0501079_0046905 3300049741 Bacteria 3334
381 Ga0501079_0085952 3300049741 Bacteria 2434
382 Ga0501080_0007063 3300049742 Bacteria 10140
383 Ga0501080_0084299 3300049742 Bacteria 2953
384 Ga0501080_0163200 3300049742 Bacteria 2057
385 Ga0501080_0456508 3300049742 Bacteria 1145
386 Ga0501081_0006867 3300049743 Bacteria 7402
387 Ga0501081_0112831 3300049743 Bacteria 1930
388 Ga0501081_0139545 3300049743 Bacteria 1736
389 Ga0501081_0714572 3300049743 Bacteria 752
390 Ga0501083_0060423 3300049744 Bacteria 2532
391 Ga0501035_0098363 3300049822 Bacteria 2569
392 Ga0501035_0302501 3300049822 Bacteria 1347
393 Ga0501044_0005788 3300049823 Bacteria 13687
394 Ga0501044_0007378 3300049823 Bacteria 12090
395 Ga0501044_0855362 3300049823 Bacteria 786
396 Ga0501045_0002201 3300049824 Bacteria 13214
397 Ga0501045_0012325 3300049824 Bacteria 6019
398 Ga0501045_0107879 3300049824 Bacteria 2063
399 Ga0501045_0273154 3300049824 Bacteria 1258
400 nmdc:mga00v17_33307_c1 3300050491 Bacteria 3053
401 nmdc:mga00v17_435350_c1 3300050491 Bacteria 852
402 nmdc:mga00v17_459960_c1 3300050491 Bacteria 826
403 nmdc:mga0yw44_15450_c1 3300050492 Bacteria 4091
404 nmdc:mga0yw44_281760_c1 3300050492 Bacteria 1111
405 nmdc:mga0yw44_352288_c1 3300050492 Bacteria 991
406 nmdc:mga0yw44_429563_c1 3300050492 Bacteria 895
407 nmdc:mga0k408_368863_c1 3300050493 Bacteria 855
408 nmdc:mga06z11_480615_c1 3300050494 Bacteria 752
409 nmdc:mga05p37_12934_c1 3300050507 Bacteria 9983
410 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
411 nmdc:mga05p37_17264_c1 3300050507 Bacteria 8706
412 nmdc:mga05p37_33504_c1 3300050507 Bacteria 6292
413 nmdc:mga05p37_41972_c1 3300050507 Bacteria 5619
414 nmdc:mga05p37_47080_c1 3300050507 Bacteria 5303
415 nmdc:mga09592_13664_c1 3300050508 Bacteria 6635
416 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
417 nmdc:mga09592_27861_c1 3300050508 Bacteria 4689
418 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
419 nmdc:mga0qj67_15087_c1 3300050509 Bacteria 5847
420 nmdc:mga0qj67_234918_c1 3300050509 Bacteria 1488
421 nmdc:mga0qj67_2649_c1 3300050509 Bacteria 12826
422 nmdc:mga0qj67_5012_c1 3300050509 Bacteria 9622
423 nmdc:mga0qj67_66709_c1 3300050509 Bacteria 2867
424 nmdc:mga06r32_147331_c1 3300050510 Bacteria 2332
425 nmdc:mga06r32_182281_c1 3300050510 Bacteria 2086
426 nmdc:mga06r32_32845_c1 3300050510 Bacteria 4886
427 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
428 nmdc:mga06r32_35398_c1 3300050510 Bacteria 4712
429 nmdc:mga06r32_458714_c1 3300050510 Bacteria 1254
430 nmdc:mga06r32_72641_c1 3300050510 Bacteria 3331
431 nmdc:mga08y16_145299_c1 3300050511 Bacteria 2466
432 nmdc:mga08y16_160248_c1 3300050511 Bacteria 2338
433 nmdc:mga08y16_74751_c1 3300050511 Bacteria 3532
434 nmdc:mga08y16_941816_c1 3300050511 Bacteria 847
435 nmdc:mga0n895_34981_c1 3300050512 Bacteria 4840
436 nmdc:mga0n895_35003_c1 3300050512 Bacteria 4838
437 nmdc:mga0a205_3780_c1 3300050515 Bacteria 13551
438 nmdc:mga0a205_55881_c1 3300050515 Bacteria 3812
439 Ga0495601_0664394 3300053077 Bacteria 666
440 Ga0495655_0101103 3300053083 Bacteria 854
441 Ga0500646_0046580 3300053090 Bacteria 1238
442 Ga0500562_091170 3300053108 Bacteria 827
443 Ga0500568_0000029 3300053139 Bacteria 159927
444 Ga0500616_0001847 3300053153 Bacteria 19181
445 Ga0501084_0004976 3300054114 Bacteria 10867
446 Ga0501084_0009653 3300054114 Bacteria 7984
447 Ga0501084_0072401 3300054114 Bacteria 2886
448 Ga0501084_0328882 3300054114 Bacteria 1291
449 Ga0590077_014088 3300059426 Bacteria 1664
450 Ga0501082_0015305 3300060353 Bacteria 6604
451 Ga0501082_0018922 3300060353 Bacteria 5933
452 Ga0501082_0052772 3300060353 Bacteria 3505
453 Ga0530510_0008315 3300061734 Bacteria 7237
454 Ga0530510_0010134 3300061734 Bacteria 6605
455 Ga0530510_0010398 3300061734 Bacteria 6523
456 Ga0530510_0015394 3300061734 Bacteria 5405
457 Ga0530510_0293994 3300061734 Bacteria 1215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_218418 Ga0400483_218418_12001_12573 176
2 3300005344 Ga0070661_100103545 Ga0070661_1001035454 178
3 3300005614 Ga0068856_100052395 Ga0068856_1000523954 178
4 3300009094 Ga0111539_10174198 Ga0111539_101741984 178
5 3300013105 Ga0157369_10288257 Ga0157369_102882574 178
6 3300025912 Ga0207707_10129024 Ga0207707_101290243 178
