F448084

General Info

Members Datasets Scaffolds Average Seq Length
457 280 914 379

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0043172|Ga0495601_0043172_262_1599
Length 437
Sequence VSPLEDTPRVAGQAAVAGRQAQQGNMRSLDQLDVLGKRVLVRVDFNVPLKKGQDGAIEVADDTRIVQALPTIEELRARGARLVLVSHLGRPEGRPEADLSLAPVVARLRELIDVVGASARALAHRLAYGEVLVLENVRFMPGETTNDPELARALAELADVYVNDAFGAAHRAHASTAGVAHLLPCAAGRLLEREVKTLTGILEHPERPLVAVIGGAKVADKIAVIDRFLAIADAVVIGGAMCFPFLAAQGHEVGDSLCDAEDVEHARALFVQAALPHKARLELPVDLVIGDRLAADAEHRVLGSQPGGRAGQAGEQTGLDVPEGWMGLDIGPATAERYAQLVENAGTVFWNGPMGAFELEPFAGGTRRVARAVAGAKGVTVVGGGDSAAALVHFGMEGSVDHLSTGGGATLELVEGRMLPGVQALETPSGVQVAGGA

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 2547132424 Nocardia nova SH22a Isolate Unclassified
268 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
269 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
270 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
271 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
272 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
273 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
274 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
275 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
276 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
277 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
278 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
279 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
280 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.22
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 9.63
Rhizosphere 83.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0043172 3300053077 Bacteria 2832
2 Ga0070683_100014931 3300005329 Bacteria 6808
3 Ga0070683_100054804 3300005329 Bacteria 3698
4 Ga0070683_100291684 3300005329 Bacteria 1551
5 Ga0070690_100121147 3300005330 Bacteria 1756
6 Ga0070670_100007187 3300005331 Bacteria 9432
7 Ga0070666_10033650 3300005335 Bacteria 3392
8 Ga0070682_100034749 3300005337 Bacteria 3072
9 Ga0070682_100138541 3300005337 Bacteria 1656
10 Ga0068868_100059389 3300005338 Bacteria 3024
11 Ga0070660_100017478 3300005339 Bacteria 5228
12 Ga0070691_10031886 3300005341 Bacteria 2473
13 Ga0070661_100033691 3300005344 Bacteria 3711
14 Ga0070661_100066043 3300005344 Bacteria 2658
15 Ga0070671_100065963 3300005355 Bacteria 3016
16 Ga0070671_100189300 3300005355 Bacteria 1744
17 Ga0070659_100096357 3300005366 Bacteria 2376
18 Ga0070714_100000695 3300005435 Bacteria 23799
19 Ga0070714_100039124 3300005435 Bacteria 3991
20 Ga0070713_100100264 3300005436 Bacteria 2507
21 Ga0070710_10011979 3300005437 Bacteria 4297
22 Ga0070701_10013623 3300005438 Bacteria 3704
23 Ga0070711_100036669 3300005439 Bacteria 3286
24 Ga0070711_100043189 3300005439 Bacteria 3052
25 Ga0070700_100042152 3300005441 Bacteria 2801
26 Ga0070708_100002425 3300005445 Bacteria 14451
27 Ga0070708_100014932 3300005445 Bacteria 6403
28 Ga0070708_100028098 3300005445 Bacteria 4837
29 Ga0070662_100135819 3300005457 Bacteria 1901
30 Ga0068867_100004348 3300005459 Bacteria 9973
31 Ga0070706_100025688 3300005467 Bacteria 5421
32 Ga0070707_100278425 3300005468 Bacteria 1626
33 Ga0070699_100089679 3300005518 Bacteria 2687
34 Ga0070679_100126052 3300005530 Bacteria 2543
35 Ga0070684_100206737 3300005535 Bacteria 1789
36 Ga0070693_100029205 3300005547 Bacteria 3006
37 Ga0070665_100000632 3300005548 Bacteria 47885
38 Ga0070665_100118331 3300005548 Bacteria 2651
39 Ga0070665_100168258 3300005548 Bacteria 2194
40 Ga0070665_100303679 3300005548 Bacteria 1599
41 Ga0068855_100023771 3300005563 Bacteria 7341
42 Ga0070664_100300698 3300005564 Bacteria 1450
43 Ga0068854_100180966 3300005578 Bacteria 1647
44 Ga0068856_100008405 3300005614 Bacteria 10055
45 Ga0068856_100264643 3300005614 Bacteria 1735
46 Ga0068856_100408782 3300005614 Bacteria 1377
47 Ga0070702_100010664 3300005615 Bacteria 4538
48 Ga0068852_100073599 3300005616 Bacteria 3006
49 Ga0068859_100152558 3300005617 Bacteria 2386
50 Ga0068864_100038213 3300005618 Bacteria 4098
51 Ga0068851_10002120 3300005834 Bacteria 8719
52 Ga0068858_100000497 3300005842 Bacteria 41136
53 Ga0068858_100089750 3300005842 Bacteria 2860
54 Ga0068860_100045753 3300005843 Bacteria 4173
55 Ga0068860_100290798 3300005843 Bacteria 1599
56 Ga0068862_100108641 3300005844 Bacteria 2433
57 Ga0081455_10050743 3300005937 Bacteria 3564
58 Ga0081538_10000514 3300005981 Bacteria 43252
59 Ga0081538_10001885 3300005981 Bacteria 21119
