F448116

General Info

Members Datasets Scaffolds Average Seq Length
458 286 916 244

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10270102|rootH1_102701021
Length 290
Sequence MAHGRHAMIDAAGTPWHRHMTRGSAVLPKATIRRTRNDEASVAGGEAGWQQSLRRLYEGHSAAGQRFRYGLVALDVVTVLYIVATSFLDHSRLIGIIDVTLGVVLLADFAARMVLARRRWRELLYPSTWADVAAIVSFLAPILGEGLAFLRALVAQLRADSPYFRRHEEVILALANLVVFIFIVTGAVYETQHYTNPSIHNYVDALYFTVAALTTTGFGDITLSGTVGRLLSVIIMIFGVTLFFNLARALLSPSKVRFSCPTCGLQRHDSDAVHCKACGTVLNIPDEGLT

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
241 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
242 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
248 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
249 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
250 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
251 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
252 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
253 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
254 2791355199
255 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
256 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
257 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
258 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
259 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
260 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
261 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
262 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
263 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
264 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
265 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
266 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
267 2849560528 Caulobacter zeae 410 Isolate Unclassified
268 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
269 2851153111 Caulobacter radicis 736 Isolate Unclassified
270 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
271 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
272 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
273 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
274 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
275 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
276 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
277 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
278 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
279 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
280 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
281 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
282 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
283 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
284 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
285 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
286 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.25
Metatranscriptomes 0
Isolates 8.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.23
Nodule 2.84
Rhizoplane 8.52
Rhizosphere 67.9
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10270102 3300003323 Bacteria 1376
2 JGI25406J46586_10005123 3300003203 Bacteria 6078
3 JGI25153J46596_10000703 3300003215 Bacteria 20474
4 JGI25153J46596_10004919 3300003215 Bacteria 7102
5 rootL2_10113382 3300003322 Bacteria 2248
6 rootL2_10338969 3300003322 Bacteria 1455
7 JGI25404J52841_10000420 3300003659 Bacteria 5930
8 Ga0055531_10004834 3300003794 Bacteria 8038
9 Ga0065165_1004197 3300005262 Bacteria 9179
10 Ga0065165_1005620 3300005262 Bacteria 6942
11 Ga0070658_10109157 3300005327 Bacteria 2291
12 Ga0070658_10499897 3300005327 Bacteria 1050
13 Ga0068869_100019026 3300005334 Bacteria 4684
14 Ga0070680_100022165 3300005336 Bacteria 5054
15 Ga0070682_100166421 3300005337 Bacteria 1528
16 Ga0070682_100498859 3300005337 Bacteria 943
17 Ga0070687_100038286 3300005343 Bacteria 2403
18 Ga0070668_100011610 3300005347 Bacteria 6558
19 Ga0070668_100025351 3300005347 Bacteria 4495
20 Ga0070668_100055140 3300005347 Bacteria 3067
21 Ga0070668_100063510 3300005347 Bacteria 2862
22 Ga0070668_100132939 3300005347 Bacteria 1998
23 Ga0070668_100341187 3300005347 Bacteria 1266
24 Ga0070668_100452108 3300005347 Bacteria 1104
25 Ga0070669_100094933 3300005353 Bacteria 2242
26 Ga0070669_100391214 3300005353 Bacteria 1136
27 Ga0070671_100408620 3300005355 Bacteria 1162
28 Ga0070674_100218409 3300005356 Bacteria 1482
29 Ga0070674_100589632 3300005356 Bacteria 938
30 Ga0070659_100297076 3300005366 Bacteria 1346
31 Ga0070667_100072674 3300005367 Bacteria 2931
32 Ga0070701_10149865 3300005438 Bacteria 1342
33 Ga0070700_100332209 3300005441 Bacteria 1120
34 Ga0070663_100098802 3300005455 Bacteria 2175