7 3300025912 Ga0207707_10266805 Ga0207707_102668053 178
8 3300026078 Ga0207702_10094514 Ga0207702_100945144 178
9 3300035089 Ga0373944_0009816 Ga0373944_0009816_582_1124 179
10 3300035170 Ga0373943_0154181 Ga0373943_0154181_35_577 179
11 3300035695 Ga0373927_0000686 Ga0373927_0000686_14307_14849 179
12 3300037068 Ga0373925_0005035 Ga0373925_0005035_7912_8454 179
13 3300005467 Ga0070706_100309684 Ga0070706_1003096842 181
14 3300020080 Ga0206350_10800340 Ga0206350_108003402 181
15 3300026078 Ga0207702_10183444 Ga0207702_101834443 181
16 3300032002 Ga0307416_101488321 Ga0307416_1014883212 181
17 3300046477 Ga0495664_0214813 Ga0495664_0214813_61_609 181
18 3300046543 Ga0495645_0431335 Ga0495645_0431335_83_631 181
19 3300053077 Ga0495601_0664394 Ga0495601_0664394_88_636 181
20 3300005436 Ga0070713_100060396 Ga0070713_1000603966 182
21 3300024225 Ga0224572_1022914 Ga0224572_10229143 182
22 3300025928 Ga0207700_10379775 Ga0207700_103797751 182
23 3300028800 Ga0265338_10618612 Ga0265338_106186122 182
24 3300030878 Ga0265770_1013611 Ga0265770_10136113 182
25 3300031090 Ga0265760_10034268 Ga0265760_100342682 182
26 3300039438 Ga0436360_0735077 Ga0436360_0735077_58_609 182
27 3300039453 Ga0436362_0092792 Ga0436362_0092792_792_1343 182
28 3300046516 Ga0495628_0310808 Ga0495628_0310808_516_1070 182
29 3300005331 Ga0070670_100353015 Ga0070670_1003530152 183
30 3300005455 Ga0070663_100651500 Ga0070663_1006515002 183
31 3300005466 Ga0070685_10723163 Ga0070685_107231631 183
32 3300005841 Ga0068863_100520490 Ga0068863_1005204902 183
33 3300005843 Ga0068860_100049813 Ga0068860_1000498133 183
34 3300006038 Ga0075365_10473357 Ga0075365_104733572 183
35 3300009098 Ga0105245_10511606 Ga0105245_105116063 183
36 3300013296 Ga0157374_10753677 Ga0157374_107536771 183
37 3300013296 Ga0157374_10869214 Ga0157374_108692142 183
38 3300013308 Ga0157375_10247308 Ga0157375_102473084 183
39 3300014326 Ga0157380_11676651 Ga0157380_116766511 183
40 3300025925 Ga0207650_10345626 Ga0207650_103456262 183
41 3300025927 Ga0207687_10374566 Ga0207687_103745663 183
42 3300026075 Ga0207708_10750454 Ga0207708_107504542 183
43 3300026121 Ga0207683_10271393 Ga0207683_102713933 183
44 3300028381 Ga0268264_10036210 Ga0268264_100362106 183
45 3300046454 Ga0495592_0364133 Ga0495592_0364133_11_568 183
46 3300046536 Ga0495587_0150847 Ga0495587_0150847_313_867 183
47 3300048905 Ga0496102_0534751 Ga0496102_0534751_159_770 183
48 3300048911 Ga0496108_1359662 Ga0496108_1359662_23_580 183
49 3300050492 nmdc:mga0yw44_352288_c1 nmdc:mga0yw44_352288_c1_350_904 183
50 3300050493 nmdc:mga0k408_368863_c1 nmdc:mga0k408_368863_c1_54_608 183
51 3300005331 Ga0070670_100211244 Ga0070670_1002112443 184
52 3300005353 Ga0070669_100180100 Ga0070669_1001801003 184
53 3300005458 Ga0070681_10394276 Ga0070681_103942762 184
54 3300005981 Ga0081538_10027452 Ga0081538_100274525 184
55 3300006038 Ga0075365_10590500 Ga0075365_105905002 184
56 3300006048 Ga0075363_100079405 Ga0075363_1000794054 184
57 3300006048 Ga0075363_100576973 Ga0075363_1005769731 184
58 3300006051 Ga0075364_10119664 Ga0075364_101196641 184
59 3300006051 Ga0075364_10183516 Ga0075364_101835162 184
60 3300006051 Ga0075364_10203693 Ga0075364_102036933 184
61 3300006051 Ga0075364_10699965 Ga0075364_106999652 184
62 3300006177 Ga0075362_10068155 Ga0075362_100681551 184
63 3300006178 Ga0075367_10458981 Ga0075367_104589812 184
64 3300006186 Ga0075369_10085041 Ga0075369_100850413 184
65 3300006237 Ga0097621_101258818 Ga0097621_1012588181 184
66 3300006844 Ga0075428_100679155 Ga0075428_1006791553 184
67 3300009094 Ga0111539_10028860 Ga0111539_100288606 184
68 3300009147 Ga0114129_11564087 Ga0114129_115640871 184
69 3300010375 Ga0105239_10505228 Ga0105239_105052282 184
70 3300013297 Ga0157378_10081782 Ga0157378_100817824 184
71 3300013308 Ga0157375_10634625 Ga0157375_106346252 184
72 3300021384 Ga0213876_10169304 Ga0213876_101693043 184
73 3300025907 Ga0207645_10094364 Ga0207645_100943643 184
74 3300025925 Ga0207650_10469253 Ga0207650_104692532 184
75 3300025937 Ga0207669_10491005 Ga0207669_104910052 184
76 3300025972 Ga0207668_10361787 Ga0207668_103617873 184
77 3300025986 Ga0207658_10399100 Ga0207658_103991003 184
78 3300026095 Ga0207676_10150304 Ga0207676_101503042 184
79 3300027907 Ga0207428_10029499 Ga0207428_1002949911 184