60 Ga0081538_10004433 3300005981 Bacteria 12939
61 Ga0081538_10044170 3300005981 Bacteria 2784
62 Ga0081540_1000306 3300005983 Bacteria 50547
63 Ga0081539_10003296 3300005985 Bacteria 20206
64 Ga0070717_10006562 3300006028 Bacteria 8570
65 Ga0070717_10038922 3300006028 Bacteria 3866
66 Ga0070717_10083087 3300006028 Bacteria 2692
67 Ga0075365_10038372 3300006038 Bacteria 3113
68 Ga0075363_100014085 3300006048 Bacteria 3896
69 Ga0075362_10012535 3300006177 Bacteria 3370
70 Ga0075367_10041164 3300006178 Bacteria 2700
71 Ga0075428_100061880 3300006844 Bacteria 4099
72 Ga0075428_100264462 3300006844 Bacteria 1852
73 Ga0075428_100281030 3300006844 Bacteria 1791
74 Ga0075430_100297706 3300006846 Bacteria 1334
75 Ga0075434_100005221 3300006871 Bacteria 11799
76 Ga0075429_100192739 3300006880 Bacteria 1785
77 Ga0097620_100152552 3300006931 Bacteria 2386
78 Ga0075435_100006532 3300007076 Bacteria 8247
79 Ga0105240_10000239 3300009093 Bacteria 109259
80 Ga0105240_10021155 3300009093 Bacteria 8660
81 Ga0105240_10021786 3300009093 Bacteria 8516
82 Ga0105240_10116988 3300009093 Bacteria 3215
83 Ga0111539_10014275 3300009094 Bacteria 9922
84 Ga0111539_10022251 3300009094 Bacteria 7792
85 Ga0111539_10190356 3300009094 Bacteria 2394
86 Ga0105245_10007321 3300009098 Bacteria 9664
87 Ga0105245_10213475 3300009098 Bacteria 1859
88 Ga0105245_10268807 3300009098 Bacteria 1662
89 Ga0114129_10115628 3300009147 Bacteria 3697
90 Ga0114129_10210949 3300009147 Bacteria 2625
91 Ga0114129_10258680 3300009147 Bacteria 2334
92 Ga0105243_10032229 3300009148 Bacteria 4047
93 Ga0105243_10165213 3300009148 Bacteria 1912
94 Ga0105241_10195841 3300009174 Bacteria 1685
95 Ga0105242_10012941 3300009176 Bacteria 6433
96 Ga0105242_10196349 3300009176 Bacteria 1790
97 Ga0105237_10001661 3300009545 Bacteria 28883
98 Ga0105237_10283697 3300009545 Bacteria 1659
99 Ga0105238_10007559 3300009551 Bacteria 10887
100 Ga0105238_10048591 3300009551 Bacteria 4275
101 Ga0105249_10157912 3300009553 Bacteria 2189
102 Ga0105249_10177748 3300009553 Bacteria 2068
103 Ga0105239_10116674 3300010375 Bacteria 2963
104 Ga0105246_10007821 3300011119 Bacteria 6559
105 Ga0105246_10014139 3300011119 Bacteria 5016
106 Ga0157371_10025496 3300013102 Bacteria 4307
107 Ga0157378_10010775 3300013297 Bacteria 7992
108 Ga0163163_10071286 3300014325 Bacteria 3462
109 Ga0157379_10058861 3300014968 Bacteria 3436
110 Ga0157379_10108836 3300014968 Bacteria 2489
111 Ga0206356_11066038 3300020070 Bacteria 3565
112 Ga0213873_10001448 3300021358 Bacteria 3937
113 Ga0213876_10018870 3300021384 Bacteria 3642
114 Ga0213875_10000095 3300021388 Bacteria 102332
115 Ga0213875_10032746 3300021388 Bacteria 2455
116 Ga0213871_10001375 3300021441 Bacteria 4040
117 Ga0209025_1016219 3300025294 Bacteria 4420
118 Ga0207656_10042815 3300025321 Bacteria 1928
119 Ga0207692_10008211 3300025898 Bacteria 4316
120 Ga0207688_10001500 3300025901 Bacteria 12251
121 Ga0207680_10009002 3300025903 Bacteria 4928
122 Ga0207647_10000326 3300025904 Bacteria 39076
123 Ga0207643_10056113 3300025908 Bacteria 2240
124 Ga0207684_10033625 3300025910 Bacteria 4360
125 Ga0207654_10029555 3300025911 Bacteria 3002
126 Ga0207695_10010063 3300025913 Bacteria 11612
127 Ga0207695_10070523 3300025913 Bacteria 3572
128 Ga0207671_10020272 3300025914 Bacteria 5064
129 Ga0207671_10057459 3300025914 Bacteria 2884
130 Ga0207671_10079762 3300025914 Bacteria 2453
131 Ga0207693_10014455 3300025915 Bacteria 6346
132 Ga0207693_10061426 3300025915 Bacteria 2943
133 Ga0207663_10004594 3300025916 Bacteria 6881
134 Ga0207663_10009452 3300025916 Bacteria 5149
135 Ga0207657_10009046 3300025919 Bacteria 10057
136 Ga0207657_10208492 3300025919 Bacteria 1569
137 Ga0207652_10171963 3300025921 Bacteria 1944
138 Ga0207646_10069779 3300025922 Bacteria 3139
139 Ga0207694_10006344 3300025924 Bacteria 9025
140 Ga0207694_10057972 3300025924 Bacteria 3012
141 Ga0207650_10009082 3300025925 Bacteria 6795
142 Ga0207650_10074069 3300025925 Bacteria 2566
143 Ga0207687_10002296 3300025927 Bacteria 13027
144 Ga0207687_10178228 3300025927 Bacteria 1644
145 Ga0207700_10071572 3300025928 Bacteria 2670
146 Ga0207664_10059599 3300025929 Bacteria 3040
147 Ga0207690_10028886 3300025932 Bacteria 3519
148 Ga0207706_10032594 3300025933 Bacteria 4640
149 Ga0207706_10063363 3300025933 Bacteria 3255
150 Ga0207706_10096762 3300025933 Bacteria 2596
151 Ga0207669_10009666 3300025937 Bacteria 4609
152 Ga0207704_10018009 3300025938 Bacteria 3677