80 3300028381 Ga0268264_10034621 Ga0268264_100346216 184
81 3300028381 Ga0268264_10182181 Ga0268264_101821813 184
82 3300039062 Ga0400483_122812 Ga0400483_122812_274_879 184
83 3300039437 Ga0436365_1863882 Ga0436365_1863882_2789_3346 184
84 3300039437 Ga0436365_1909981 Ga0436365_1909981_995_1552 184
85 3300039453 Ga0436362_0296838 Ga0436362_0296838_488_1045 184
86 3300048905 Ga0496102_0605003 Ga0496102_0605003_102_665 184
87 3300048911 Ga0496108_0032489 Ga0496108_0032489_326_889 184
88 3300048912 Ga0496109_0127108 Ga0496109_0127108_422_982 184
89 3300048913 Ga0496110_0093866 Ga0496110_0093866_466_1029 184
90 3300048913 Ga0496110_0670647 Ga0496110_0670647_154_717 184
91 3300048916 Ga0496113_0244863 Ga0496113_0244863_397_957 184
92 3300048917 Ga0496114_0161467 Ga0496114_0161467_1348_1911 184
93 3300049583 Ga0501067_0214756 Ga0501067_0214756_37_597 184
94 3300050491 nmdc:mga00v17_33307_c1 nmdc:mga00v17_33307_c1_100_690 184
95 3300050491 nmdc:mga00v17_435350_c1 nmdc:mga00v17_435350_c1_32_622 184
96 3300050492 nmdc:mga0yw44_15450_c1 nmdc:mga0yw44_15450_c1_1010_1600 184
97 3300050492 nmdc:mga0yw44_429563_c1 nmdc:mga0yw44_429563_c1_220_810 184
98 3300050494 nmdc:mga06z11_480615_c1 nmdc:mga06z11_480615_c1_25_615 184
99 3300050507 nmdc:mga05p37_17264_c1 nmdc:mga05p37_17264_c1_392_1024 184
100 3300050509 nmdc:mga0qj67_234918_c1 nmdc:mga0qj67_234918_c1_465_1097 184
101 3300050510 nmdc:mga06r32_182281_c1 nmdc:mga06r32_182281_c1_1357_1989 184
102 3300050511 nmdc:mga08y16_160248_c1 nmdc:mga08y16_160248_c1_1161_1793 184
103 3300050511 nmdc:mga08y16_74751_c1 nmdc:mga08y16_74751_c1_665_1288 184
104 3300005355 Ga0070671_100145747 Ga0070671_1001457472 185
105 3300005367 Ga0070667_100252409 Ga0070667_1002524092 185
106 3300005843 Ga0068860_100349414 Ga0068860_1003494143 185
107 3300005843 Ga0068860_100778047 Ga0068860_1007780472 185
108 3300005937 Ga0081455_10006029 Ga0081455_1000602918 185
109 3300006048 Ga0075363_100417217 Ga0075363_1004172171 185
110 3300006353 Ga0075370_10277994 Ga0075370_102779941 185
111 3300006844 Ga0075428_100007971 Ga0075428_10000797110 185
112 3300006846 Ga0075430_100004496 Ga0075430_10000449610 185
113 3300006847 Ga0075431_100014147 Ga0075431_10001414712 185
114 3300006880 Ga0075429_100004700 Ga0075429_10000470010 185
115 3300006880 Ga0075429_100461167 Ga0075429_1004611671 185
116 3300009147 Ga0114129_10013234 Ga0114129_1001323411 185
117 3300013308 Ga0157375_11034862 Ga0157375_110348622 185
118 3300014497 Ga0182008_10013172 Ga0182008_1001317211 185
119 3300025927 Ga0207687_10078809 Ga0207687_100788092 185
120 3300025931 Ga0207644_10113690 Ga0207644_101136904 185
121 3300025986 Ga0207658_10180622 Ga0207658_101806223 185
122 3300026035 Ga0207703_10598697 Ga0207703_105986972 185
123 3300026095 Ga0207676_10815698 Ga0207676_108156982 185
124 3300028381 Ga0268264_10363733 Ga0268264_103637333 185
125 3300028786 Ga0307517_10200393 Ga0307517_102003932 185
126 3300028800 Ga0265338_10033562 Ga0265338_100335626 185
127 3300031251 Ga0265327_10035923 Ga0265327_100359233 185
128 3300041460 Ga0451802_0458473 Ga0451802_0458473_30_593 185
129 3300041494 Ga0451837_0071548 Ga0451837_0071548_106_669 185
130 3300046683 Ga0495658_0150496 Ga0495658_0150496_397_960 185
131 3300047315 Ga0495581_0476617 Ga0495581_0476617_151_714 185
132 3300048089 Ga0495614_0327784 Ga0495614_0327784_124_687 185
133 3300048903 Ga0496100_0615710 Ga0496100_0615710_52_615 185
134 3300048912 Ga0496109_0674954 Ga0496109_0674954_254_817 185
135 3300048916 Ga0496113_0572054 Ga0496113_0572054_151_714 185
136 3300049571 Ga0501034_0004900 Ga0501034_0004900_14171_14734 185
137 3300049571 Ga0501034_0821187 Ga0501034_0821187_222_785 185
138 3300049572 Ga0501036_0386938 Ga0501036_0386938_440_997 185
139 3300049575 Ga0501039_0178474 Ga0501039_0178474_436_993 185
140 3300049588 Ga0501072_0645641 Ga0501072_0645641_58_615 185
141 3300049742 Ga0501080_0456508 Ga0501080_0456508_105_662 185
142 3300049743 Ga0501081_0714572 Ga0501081_0714572_17_574 185
143 3300050507 nmdc:mga05p37_171_c1 nmdc:mga05p37_171_c1_45330_45959 185
144 3300050508 nmdc:mga09592_565_c1 nmdc:mga09592_565_c1_15845_16474 185
145 3300050509 nmdc:mga0qj67_2649_c1 nmdc:mga0qj67_2649_c1_9035_9664 185
146 3300050510 nmdc:mga06r32_32845_c1 nmdc:mga06r32_32845_c1_3365_3994 185
147 3300050510 nmdc:mga06r32_458714_c1 nmdc:mga06r32_458714_c1_98_727 185
148 3300059426 Ga0590077_014088 Ga0590077_014088_433_1056 185
149 3300061734 Ga0530510_0015394 Ga0530510_0015394_1676_2233 185
150 3300005616 Ga0068852_101304803 Ga0068852_1013048031 186
151 3300005719 Ga0068861_100008806 Ga0068861_1000088064 186
152 3300006051 Ga0075364_10069582 Ga0075364_100695824 186
153 3300006178 Ga0075367_10207925 Ga0075367_102079253 186
154 3300006195 Ga0075366_10185048 Ga0075366_101850483 186
155 3300006852 Ga0075433_10324294 Ga0075433_103242942 186
156 3300014325 Ga0163163_10680232 Ga0163163_106802322 186
157 3300025899 Ga0207642_10070001 Ga0207642_100700013 186
158 3300026118 Ga0207675_100006310 Ga0207675_1000063103 186
159 3300026142 Ga0207698_10701952 Ga0207698_107019522 186
160 3300038735 Ga0400485_01890 Ga0400485_01890_4009_4578 186
161 3300039062 Ga0400483_076338 Ga0400483_076338_594_1187 186
162 3300039062 Ga0400483_217638 Ga0400483_217638_9280_9873 186
163 3300041494 Ga0451837_0714092 Ga0451837_0714092_574_1140 186
164 3300042876 Ga0451577_0007199 Ga0451577_0007199_3727_4329 186
165 3300044712 Ga0453684_0017333 Ga0453684_0017333_3205_3807 186
166 3300048907 Ga0496104_0337624 Ga0496104_0337624_11_604 186
167 3300048914 Ga0496111_0302296 Ga0496111_0302296_394_987 186
168 3300048917 Ga0496114_0329143 Ga0496114_0329143_231_824 186
169 3300049569 Ga0501032_0002622 Ga0501032_0002622_5103_5669 186
170 3300049570 Ga0501033_0467551 Ga0501033_0467551_141_707 186
171 3300049571 Ga0501034_0003206 Ga0501034_0003206_12264_12830 186
172 3300049571 Ga0501034_0126128 Ga0501034_0126128_1454_2020 186
173 3300049572 Ga0501036_0140310 Ga0501036_0140310_597_1163 186
174 3300049573 Ga0501037_0003123 Ga0501037_0003123_4206_4772 186
175 3300049574 Ga0501038_0326395 Ga0501038_0326395_222_788 186
176 3300049579 Ga0501043_0066703 Ga0501043_0066703_1739_2305 186
177 3300049581 Ga0501047_0435056 Ga0501047_0435056_121_687 186
178 3300049584 Ga0501068_0159931 Ga0501068_0159931_102_701 186
179 3300049584 Ga0501068_0252665 Ga0501068_0252665_379_945 186
180 3300049586 Ga0501070_0078524 Ga0501070_0078524_1992_2558 186
181 3300049742 Ga0501080_0007063 Ga0501080_0007063_2308_2874 186
182 3300049822 Ga0501035_0302501 Ga0501035_0302501_293_859 186
183 3300049823 Ga0501044_0005788 Ga0501044_0005788_8915_9481 186
184 3300049823 Ga0501044_0855362 Ga0501044_0855362_193_759 186
185 3300050491 nmdc:mga00v17_459960_c1 nmdc:mga00v17_459960_c1_63_656 186
186 3300053090 Ga0500646_0046580 Ga0500646_0046580_56_673 186
187 3300053139 Ga0500568_0000029 Ga0500568_0000029_78642_79280 186
188 3300026118 Ga0207675_100177243 Ga0207675_1001772434 187
189 3300033527 Ga0316586_1057154 Ga0316586_10571541 187
190 3300037471 Ga0395905_0090297 Ga0395905_0090297_983_1552 187
191 3300041411 Ga0439466_0089179 Ga0439466_0089179_356_949 187
192 3300041486 Ga0451807_0095516 Ga0451807_0095516_42_638 187
193 3300049568 Ga0501031_0020256 Ga0501031_0020256_1181_1828 187
194 3300049572 Ga0501036_0043183 Ga0501036_0043183_870_1517 187
195 3300049574 Ga0501038_0171112 Ga0501038_0171112_784_1431 187
196 3300049575 Ga0501039_0002563 Ga0501039_0002563_3059_3706 187
197 3300049576 Ga0501040_0002053 Ga0501040_0002053_9588_10235 187
198 3300049577 Ga0501041_0092489 Ga0501041_0092489_784_1431 187
199 3300049578 Ga0501042_0176214 Ga0501042_0176214_553_1200 187
200 3300049579 Ga0501043_0223516 Ga0501043_0223516_323_970 187
201 3300049580 Ga0501046_0046282 Ga0501046_0046282_1078_1725 187
202 3300049581 Ga0501047_0144851 Ga0501047_0144851_1169_1744 187
203 3300049581 Ga0501047_0732298 Ga0501047_0732298_79_648 187
204 3300049582 Ga0501048_0030590 Ga0501048_0030590_1558_2205 187
205 3300049584 Ga0501068_0005345 Ga0501068_0005345_4114_4761 187
206 3300049587 Ga0501071_0059569 Ga0501071_0059569_1616_2263 187
207 3300049588 Ga0501072_0000404 Ga0501072_0000404_21129_21773 187
208 3300049590 Ga0501074_0042273 Ga0501074_0042273_1768_2415 187
209 3300049591 Ga0501075_0003133 Ga0501075_0003133_5299_5946 187
210 3300049592 Ga0501076_0002476 Ga0501076_0002476_543_1190 187
211 3300049593 Ga0501077_0010895 Ga0501077_0010895_3666_4313 187
212 3300049741 Ga0501079_0085952 Ga0501079_0085952_1629_2276 187
213 3300049744 Ga0501083_0060423 Ga0501083_0060423_1666_2313 187
214 3300049823 Ga0501044_0007378 Ga0501044_0007378_9326_9901 187