153 Ga0207704_10165629 3300025938 Bacteria 1578
154 Ga0207665_10014888 3300025939 Bacteria 5111
155 Ga0207691_10052739 3300025940 Bacteria 3714
156 Ga0207689_10011563 3300025942 Bacteria 7561
157 Ga0207661_10021118 3300025944 Bacteria 4877
158 Ga0207661_10461902 3300025944 Bacteria 1157
159 Ga0207679_10010216 3300025945 Bacteria 6038
160 Ga0207679_10071163 3300025945 Bacteria 2623
161 Ga0207679_10206201 3300025945 Bacteria 1646
162 Ga0207667_10056773 3300025949 Bacteria 4111
163 Ga0207667_10117559 3300025949 Bacteria 2740
164 Ga0207651_10074729 3300025960 Bacteria 2415
165 Ga0207712_10000321 3300025961 Bacteria 43794
166 Ga0207640_10105391 3300025981 Bacteria 1987
167 Ga0207640_10287509 3300025981 Bacteria 1295
168 Ga0207677_10031855 3300026023 Bacteria 3381
169 Ga0207677_10046994 3300026023 Bacteria 2895
170 Ga0207703_10001632 3300026035 Bacteria 20217
171 Ga0207703_10077757 3300026035 Bacteria 2755
172 Ga0207703_10200079 3300026035 Bacteria 1775
173 Ga0207639_10025231 3300026041 Bacteria 4309
174 Ga0207678_10140545 3300026067 Bacteria 2060
175 Ga0207708_10095670 3300026075 Bacteria 2294
176 Ga0207708_10183620 3300026075 Bacteria 1661
177 Ga0207702_10147129 3300026078 Bacteria 2139
178 Ga0207648_10010142 3300026089 Bacteria 8957
179 Ga0207674_10300784 3300026116 Bacteria 1553
180 Ga0207675_100314084 3300026118 Bacteria 1529
181 Ga0207683_10037400 3300026121 Bacteria 4226
182 Ga0207683_10151678 3300026121 Bacteria 2092
183 Ga0207698_10080871 3300026142 Bacteria 2620
184 Ga0207428_10018799 3300027907 Bacteria 5896
185 Ga0207428_10153588 3300027907 Bacteria 1751
186 Ga0268266_10000008 3300028379 Bacteria 1161875
187 Ga0268266_10248947 3300028379 Bacteria 1643
188 Ga0268266_10278741 3300028379 Bacteria 1554
189 Ga0268265_10049869 3300028380 Bacteria 3151
190 Ga0268264_10017152 3300028381 Bacteria 5930
191 Ga0268264_10073902 3300028381 Bacteria 2895
192 Ga0265337_1006811 3300028556 Bacteria 4349
193 Ga0265326_10001791 3300028558 Bacteria 7415
194 Ga0265319_1000144 3300028563 Bacteria 52606
195 Ga0265318_10002150 3300028577 Bacteria 10707
196 Ga0265336_10000002 3300028666 Bacteria 830172
197 Ga0265338_10000001 3300028800 Bacteria 1177449
198 Ga0265324_10003810 3300029957 Bacteria 7048
199 Ga0265340_10000001 3300031247 Bacteria 1647668
200 Ga0265316_10044621 3300031344 Bacteria 3524
201 Ga0265342_10061593 3300031712 Bacteria 2210
202 Ga0316576_10028542 3300031727 Bacteria 3934
203 Ga0307413_10075276 3300031824 Bacteria 2142
204 Ga0307410_10105796 3300031852 Bacteria 2026
205 Ga0307406_10241710 3300031901 Bacteria 1354
206 Ga0307407_10007826 3300031903 Bacteria 4865
207 Ga0307412_10068641 3300031911 Bacteria 2411
208 Ga0307409_100007360 3300031995 Bacteria 6577
209 Ga0307409_100263862 3300031995 Bacteria 1582
210 Ga0307416_100008401 3300032002 Bacteria 6660
211 Ga0307416_100040230 3300032002 Bacteria 3629
212 Ga0307416_100318317 3300032002 Bacteria 1556
213 Ga0307414_10274618 3300032004 Bacteria 1413
214 Ga0307411_10030099 3300032005 Bacteria 3324
215 Ga0307411_10177903 3300032005 Bacteria 1611
216 Ga0307415_100001872 3300032126 Bacteria 10327
217 Ga0373945_0005296 3300035116 Bacteria 4128
218 Ga0373946_0018889 3300035171 Bacteria 2650
219 Ga0316574_0047369 3300035398 Bacteria 2668
220 Ga0373931_0081100 3300035691 Bacteria 1791
221 Ga0373935_0226487 3300035692 Bacteria 1300
222 Ga0373947_0003704 3300035725 Bacteria 9026
223 Ga0316584_0027794 3300036712 Bacteria 4165
224 Ga0373925_0003118 3300037068 Bacteria 13017
225 Ga0373925_0055534 3300037068 Bacteria 2965
226 Ga0395899_0003455 3300037312 Bacteria 12522
227 Ga0395900_0097494 3300037418 Bacteria 3020
228 Ga0395898_0033228 3300037466 Bacteria 5149
229 Ga0395905_0005339 3300037471 Bacteria 13132
230 Ga0436364_0860606 3300037853 Bacteria 3246
231 Ga0436364_1294613 3300037853 Bacteria 100298
232 Ga0436364_1447776 3300037853 Bacteria 4132
233 Ga0395901_0356500 3300038443 Bacteria 1509
234 Ga0400485_08530 3300038735 Bacteria 9384
235 Ga0436365_0405759 3300039437 Bacteria 1445
236 Ga0436365_1799679 3300039437 Bacteria 12113
237 Ga0436360_0121251 3300039438 Bacteria 3609
238 Ga0436361_0484246 3300039447 Bacteria 3668
239 Ga0436363_1335775 3300039450 Bacteria 3537
240 Ga0436362_0320430 3300039453 Bacteria 9108
241 Ga0451833_0911976 3300041491 Bacteria 1221
242 Ga0451577_0003411 3300042876 Bacteria 17723
243 Ga0466963_0013726 3300044694 Bacteria 4982
244 Ga0466963_0026609 3300044694 Bacteria 3700