215 3300049824 Ga0501045_0012325 Ga0501045_0012325_842_1489 187
216 3300050511 nmdc:mga08y16_941816_c1 nmdc:mga08y16_941816_c1_167_730 187
217 3300054114 Ga0501084_0072401 Ga0501084_0072401_1688_2335 187
218 3300060353 Ga0501082_0052772 Ga0501082_0052772_1353_2000 187
219 3300061734 Ga0530510_0008315 Ga0530510_0008315_1614_2261 187
220 3300006931 Ga0097620_100493310 Ga0097620_1004933101 188
221 3300025972 Ga0207668_10423389 Ga0207668_104233892 188
222 3300035398 Ga0316574_0057335 Ga0316574_0057335_174_794 188
223 3300036712 Ga0316584_0004117 Ga0316584_0004117_1111_1731 188
224 3300042013 Ga0439456_060187 Ga0439456_060187_100_723 188
225 3300049571 Ga0501034_0051197 Ga0501034_0051197_263_835 188
226 3300050492 nmdc:mga0yw44_281760_c1 nmdc:mga0yw44_281760_c1_306_890 188
227 3300053153 Ga0500616_0001847 Ga0500616_0001847_14610_15221 188
228 3300026089 Ga0207648_10071203 Ga0207648_100712033 189
229 3300005333 Ga0070677_10017280 Ga0070677_100172804 190
230 3300005347 Ga0070668_100034448 Ga0070668_1000344483 190
231 3300005356 Ga0070674_100211113 Ga0070674_1002111132 190
232 3300005543 Ga0070672_100151494 Ga0070672_1001514944 190
233 3300005615 Ga0070702_100052749 Ga0070702_1000527492 190
234 3300005937 Ga0081455_10001246 Ga0081455_1000124613 190
235 3300006844 Ga0075428_100050387 Ga0075428_1000503872 190
236 3300006846 Ga0075430_100006208 Ga0075430_10000620813 190
237 3300006847 Ga0075431_100039453 Ga0075431_10003945310 190
238 3300006880 Ga0075429_100001166 Ga0075429_10000116621 190
239 3300006880 Ga0075429_100275140 Ga0075429_1002751402 190
240 3300009147 Ga0114129_10039268 Ga0114129_100392684 190
241 3300009147 Ga0114129_10156852 Ga0114129_101568522 190
242 3300009148 Ga0105243_10006064 Ga0105243_1000606415 190
243 3300009177 Ga0105248_10124853 Ga0105248_101248531 190
244 3300013308 Ga0157375_10008438 Ga0157375_100084387 190
245 3300014325 Ga0163163_10031271 Ga0163163_100312714 190
246 3300014326 Ga0157380_10067605 Ga0157380_100676052 190
247 3300014969 Ga0157376_10714614 Ga0157376_107146142 190
248 3300017792 Ga0163161_10016026 Ga0163161_1001602612 190
249 3300025901 Ga0207688_10254436 Ga0207688_102544362 190
250 3300025935 Ga0207709_10091647 Ga0207709_100916473 190
251 3300025940 Ga0207691_10007702 Ga0207691_100077024 190
252 3300042005 Ga0439448_0005269 Ga0439448_0005269_1034_1663 190
253 3300042016 Ga0439463_001342 Ga0439463_001342_1704_2333 190
254 3300042437 Ga0439444_0027279 Ga0439444_0027279_184_813 190
255 3300042439 Ga0439464_0000848 Ga0439464_0000848_2351_2980 190
256 3300046455 Ga0495603_0033810 Ga0495603_0033810_1294_1995 190
257 3300048917 Ga0496114_0042364 Ga0496114_0042364_2889_3590 190
258 3300049570 Ga0501033_0007082 Ga0501033_0007082_3723_4352 190
259 3300049572 Ga0501036_0016080 Ga0501036_0016080_4855_5484 190
260 3300049573 Ga0501037_0277045 Ga0501037_0277045_215_844 190
261 3300049574 Ga0501038_0038011 Ga0501038_0038011_2581_3210 190
262 3300049576 Ga0501040_0011866 Ga0501040_0011866_959_1588 190
263 3300049577 Ga0501041_0018833 Ga0501041_0018833_1546_2175 190
264 3300049578 Ga0501042_0013371 Ga0501042_0013371_1374_2003 190
265 3300049579 Ga0501043_0057348 Ga0501043_0057348_770_1399 190
266 3300049580 Ga0501046_0030593 Ga0501046_0030593_380_1009 190
267 3300049582 Ga0501048_0004571 Ga0501048_0004571_8042_8671 190
268 3300049584 Ga0501068_0050905 Ga0501068_0050905_1286_1915 190
269 3300049586 Ga0501070_0151858 Ga0501070_0151858_403_1032 190
270 3300049587 Ga0501071_0005915 Ga0501071_0005915_3099_3728 190
271 3300049588 Ga0501072_0015662 Ga0501072_0015662_4792_5421 190
272 3300049591 Ga0501075_0004688 Ga0501075_0004688_5817_6446 190
273 3300049592 Ga0501076_0007602 Ga0501076_0007602_4638_5267 190
274 3300049593 Ga0501077_0006635 Ga0501077_0006635_5276_5905 190
275 3300049741 Ga0501079_0017365 Ga0501079_0017365_2921_3550 190
276 3300049743 Ga0501081_0006867 Ga0501081_0006867_5006_5635 190
277 3300049824 Ga0501045_0002201 Ga0501045_0002201_7838_8467 190
278 3300050507 nmdc:mga05p37_47080_c1 nmdc:mga05p37_47080_c1_2008_2727 190
279 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_24317_25036 190
280 3300050508 nmdc:mga09592_27861_c1 nmdc:mga09592_27861_c1_722_1351 190
281 3300050509 nmdc:mga0qj67_5012_c1 nmdc:mga0qj67_5012_c1_3828_4547 190
282 3300050510 nmdc:mga06r32_342_c1 nmdc:mga06r32_342_c1_36040_36759 190
283 3300050510 nmdc:mga06r32_72641_c1 nmdc:mga06r32_72641_c1_2429_3058 190
284 3300053083 Ga0495655_0101103 Ga0495655_0101103_50_751 190
285 3300053108 Ga0500562_091170 Ga0500562_091170_125_730 190
286 3300054114 Ga0501084_0004976 Ga0501084_0004976_3790_4419 190
287 3300060353 Ga0501082_0018922 Ga0501082_0018922_1660_2289 190
288 3300061734 Ga0530510_0010398 Ga0530510_0010398_3916_4545 190
289 3300031665 Ga0316575_10023255 Ga0316575_100232553 192
290 3300031691 Ga0316579_10044489 Ga0316579_100444893 192
291 3300031727 Ga0316576_10037669 Ga0316576_100376696 192
292 3300031728 Ga0316578_10000790 Ga0316578_1000079017 192
293 3300031728 Ga0316578_10004574 Ga0316578_1000457412 192
294 3300031733 Ga0316577_10050872 Ga0316577_100508723 192
295 3300031733 Ga0316577_10066828 Ga0316577_100668281 192
296 3300032139 Ga0316580_10007998 Ga0316580_100079986 192
297 3300032168 Ga0316593_10004257 Ga0316593_100042574 192
298 3300033541 Ga0316596_1002269 Ga0316596_10022694 192
299 3300035398 Ga0316574_0010480 Ga0316574_0010480_438_1073 192
300 3300036647 Ga0316582_0068021 Ga0316582_0068021_650_1285 192
301 3300036712 Ga0316584_0016208 Ga0316584_0016208_4525_5160 192
302 3300049572 Ga0501036_0014785 Ga0501036_0014785_1434_2030 192
303 3300049574 Ga0501038_0119136 Ga0501038_0119136_1115_1711 192
304 3300049577 Ga0501041_0025638 Ga0501041_0025638_1374_1970 192
305 3300049578 Ga0501042_0012903 Ga0501042_0012903_2854_3450 192
306 3300049582 Ga0501048_0053488 Ga0501048_0053488_1388_1984 192
307 3300049590 Ga0501074_0312170 Ga0501074_0312170_285_881 192
308 3300049742 Ga0501080_0084299 Ga0501080_0084299_1906_2502 192
309 3300049743 Ga0501081_0112831 Ga0501081_0112831_336_932 192
310 3300049822 Ga0501035_0098363 Ga0501035_0098363_738_1334 192
311 3300005466 Ga0070685_10243073 Ga0070685_102430733 206
312 3300005617 Ga0068859_100935050 Ga0068859_1009350501 206
313 3300006931 Ga0097620_100934962 Ga0097620_1009349621 206
314 3300025936 Ga0207670_10138422 Ga0207670_101384222 206
315 3300026121 Ga0207683_10838882 Ga0207683_108388822 206
316 3300046499 Ga0495594_0006316 Ga0495594_0006316_3296_3928 206
317 3300048912 Ga0496109_0165488 Ga0496109_0165488_903_1535 206
318 3300002459 JGI24751J29686_10000650 JGI24751J29686_1000065011 207
319 3300002459 JGI24751J29686_10003292 JGI24751J29686_100032926 207
320 3300005329 Ga0070683_100265522 Ga0070683_1002655222 207
321 3300005340 Ga0070689_100600956 Ga0070689_1006009562 207
322 3300005344 Ga0070661_100020772 Ga0070661_10002077211 207
323 3300005354 Ga0070675_100017277 Ga0070675_1000172777 207
324 3300005354 Ga0070675_100046841 Ga0070675_1000468416 207
325 3300005441 Ga0070700_100037510 Ga0070700_1000375102 207
326 3300005441 Ga0070700_100354742 Ga0070700_1003547421 207
327 3300005455 Ga0070663_100114935 Ga0070663_1001149351 207
328 3300005467 Ga0070706_100148861 Ga0070706_1001488611 207
329 3300005518 Ga0070699_100157536 Ga0070699_1001575363 207
330 3300005535 Ga0070684_100032950 Ga0070684_1000329503 207
331 3300005564 Ga0070664_100023793 Ga0070664_1000237933 207
332 3300005577 Ga0068857_100222221 Ga0068857_1002222214 207
333 3300005719 Ga0068861_100157413 Ga0068861_1001574133 207
334 3300005840 Ga0068870_10000375 Ga0068870_1000037524 207
335 3300005841 Ga0068863_100013521 Ga0068863_10001352112 207
336 3300005843 Ga0068860_100080554 Ga0068860_1000805544 207
337 3300005844 Ga0068862_100053766 Ga0068862_1000537668 207
338 3300005937 Ga0081455_10019312 Ga0081455_1001931211 207
339 3300005937 Ga0081455_10073568 Ga0081455_100735684 207
340 3300005937 Ga0081455_10228915 Ga0081455_102289153 207
341 3300006058 Ga0075432_10002848 Ga0075432_100028486 207
342 3300006058 Ga0075432_10060883 Ga0075432_100608833 207
343 3300006844 Ga0075428_100010442 Ga0075428_1000104424 207
344 3300006844 Ga0075428_100142831 Ga0075428_1001428312 207
345 3300006846 Ga0075430_100000285 Ga0075430_10000028534 207
346 3300006846 Ga0075430_100018701 Ga0075430_1000187016 207
347 3300006847 Ga0075431_100000899 Ga0075431_10000089924 207
348 3300006847 Ga0075431_100021761 Ga0075431_1000217619 207
349 3300006847 Ga0075431_100034918 Ga0075431_1000349184 207
350 3300006852 Ga0075433_10051351 Ga0075433_100513514 207
351 3300006871 Ga0075434_100025716 Ga0075434_1000257168 207
352 3300006871 Ga0075434_100027895 Ga0075434_10002789510 207