245 Ga0466963_0026894 3300044694 Bacteria 3680
246 Ga0466963_0063532 3300044694 Bacteria 2471
247 Ga0466963_0149998 3300044694 Bacteria 1618
248 Ga0466964_0051638 3300044706 Bacteria 1689
249 Ga0453684_0021860 3300044712 Bacteria 9526
250 Ga0453684_0054884 3300044712 Bacteria 5185
251 Ga0466971_0074809 3300044719 Bacteria 1540
252 Ga0466958_0037916 3300045836 Bacteria 2890
253 Ga0466958_0066151 3300045836 Bacteria 2207
254 Ga0466967_0002553 3300045976 Bacteria 11410
255 Ga0466967_0008361 3300045976 Bacteria 7573
256 Ga0466967_0050299 3300045976 Bacteria 3649
257 Ga0466967_0050611 3300045976 Bacteria 3638
258 Ga0466967_0066789 3300045976 Bacteria 3206
259 Ga0466967_0197807 3300045976 Bacteria 1902
260 Ga0466967_0294340 3300045976 Bacteria 1560
261 Ga0466967_0298644 3300045976 Bacteria 1549
262 Ga0495603_0033723 3300046455 Bacteria 3079
263 Ga0495629_0051245 3300046459 Bacteria 2889
264 Ga0495641_0003915 3300046461 Bacteria 10822
265 Ga0495641_0034325 3300046461 Bacteria 2399
266 Ga0495641_0074041 3300046461 Bacteria 1528
267 Ga0495651_0067994 3300046462 Bacteria 2716
268 Ga0495653_0000718 3300046463 Bacteria 25191
269 Ga0495653_0007703 3300046463 Bacteria 8812
270 Ga0495653_0012191 3300046463 Bacteria 7014
271 Ga0495580_0011252 3300046472 Bacteria 6924
272 Ga0495582_0000011 3300046473 Bacteria 113352
273 Ga0495582_0003433 3300046473 Bacteria 8925
274 Ga0495639_0000900 3300046475 Bacteria 13432
275 Ga0495662_0004791 3300046476 Bacteria 6779
276 Ga0495662_0130496 3300046476 Bacteria 1235
277 Ga0495664_0000007 3300046477 Bacteria 386710
278 Ga0495664_0009688 3300046477 Bacteria 5395
279 Ga0495618_0000478 3300046514 Bacteria 28566
280 Ga0495618_0002981 3300046514 Bacteria 10699
281 Ga0495628_0001219 3300046516 Bacteria 23555
282 Ga0495628_0182826 3300046516 Bacteria 1585
283 Ga0495630_0003283 3300046517 Bacteria 11285
284 Ga0495630_0041078 3300046517 Bacteria 3454
285 Ga0495630_0075230 3300046517 Bacteria 2545
286 Ga0495652_0036988 3300046529 Bacteria 4239
287 Ga0495652_0121562 3300046529 Bacteria 2081
288 Ga0495665_0001729 3300046531 Bacteria 11727
289 Ga0495640_0070397 3300046533 Bacteria 2350
290 Ga0495640_0084861 3300046533 Bacteria 2099
291 Ga0495640_0152960 3300046533 Bacteria 1481
292 Ga0495586_0051824 3300046535 Bacteria 2221
293 Ga0495587_0050954 3300046536 Bacteria 2449
294 Ga0495645_0000051 3300046543 Bacteria 87212
295 Ga0495645_0079688 3300046543 Bacteria 2352
296 Ga0495645_0102329 3300046543 Bacteria 2036
297 Ga0495667_0016004 3300046559 Bacteria 5068
298 Ga0495667_0130913 3300046559 Bacteria 1618
299 Ga0495634_0008255 3300046642 Bacteria 7766
300 Ga0495634_0078735 3300046642 Bacteria 2159
301 Ga0495635_0011346 3300046663 Bacteria 6250
302 Ga0495657_0000013 3300046675 Bacteria 195590
303 Ga0495657_0003884 3300046675 Bacteria 12036
304 Ga0495623_0023337 3300046679 Bacteria 3993
305 Ga0495658_0003331 3300046683 Bacteria 7972
306 Ga0495613_0005324 3300046689 Bacteria 9668
307 Ga0495613_0042977 3300046689 Bacteria 3343
308 Ga0495624_0117833 3300046690 Bacteria 1631
309 Ga0495670_0041778 3300046691 Bacteria 2288
310 Ga0495600_0001759 3300046809 Bacteria 12113
311 Ga0495581_0009467 3300047315 Bacteria 5637
312 Ga0495604_0000824 3300047317 Bacteria 25900
313 Ga0495674_0124325 3300047319 Bacteria 2178
314 Ga0495674_0130271 3300047319 Bacteria 2119
315 Ga0495676_0010496 3300047321 Bacteria 8398
316 Ga0495683_0001669 3300047323 Bacteria 14143
317 Ga0495684_0006217 3300047471 Bacteria 9286
318 Ga0495684_0069147 3300047471 Bacteria 2685
319 Ga0495602_0000497 3300048088 Bacteria 36490
320 Ga0495602_0043100 3300048088 Bacteria 4106
321 Ga0496100_0010180 3300048903 Bacteria 5318
322 Ga0496100_0029866 3300048903 Bacteria 3376
323 Ga0496100_0085268 3300048903 Bacteria 2143
324 Ga0496101_0022760 3300048904 Bacteria 4318
325 Ga0496101_0032431 3300048904 Bacteria 3677
326 Ga0496101_0179858 3300048904 Bacteria 1628
327 Ga0496102_0000002 3300048905 Bacteria 814588
328 Ga0496102_0011579 3300048905 Bacteria 7609
329 Ga0496102_0024164 3300048905 Bacteria 5402
330 Ga0496103_0000017 3300048906 Bacteria 244768
331 Ga0496103_0046533 3300048906 Bacteria 2679
332 Ga0496104_0000129 3300048907 Bacteria 69982
333 Ga0496104_0076803 3300048907 Bacteria 3181
334 Ga0496104_0288643 3300048907 Bacteria 1553
335 Ga0496105_0000846 3300048908 Bacteria 20846
336 Ga0496105_0012203 3300048908 Bacteria 6802
337 Ga0496105_0147405 3300048908 Bacteria 1935
338 Ga0496106_0004621 3300048909 Bacteria 10212