353 3300006880 Ga0075429_100000228 Ga0075429_10000022814 207
354 3300006880 Ga0075429_100118891 Ga0075429_1001188912 207
355 3300006880 Ga0075429_100127604 Ga0075429_1001276045 207
356 3300006881 Ga0068865_100379067 Ga0068865_1003790672 207
357 3300009094 Ga0111539_10036756 Ga0111539_100367566 207
358 3300009094 Ga0111539_10232698 Ga0111539_102326982 207
359 3300009098 Ga0105245_10022916 Ga0105245_100229165 207
360 3300009147 Ga0114129_10039220 Ga0114129_100392204 207
361 3300009148 Ga0105243_10004735 Ga0105243_100047355 207
362 3300009148 Ga0105243_10456296 Ga0105243_104562963 207
363 3300014325 Ga0163163_10006685 Ga0163163_100066859 207
364 3300014968 Ga0157379_10555321 Ga0157379_105553212 207
365 3300025904 Ga0207647_10006436 Ga0207647_1000643612 207
366 3300025908 Ga0207643_10000118 Ga0207643_1000011865 207
367 3300025910 Ga0207684_10569888 Ga0207684_105698882 207
368 3300025920 Ga0207649_10079383 Ga0207649_100793832 207
369 3300025925 Ga0207650_10002395 Ga0207650_1000239521 207
370 3300025926 Ga0207659_10201067 Ga0207659_102010673 207
371 3300025927 Ga0207687_10733796 Ga0207687_107337961 207
372 3300025935 Ga0207709_10213924 Ga0207709_102139243 207
373 3300025944 Ga0207661_10173715 Ga0207661_101737152 207
374 3300025945 Ga0207679_10003258 Ga0207679_100032589 207
375 3300025972 Ga0207668_10373508 Ga0207668_103735081 207
376 3300026067 Ga0207678_10008107 Ga0207678_1000810711 207
377 3300026075 Ga0207708_10030576 Ga0207708_100305763 207
378 3300026088 Ga0207641_10085368 Ga0207641_100853684 207
379 3300026095 Ga0207676_10000647 Ga0207676_1000064713 207
380 3300026116 Ga0207674_10019413 Ga0207674_1001941311 207
381 3300026118 Ga0207675_100199739 Ga0207675_1001997393 207
382 3300027907 Ga0207428_10000755 Ga0207428_1000075510 207
383 3300028380 Ga0268265_10071252 Ga0268265_100712524 207
384 3300028381 Ga0268264_10013231 Ga0268264_1001323115 207
385 3300028381 Ga0268264_10408924 Ga0268264_104089243 207
386 3300034817 Ga0373948_0004143 Ga0373948_0004143_1024_1647 207
387 3300035090 Ga0373949_0011265 Ga0373949_0011265_1194_1817 207
388 3300035091 Ga0373951_0040210 Ga0373951_0040210_262_885 207
389 3300035115 Ga0373941_0061372 Ga0373941_0061372_135_758 207
390 3300035241 Ga0373961_0018327 Ga0373961_0018327_503_1126 207
391 3300035242 Ga0373962_0014564 Ga0373962_0014564_1083_1706 207
392 3300037312 Ga0395899_0047414 Ga0395899_0047414_1549_2181 207
393 3300037418 Ga0395900_0759476 Ga0395900_0759476_112_738 207
394 3300037466 Ga0395898_0037450 Ga0395898_0037450_1937_2569 207
395 3300037471 Ga0395905_0025006 Ga0395905_0025006_2860_3492 207
396 3300042005 Ga0439448_0033463 Ga0439448_0033463_963_1589 207
397 3300042008 Ga0439450_067765 Ga0439450_067765_38_664 207
398 3300046458 Ga0495591_024796 Ga0495591_024796_671_1297 207
399 3300046491 Ga0495584_0139862 Ga0495584_0139862_358_984 207
400 3300046500 Ga0495596_0086585 Ga0495596_0086585_263_886 207
401 3300046501 Ga0495607_0190881 Ga0495607_0190881_307_933 207
402 3300046518 Ga0495631_0175170 Ga0495631_0175170_85_711 207
403 3300046528 Ga0495642_0089116 Ga0495642_0089116_483_1109 207
404 3300046664 Ga0495659_0022021 Ga0495659_0022021_1288_1914 207
405 3300046684 Ga0495669_0083899 Ga0495669_0083899_217_840 207
406 3300046691 Ga0495670_0134029 Ga0495670_0134029_347_973 207
407 3300047446 Ga0495679_055452 Ga0495679_055452_121_753 207
408 3300047470 Ga0495681_0116579 Ga0495681_0116579_237_863 207
409 3300048911 Ga0496108_0009206 Ga0496108_0009206_6835_7458 207
410 3300048912 Ga0496109_0010105 Ga0496109_0010105_3931_4554 207
411 3300048913 Ga0496110_0075013 Ga0496110_0075013_864_1487 207
412 3300048916 Ga0496113_0010377 Ga0496113_0010377_5237_5860 207
413 3300049568 Ga0501031_0175867 Ga0501031_0175867_270_911 207
414 3300049570 Ga0501033_0065847 Ga0501033_0065847_316_957 207
415 3300049574 Ga0501038_0018247 Ga0501038_0018247_4837_5478 207
416 3300049575 Ga0501039_0013552 Ga0501039_0013552_1231_1872 207
417 3300049576 Ga0501040_0013956 Ga0501040_0013956_2909_3550 207
418 3300049576 Ga0501040_0031261 Ga0501040_0031261_1417_2055 207
419 3300049576 Ga0501040_0177728 Ga0501040_0177728_674_1321 207
420 3300049577 Ga0501041_0009630 Ga0501041_0009630_2095_2736 207
421 3300049578 Ga0501042_0004476 Ga0501042_0004476_1774_2415 207
422 3300049578 Ga0501042_0064752 Ga0501042_0064752_962_1600 207
423 3300049582 Ga0501048_0007798 Ga0501048_0007798_1796_2437 207
424 3300049582 Ga0501048_0367333 Ga0501048_0367333_66_710 207
425 3300049584 Ga0501068_0053272 Ga0501068_0053272_1698_2327 207
426 3300049587 Ga0501071_0018369 Ga0501071_0018369_4125_4766 207
427 3300049588 Ga0501072_0015537 Ga0501072_0015537_3944_4585 207
428 3300049588 Ga0501072_0215624 Ga0501072_0215624_237_875 207
429 3300049590 Ga0501074_0101434 Ga0501074_0101434_1358_1999 207
430 3300049591 Ga0501075_0002249 Ga0501075_0002249_10189_10830 207
431 3300049592 Ga0501076_0012269 Ga0501076_0012269_4555_5196 207
432 3300049592 Ga0501076_0148865 Ga0501076_0148865_1105_1749 207
433 3300049593 Ga0501077_0077464 Ga0501077_0077464_1083_1724 207
434 3300049741 Ga0501079_0016993 Ga0501079_0016993_3875_4516 207
435 3300049741 Ga0501079_0046905 Ga0501079_0046905_617_1264 207
436 3300049742 Ga0501080_0163200 Ga0501080_0163200_675_1316 207
437 3300049743 Ga0501081_0139545 Ga0501081_0139545_246_887 207
438 3300049824 Ga0501045_0107879 Ga0501045_0107879_798_1439 207
439 3300049824 Ga0501045_0273154 Ga0501045_0273154_152_799 207
440 3300050507 nmdc:mga05p37_12934_c1 nmdc:mga05p37_12934_c1_3349_3975 207
441 3300050507 nmdc:mga05p37_33504_c1 nmdc:mga05p37_33504_c1_3753_4382 207
442 3300050507 nmdc:mga05p37_41972_c1 nmdc:mga05p37_41972_c1_1744_2373 207
443 3300050508 nmdc:mga09592_13664_c1 nmdc:mga09592_13664_c1_5455_6084 207
444 3300050509 nmdc:mga0qj67_15087_c1 nmdc:mga0qj67_15087_c1_1203_1832 207
445 3300050509 nmdc:mga0qj67_66709_c1 nmdc:mga0qj67_66709_c1_1902_2528 207
446 3300050510 nmdc:mga06r32_147331_c1 nmdc:mga06r32_147331_c1_503_1132 207
447 3300050510 nmdc:mga06r32_35398_c1 nmdc:mga06r32_35398_c1_1536_2162 207
448 3300050511 nmdc:mga08y16_145299_c1 nmdc:mga08y16_145299_c1_1380_2006 207
449 3300050512 nmdc:mga0n895_34981_c1 nmdc:mga0n895_34981_c1_1536_2162 207
450 3300050512 nmdc:mga0n895_35003_c1 nmdc:mga0n895_35003_c1_433_1062 207
451 3300050515 nmdc:mga0a205_3780_c1 nmdc:mga0a205_3780_c1_8367_8996 207
452 3300050515 nmdc:mga0a205_55881_c1 nmdc:mga0a205_55881_c1_1380_2006 207
453 3300054114 Ga0501084_0009653 Ga0501084_0009653_3335_3976 207
454 3300054114 Ga0501084_0328882 Ga0501084_0328882_467_1096 207
455 3300060353 Ga0501082_0015305 Ga0501082_0015305_505_1146 207
456 3300061734 Ga0530510_0010134 Ga0530510_0010134_5162_5803 207
457 3300061734 Ga0530510_0293994 Ga0530510_0293994_187_816 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

13

77

0.98

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

89

159

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zto-assembly1.cif.gz_AE e. coli 70s-rnap expressome complex in uncoupled state 1 0.9775 13 167
8byv-assembly1.cif.gz_e cryo-em structure of a staphylococus aureus 30s-rbfa complex 0.9755 13 165
8buu-assembly1.cif.gz_e are-abcf vmlr2 bound to a 70s ribosome 0.9751 13 165
5u4j-assembly1.cif.gz_e structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.9736 13 146
7p7t-assembly1.cif.gz_f poxta-eq2 antibiotic resistance abcf bound to e. faecalis 70s ribosome, state iii 0.9718 13 167
ID Description Score Start End Superfamily
af_A0A146M1R1_669_734_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9799 12 72 3.30.160.20
af_Q25815_90_159_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9683 12 74 3.30.160.20
af_C0PEC4_230_319_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9671 81 167 3.30.230.10
af_Q93425_147_216_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9627 12 74 3.30.160.20
af_Q6GKU7_423_512_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9563 85 161 3.30.230.10
ID Description Score Start End GO Terms
AF-F0SY25-F1-model_v4 Small ribosomal subunit protein uS5 0.9825 13 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A6L7VTK8-F1-model_v4 Small ribosomal subunit protein uS5 0.9796 11 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1J5CYC8-F1-model_v4 Small ribosomal subunit protein uS5 0.9794 14 166 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A0C1ZXE4-F1-model_v4 Small ribosomal subunit protein uS5 0.9786 14 165 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A3G2FN95-F1-model_v4 deleted 0.9785 13 166

Feature Viewer

pLDDT pTM Quality
82.49 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map