339 Ga0496106_0164730 3300048909 Bacteria 1754
340 Ga0496106_0173196 3300048909 Bacteria 1711
341 Ga0496107_0063667 3300048910 Bacteria 2673
342 Ga0496108_0008252 3300048911 Bacteria 8450
343 Ga0496109_0020731 3300048912 Bacteria 5805
344 Ga0496109_0023811 3300048912 Bacteria 5435
345 Ga0496109_0049209 3300048912 Bacteria 3836
346 Ga0496109_0064555 3300048912 Bacteria 3350
347 Ga0496109_0162734 3300048912 Bacteria 2091
348 Ga0496110_0003221 3300048913 Bacteria 12435
349 Ga0496110_0004469 3300048913 Bacteria 10841
350 Ga0496110_0027041 3300048913 Bacteria 4915
351 Ga0496110_0035690 3300048913 Bacteria 4315
352 Ga0496110_0155409 3300048913 Bacteria 2072
353 Ga0496110_0217993 3300048913 Bacteria 1735
354 Ga0496112_0003240 3300048915 Bacteria 13411
355 Ga0496113_0094443 3300048916 Bacteria 2310
356 Ga0496114_0011170 3300048917 Bacteria 7170
357 Ga0496114_0065404 3300048917 Bacteria 3047
358 Ga0496114_0089505 3300048917 Bacteria 2612
359 Ga0496115_0000075 3300048918 Bacteria 90155
360 Ga0496115_0000121 3300048918 Bacteria 71105
361 Ga0496115_0022542 3300048918 Bacteria 4880
362 Ga0496115_0025379 3300048918 Bacteria 4613
363 Ga0496115_0054627 3300048918 Bacteria 3207
364 Ga0496115_0172679 3300048918 Bacteria 1787
365 Ga0496121_0057097 3300048924 Bacteria 3237
366 Ga0501031_0066093 3300049568 Bacteria 2356
367 Ga0501034_0168275 3300049571 Bacteria 2160
368 Ga0501036_0158872 3300049572 Bacteria 1906
369 Ga0501038_0121738 3300049574 Bacteria 2151
370 Ga0501039_0008934 3300049575 Bacteria 7635
371 Ga0501039_0031961 3300049575 Bacteria 4058
372 Ga0501039_0091576 3300049575 Bacteria 2370
373 Ga0501040_0004863 3300049576 Bacteria 8698
374 Ga0501041_0029589 3300049577 Bacteria 3304
375 Ga0501041_0052475 3300049577 Bacteria 2486
376 Ga0501042_0020617 3300049578 Bacteria 4589
377 Ga0501042_0080860 3300049578 Bacteria 2328
378 Ga0501048_0042454 3300049582 Bacteria 3256
379 Ga0501048_0056224 3300049582 Bacteria 2792
380 Ga0501048_0089861 3300049582 Bacteria 2167
381 Ga0501068_0040733 3300049584 Bacteria 2790
382 Ga0501071_0036339 3300049587 Bacteria 3513
383 Ga0501071_0041530 3300049587 Bacteria 3294
384 Ga0501072_0035077 3300049588 Bacteria 3932
385 Ga0501072_0061451 3300049588 Bacteria 2963
386 Ga0501072_0071929 3300049588 Bacteria 2733
387 Ga0501072_0072427 3300049588 Bacteria 2723
388 Ga0501073_0203999 3300049589 Bacteria 1367
389 Ga0501074_0061398 3300049590 Bacteria 2708
390 Ga0501075_0012398 3300049591 Bacteria 6059
391 Ga0501075_0012727 3300049591 Bacteria 5987
392 Ga0501075_0061336 3300049591 Bacteria 2834
393 Ga0501075_0076746 3300049591 Bacteria 2528
394 Ga0501076_0009268 3300049592 Bacteria 7263
395 Ga0501076_0010603 3300049592 Bacteria 6843
396 Ga0501076_0054499 3300049592 Bacteria 3169
397 Ga0501079_0034231 3300049741 Bacteria 3909
398 Ga0501079_0045025 3300049741 Bacteria 3405
399 Ga0501080_0390237 3300049742 Bacteria 1253
400 Ga0501081_0037729 3300049743 Bacteria 3298
401 Ga0501081_0115466 3300049743 Bacteria 1908
402 Ga0501081_0237163 3300049743 Bacteria 1329
403 Ga0501083_0165044 3300049744 Bacteria 1448
404 Ga0501035_0093949 3300049822 Bacteria 2638
405 Ga0501044_0192424 3300049823 Bacteria 2002
406 Ga0501045_0023504 3300049824 Bacteria 4420
407 Ga0501045_0048324 3300049824 Bacteria 3102
408 Ga0501045_0082152 3300049824 Bacteria 2376
409 Ga0501045_0095285 3300049824 Bacteria 2202
410 Ga0501045_0109516 3300049824 Bacteria 2047
411 Ga0501045_0140019 3300049824 Bacteria 1799
412 nmdc:mga03683_85228_c1 3300050489 Bacteria 1370
413 nmdc:mga03n38_1833_c1 3300050490 Bacteria 6330
414 nmdc:mga03n38_20877_c1 3300050490 Bacteria 2627
415 nmdc:mga00v17_23284_c1 3300050491 Bacteria 3582
416 nmdc:mga0yw44_11056_c1 3300050492 Bacteria 4639
417 nmdc:mga0yw44_112257_c1 3300050492 Bacteria 1748
418 nmdc:mga0yw44_80328_c1 3300050492 Bacteria 2042
419 nmdc:mga0k408_63204_c1 3300050493 Bacteria 2153
420 nmdc:mga06z11_107427_c1 3300050494 Bacteria 1540
421 nmdc:mga05p37_17547_c1 3300050507 Bacteria 8641
422 nmdc:mga05p37_314192_c1 3300050507 Bacteria 1856
423 nmdc:mga06r32_26452_c1 3300050510 Bacteria 5410
424 nmdc:mga08y16_221135_c1 3300050511 Bacteria 1960
425 nmdc:mga08y16_22986_c1 3300050511 Bacteria 6582
426 nmdc:mga08y16_32338_c1 3300050511 Bacteria 5501
427 nmdc:mga0n895_12586_c1 3300050512 Bacteria 7594
428 nmdc:mga0n895_140917_c1 3300050512 Bacteria 2439
429 nmdc:mga0rr50_2158_c2 3300050513 Bacteria 8922
430 nmdc:mga0rr50_32514_c1 3300050513 Bacteria 3718
431 Ga0495601_0012329 3300053077 Bacteria 5127
432 Ga0495601_0037930 3300053077 Bacteria 3012
433 Ga0495601_0054959 3300053077 Bacteria 2520
434 Ga0495601_0057388 3300053077 Bacteria 2466
435 Ga0495612_0000136 3300053078 Bacteria 31282
436 Ga0495619_0135864 3300053085 Bacteria 1691
437 Ga0500645_014762 3300053730 Bacteria 2485
438 Ga0501084_0002029 3300054114 Bacteria 16166
439 Ga0501084_0139872 3300054114 Bacteria 2038
440 Ga0501084_0176950 3300054114 Bacteria 1801
441 Ga0501082_0005768 3300060353 Bacteria 10745
442 Ga0501082_0089404 3300060353 Bacteria 2659
443 Ga0466962_0080097 3300061719 Bacteria 1561
444 2548696739 2547132424 Bacteria 8348532
445 2552108852 2551306166 Bacteria 9731570
446 2688069552 2687453257 Bacteria 6784659
447 2852676915 2852673933 Bacteria 3347676
448 2857609953 2857609550 Bacteria 3753890
449 2889418157 2889415604 Bacteria 8048700
450 2919717649 2919713450 Bacteria 7431245
451 2920114449 2920107658 Bacteria 10042636
452 2928144570 2928142448 Bacteria 5288925
453 2928514886 2928510474 Bacteria 4815308
454 2939596052 2939593269 Bacteria 4798695
455 2964376352 2964375228 Bacteria 4909004
456 3001121609 3001119090 Bacteria 3449530
457 8055536294 8055531788 Bacteria 5249694
458 Ga0495601_0043172
459 Ga0070683_100014931
460 Ga0070683_100054804
461 Ga0070683_100291684
462 Ga0070690_100121147
463 Ga0070670_100007187
464 Ga0070666_10033650
465 Ga0070682_100034749
466 Ga0070682_100138541
467 Ga0068868_100059389
468 Ga0070660_100017478
469 Ga0070691_10031886
470 Ga0070661_100033691
471 Ga0070661_100066043
472 Ga0070671_100065963
473 Ga0070671_100189300
474 Ga0070659_100096357
475 Ga0070714_100000695
476 Ga0070714_100039124
477 Ga0070713_100100264
478 Ga0070710_10011979
479 Ga0070701_10013623
480 Ga0070711_100036669
481 Ga0070711_100043189
482 Ga0070700_100042152
483 Ga0070708_100002425
484 Ga0070708_100014932
485 Ga0070708_100028098
486 Ga0070662_100135819
487 Ga0068867_100004348
488 Ga0070706_100025688
489 Ga0070707_100278425
490 Ga0070699_100089679
491 Ga0070679_100126052
492 Ga0070684_100206737
493 Ga0070693_100029205
494 Ga0070665_100000632
495 Ga0070665_100118331
496 Ga0070665_100168258
497 Ga0070665_100303679
498 Ga0068855_100023771
499 Ga0070664_100300698
500 Ga0068854_100180966
501 Ga0068856_100008405
502 Ga0068856_100264643
503 Ga0068856_100408782
504 Ga0070702_100010664
505 Ga0068852_100073599
506 Ga0068859_100152558
507 Ga0068864_100038213
508 Ga0068851_10002120
509 Ga0068858_100000497
510 Ga0068858_100089750
511 Ga0068860_100045753
512 Ga0068860_100290798
513 Ga0068862_100108641
514 Ga0081455_10050743
515 Ga0081538_10000514
516 Ga0081538_10001885
517 Ga0081538_10004433
518 Ga0081538_10044170
519 Ga0081540_1000306
520 Ga0081539_10003296
521 Ga0070717_10006562
522 Ga0070717_10038922
523 Ga0070717_10083087
524 Ga0075365_10038372
525 Ga0075363_100014085
526 Ga0075362_10012535
527 Ga0075367_10041164
528 Ga0075428_100061880
529 Ga0075428_100264462
530 Ga0075428_100281030
531 Ga0075430_100297706
532 Ga0075434_100005221
533 Ga0075429_100192739
534 Ga0097620_100152552
535 Ga0075435_100006532
536 Ga0105240_10000239
537 Ga0105240_10021155
538 Ga0105240_10021786
539 Ga0105240_10116988
540 Ga0111539_10014275
541 Ga0111539_10022251
542 Ga0111539_10190356
543 Ga0105245_10007321
544 Ga0105245_10213475
545 Ga0105245_10268807
546 Ga0114129_10115628
547 Ga0114129_10210949
548 Ga0114129_10258680
549 Ga0105243_10032229
550 Ga0105243_10165213
551 Ga0105241_10195841
552 Ga0105242_10012941
553 Ga0105242_10196349
554 Ga0105237_10001661
555 Ga0105237_10283697
556 Ga0105238_10007559
557 Ga0105238_10048591
558 Ga0105249_10157912
559 Ga0105249_10177748
560 Ga0105239_10116674
561 Ga0105246_10007821
562 Ga0105246_10014139
563 Ga0157371_10025496
564 Ga0157378_10010775
565 Ga0163163_10071286
566 Ga0157379_10058861
567 Ga0157379_10108836
568 Ga0206356_11066038
569 Ga0213873_10001448
570 Ga0213876_10018870
571 Ga0213875_10000095
572 Ga0213875_10032746
573 Ga0213871_10001375
574 Ga0209025_1016219
575 Ga0207656_10042815
576 Ga0207692_10008211
577 Ga0207688_10001500
578 Ga0207680_10009002
579 Ga0207647_10000326
580 Ga0207643_10056113
581 Ga0207684_10033625
582 Ga0207654_10029555
583 Ga0207695_10010063
584 Ga0207695_10070523
585 Ga0207671_10020272
586 Ga0207671_10057459
587 Ga0207671_10079762
588 Ga0207693_10014455
589 Ga0207693_10061426
590 Ga0207663_10004594
591 Ga0207663_10009452
592 Ga0207657_10009046
593 Ga0207657_10208492
594 Ga0207652_10171963
595 Ga0207646_10069779
596 Ga0207694_10006344
597 Ga0207694_10057972
598 Ga0207650_10009082
599 Ga0207650_10074069
600 Ga0207687_10002296
601 Ga0207687_10178228
602 Ga0207700_10071572
603 Ga0207664_10059599
604 Ga0207690_10028886
605 Ga0207706_10032594
606 Ga0207706_10063363
607 Ga0207706_10096762
608 Ga0207669_10009666
609 Ga0207704_10018009
610 Ga0207704_10165629
611 Ga0207665_10014888
612 Ga0207691_10052739
613 Ga0207689_10011563
614 Ga0207661_10021118
615 Ga0207661_10461902
616 Ga0207679_10010216
617 Ga0207679_10071163
618 Ga0207679_10206201
619 Ga0207667_10056773
620 Ga0207667_10117559
621 Ga0207651_10074729
622 Ga0207712_10000321
623 Ga0207640_10105391
624 Ga0207640_10287509
625 Ga0207677_10031855
626 Ga0207677_10046994
627 Ga0207703_10001632
628 Ga0207703_10077757
629 Ga0207703_10200079
630 Ga0207639_10025231
631 Ga0207678_10140545
632 Ga0207708_10095670
633 Ga0207708_10183620
634 Ga0207702_10147129
635 Ga0207648_10010142
636 Ga0207674_10300784
637 Ga0207675_100314084
638 Ga0207683_10037400
639 Ga0207683_10151678
640 Ga0207698_10080871
641 Ga0207428_10018799
642 Ga0207428_10153588
643 Ga0268266_10000008
644 Ga0268266_10248947
645 Ga0268266_10278741
646 Ga0268265_10049869
647 Ga0268264_10017152
648 Ga0268264_10073902
649 Ga0265337_1006811
650 Ga0265326_10001791
651 Ga0265319_1000144
652 Ga0265318_10002150
653 Ga0265336_10000002
654 Ga0265338_10000001
655 Ga0265324_10003810
656 Ga0265340_10000001
657 Ga0265316_10044621
658 Ga0265342_10061593
659 Ga0316576_10028542
660 Ga0307413_10075276
661 Ga0307410_10105796
662 Ga0307406_10241710
663 Ga0307407_10007826
664 Ga0307412_10068641
665 Ga0307409_100007360
666 Ga0307409_100263862
667 Ga0307416_100008401
668 Ga0307416_100040230
669 Ga0307416_100318317
670 Ga0307414_10274618
671 Ga0307411_10030099
672 Ga0307411_10177903
673 Ga0307415_100001872
674 Ga0373945_0005296
675 Ga0373946_0018889
676 Ga0316574_0047369
677 Ga0373931_0081100
678 Ga0373935_0226487
679 Ga0373947_0003704
680 Ga0316584_0027794
681 Ga0373925_0003118
682 Ga0373925_0055534
683 Ga0395899_0003455
684 Ga0395900_0097494
685 Ga0395898_0033228
686 Ga0395905_0005339
687 Ga0436364_0860606
688 Ga0436364_1294613
689 Ga0436364_1447776
690 Ga0395901_0356500
691 Ga0400485_08530
692 Ga0436365_0405759
693 Ga0436365_1799679
694 Ga0436360_0121251
695 Ga0436361_0484246
696 Ga0436363_1335775
697 Ga0436362_0320430
698 Ga0451833_0911976
699 Ga0451577_0003411
700 Ga0466963_0013726
701 Ga0466963_0026609
702 Ga0466963_0026894
703 Ga0466963_0063532
704 Ga0466963_0149998
705 Ga0466964_0051638
706 Ga0453684_0021860
707 Ga0453684_0054884
708 Ga0466971_0074809
709 Ga0466958_0037916
710 Ga0466958_0066151
711 Ga0466967_0002553
712 Ga0466967_0008361
713 Ga0466967_0050299
714 Ga0466967_0050611
715 Ga0466967_0066789
716 Ga0466967_0197807
717 Ga0466967_0294340
718 Ga0466967_0298644
719 Ga0495603_0033723
720 Ga0495629_0051245
721 Ga0495641_0003915
722 Ga0495641_0034325
723 Ga0495641_0074041
724 Ga0495651_0067994
725 Ga0495653_0000718
726 Ga0495653_0007703
727 Ga0495653_0012191
728 Ga0495580_0011252
729 Ga0495582_0000011
730 Ga0495582_0003433
731 Ga0495639_0000900
732 Ga0495662_0004791
733 Ga0495662_0130496
734 Ga0495664_0000007
735 Ga0495664_0009688
736 Ga0495618_0000478
737 Ga0495618_0002981
738 Ga0495628_0001219
739 Ga0495628_0182826
740 Ga0495630_0003283
741 Ga0495630_0041078
742 Ga0495630_0075230
743 Ga0495652_0036988
744 Ga0495652_0121562
745 Ga0495665_0001729
746 Ga0495640_0070397
747 Ga0495640_0084861
748 Ga0495640_0152960
749 Ga0495586_0051824
750 Ga0495587_0050954
751 Ga0495645_0000051
752 Ga0495645_0079688
753 Ga0495645_0102329
754 Ga0495667_0016004
755 Ga0495667_0130913
756 Ga0495634_0008255
757 Ga0495634_0078735
758 Ga0495635_0011346
759 Ga0495657_0000013
760 Ga0495657_0003884
761 Ga0495623_0023337
762 Ga0495658_0003331
763 Ga0495613_0005324
764 Ga0495613_0042977
765 Ga0495624_0117833
766 Ga0495670_0041778
767 Ga0495600_0001759
768 Ga0495581_0009467
769 Ga0495604_0000824
770 Ga0495674_0124325
771 Ga0495674_0130271
772 Ga0495676_0010496
773 Ga0495683_0001669
774 Ga0495684_0006217
775 Ga0495684_0069147
776 Ga0495602_0000497
777 Ga0495602_0043100
778 Ga0496100_0010180
779 Ga0496100_0029866
780 Ga0496100_0085268
781 Ga0496101_0022760
782 Ga0496101_0032431
783 Ga0496101_0179858
784 Ga0496102_0000002
785 Ga0496102_0011579
786 Ga0496102_0024164
787 Ga0496103_0000017
788 Ga0496103_0046533
789 Ga0496104_0000129
790 Ga0496104_0076803
791 Ga0496104_0288643
792 Ga0496105_0000846
793 Ga0496105_0012203
794 Ga0496105_0147405
795 Ga0496106_0004621
796 Ga0496106_0164730
797 Ga0496106_0173196
798 Ga0496107_0063667
799 Ga0496108_0008252
800 Ga0496109_0020731
801 Ga0496109_0023811
802 Ga0496109_0049209
803 Ga0496109_0064555
804 Ga0496109_0162734
805 Ga0496110_0003221
806 Ga0496110_0004469
807 Ga0496110_0027041
808 Ga0496110_0035690
809 Ga0496110_0155409
810 Ga0496110_0217993
811 Ga0496112_0003240
812 Ga0496113_0094443
813 Ga0496114_0011170
814 Ga0496114_0065404
815 Ga0496114_0089505
816 Ga0496115_0000075
817 Ga0496115_0000121
818 Ga0496115_0022542
819 Ga0496115_0025379
820 Ga0496115_0054627
821 Ga0496115_0172679
822 Ga0496121_0057097
823 Ga0501031_0066093
824 Ga0501034_0168275
825 Ga0501036_0158872
826 Ga0501038_0121738
827 Ga0501039_0008934
828 Ga0501039_0031961
829 Ga0501039_0091576
830 Ga0501040_0004863
831 Ga0501041_0029589
832 Ga0501041_0052475
833 Ga0501042_0020617
834 Ga0501042_0080860
835 Ga0501048_0042454
836 Ga0501048_0056224
837 Ga0501048_0089861
838 Ga0501068_0040733
839 Ga0501071_0036339
840 Ga0501071_0041530
841 Ga0501072_0035077
842 Ga0501072_0061451
843 Ga0501072_0071929
844 Ga0501072_0072427
845 Ga0501073_0203999
846 Ga0501074_0061398
847 Ga0501075_0012398
848 Ga0501075_0012727
849 Ga0501075_0061336
850 Ga0501075_0076746
851 Ga0501076_0009268
852 Ga0501076_0010603
853 Ga0501076_0054499
854 Ga0501079_0034231
855 Ga0501079_0045025
856 Ga0501080_0390237
857 Ga0501081_0037729
858 Ga0501081_0115466
859 Ga0501081_0237163
860 Ga0501083_0165044
861 Ga0501035_0093949
862 Ga0501044_0192424
863 Ga0501045_0023504
864 Ga0501045_0048324
865 Ga0501045_0082152
866 Ga0501045_0095285
867 Ga0501045_0109516
868 Ga0501045_0140019
869 nmdc:mga03683_85228_c1
870 nmdc:mga03n38_1833_c1
871 nmdc:mga03n38_20877_c1
872 nmdc:mga00v17_23284_c1
873 nmdc:mga0yw44_11056_c1
874 nmdc:mga0yw44_112257_c1
875 nmdc:mga0yw44_80328_c1
876 nmdc:mga0k408_63204_c1
877 nmdc:mga06z11_107427_c1
878 nmdc:mga05p37_17547_c1
879 nmdc:mga05p37_314192_c1
880 nmdc:mga06r32_26452_c1
881 nmdc:mga08y16_221135_c1
882 nmdc:mga08y16_22986_c1
883 nmdc:mga08y16_32338_c1
884 nmdc:mga0n895_12586_c1
885 nmdc:mga0n895_140917_c1
886 nmdc:mga0rr50_2158_c2
887 nmdc:mga0rr50_32514_c1
888 Ga0495601_0012329
889 Ga0495601_0037930
890 Ga0495601_0054959
891 Ga0495601_0057388
892 Ga0495612_0000136
893 Ga0495619_0135864
894 Ga0500645_014762
895 Ga0501084_0002029
896 Ga0501084_0139872
897 Ga0501084_0176950
898 Ga0501082_0005768
899 Ga0501082_0089404
900 Ga0466962_0080097
901 2548696739
902 2552108852
903 2688069552
904 2852676915
905 2857609953
906 2889418157
907 2919717649
908 2920114449
909 2928144570
910 2928514886
911 2939596052
912 2964376352
913 3001121609
914 8055536294

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00162

PGK

Phosphoglycerate kinase

29

417

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9663 2 374
3uwd-assembly1.cif.gz_A crystal structure of phosphoglycerate kinase from bacillus anthracis 0.9597 2 375
6i06-assembly1.cif.gz_A crystal structure of psychrophilic phosphoglycerate kinase from pseudomonas tacii18 0.9595 1 374
1zmr-assembly1.cif.gz_A crystal structure of the e. coli phosphoglycerate kinase 0.9589 1 374
1php-assembly1.cif.gz_A structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms 0.9587 2 374
ID Description Score Start End Superfamily
af_P9WID1_191_392_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9799 170 363 3.40.50.1260
af_A0A1D6FSN1_1_174_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9705 210 375 3.40.50.1260
af_A0A1D6FSN1_4_156_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9658 214 357 3.40.50.1260
af_P0A799_178_379_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.9644 172 371 3.30.200.20
af_E9AGU0_88_417_3.40.50.1260 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate kinase, N-terminal domain 0.9565 70 375 3.40.50.1260
ID Description Score Start End GO Terms
AF-A0A1Y2T1S8-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9965 270 375 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A7C5D8X0-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.993 1 85 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-W1XYT3-F1-model_v4 phosphoglycerate kinase (EC 2.7.2.3) 0.9904 277 357 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A2D5FKL4-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9891 279 374 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0043531
AF-A0A4Q2KKC6-F1-model_v4 deleted 0.9889 282 374

Map