35 Ga0070663_100201170 3300005455 Bacteria 1555
36 Ga0070663_100463718 3300005455 Bacteria 1046
37 Ga0070678_100057226 3300005456 Bacteria 2856
38 Ga0070678_100078023 3300005456 Bacteria 2500
39 Ga0070678_100142272 3300005456 Bacteria 1921
40 Ga0070678_100164067 3300005456 Bacteria 1803
41 Ga0070662_100004117 3300005457 Bacteria 9142
42 Ga0070662_100041912 3300005457 Bacteria 3268
43 Ga0070662_100269699 3300005457 Bacteria 1374
44 Ga0070681_10023400 3300005458 Bacteria 6212
45 Ga0068867_100094913 3300005459 Bacteria 2269
46 Ga0070699_100269739 3300005518 Bacteria 1523
47 Ga0070679_100347652 3300005530 Bacteria 1431
48 Ga0070684_100524671 3300005535 Bacteria 1098
49 Ga0070697_100348268 3300005536 Bacteria 1279
50 Ga0068853_100246480 3300005539 Bacteria 1639
51 Ga0070696_100074679 3300005546 Bacteria 2391
52 Ga0070665_100029095 3300005548 Bacteria 5561
53 Ga0070665_100088317 3300005548 Bacteria 3105
54 Ga0070665_100119765 3300005548 Bacteria 2634
55 Ga0070665_100183221 3300005548 Bacteria 2095
56 Ga0070665_100208593 3300005548 Bacteria 1954
57 Ga0070665_100366664 3300005548 Bacteria 1447
58 Ga0070665_100423184 3300005548 Bacteria 1340
59 Ga0070665_100461335 3300005548 Bacteria 1280
60 Ga0070665_100608800 3300005548 Bacteria 1105
61 Ga0070704_100265120 3300005549 Bacteria 1417
62 Ga0070664_100551324 3300005564 Bacteria 1066
63 Ga0068854_100083307 3300005578 Bacteria 2365
64 Ga0070702_100016652 3300005615 Bacteria 3775
65 Ga0068859_100026003 3300005617 Bacteria 5872
66 Ga0068866_10041919 3300005718 Bacteria 2275
67 Ga0068861_100091001 3300005719 Bacteria 2408
68 Ga0068861_100162636 3300005719 Bacteria 1842
69 Ga0068861_100348834 3300005719 Bacteria 1298
70 Ga0068861_100376096 3300005719 Bacteria 1253
71 Ga0068870_10054031 3300005840 Bacteria 2135
72 Ga0068870_10224909 3300005840 Bacteria 1151
73 Ga0068860_100064619 3300005843 Bacteria 3475
74 Ga0068860_100081532 3300005843 Bacteria 3076
75 Ga0068862_100047142 3300005844 Bacteria 3677
76 Ga0068862_100081382 3300005844 Bacteria 2809
77 Ga0068862_100099275 3300005844 Bacteria 2544
78 Ga0068862_100214149 3300005844 Bacteria 1741
79 Ga0081455_10012953 3300005937 Bacteria 8272
80 Ga0081540_1006401 3300005983 Bacteria 8583
81 Ga0081539_10000737 3300005985 Bacteria 65468
82 Ga0075365_10003516 3300006038 Bacteria 8099
83 Ga0075365_10037539 3300006038 Bacteria 3146
84 Ga0075365_10171178 3300006038 Bacteria 1516
85 Ga0075365_10178371 3300006038 Bacteria 1485
86 Ga0075365_10242126 3300006038 Bacteria 1267
87 Ga0075368_10046577 3300006042 Unclassified 1715
88 Ga0075363_100025060 3300006048 Bacteria 3038
89 Ga0075363_100220975 3300006048 Bacteria 1086
90 Ga0075364_10082837 3300006051 Bacteria 2122
91 Ga0075364_10122698 3300006051 Bacteria 1740
92 Ga0075362_10012399 3300006177 Bacteria 3385
93 Ga0075367_10035342 3300006178 Unclassified 2892
94 Ga0075367_10089796 3300006178 Bacteria 1868
95 Ga0075369_10102051 3300006186 Bacteria 1288
96 Ga0075370_10011359 3300006353 Bacteria 4676
97 Ga0075428_100047973 3300006844 Unclassified 4689
98 Ga0075428_100217122 3300006844 Bacteria 2066
99 Ga0075428_100475264 3300006844 Bacteria 1338
100 Ga0075428_100788626 3300006844 Bacteria 1010
101 Ga0075430_100136898 3300006846 Bacteria 2040
102 Ga0075431_100570145 3300006847 Bacteria 1118
103 Ga0068865_100004347 3300006881 Bacteria 8548
104 Ga0068865_100395353 3300006881 Bacteria 1131
105 Ga0097620_100026006 3300006931 Bacteria 5872
106 Ga0075435_100152784 3300007076 Bacteria 1942
107 Ga0099795_10002852 3300007788 Bacteria 4177
108 Ga0105250_10067158 3300009092 Bacteria 1446
109 Ga0111539_10084388 3300009094 Unclassified 3734
110 Ga0111539_10417720 3300009094 Bacteria 1562
111 Ga0111539_10649828 3300009094 Bacteria 1228
112 Ga0105245_10004015 3300009098 Bacteria 13084
113 Ga0105245_10068840 3300009098 Bacteria 3208
114 Ga0105245_10237560 3300009098 Bacteria 1765
115 Ga0105245_10453838 3300009098 Bacteria 1291
116 Ga0105247_10119257 3300009101 Bacteria 1707
117 Ga0105247_10263119 3300009101 Bacteria 1183
118 Ga0114129_10165922 3300009147 Bacteria 3014
119 Ga0114129_10496696 3300009147 Bacteria 1594
120 Ga0105243_10160096 3300009148 Bacteria 1940
121 Ga0105242_10048044 3300009176 Bacteria 3467
122 Ga0105248_10520662 3300009177 Bacteria 1341
123 Ga0105238_10124884 3300009551 Bacteria 2553
124 Ga0105249_10067607 3300009553 Bacteria 3293
125 Ga0099796_10031571 3300010159 Bacteria 1729
126 Ga0105246_10164114 3300011119 Bacteria 1695
127 Ga0105246_10233375 3300011119 Bacteria 1450
128 Ga0105246_10464767 3300011119 Bacteria 1067
129 Ga0105246_10617121 3300011119 Bacteria 939
130 Ga0157374_10063432 3300013296 Bacteria 3465
131 Ga0157374_10516437 3300013296 Bacteria 1200
132 Ga0157378_10011054 3300013297 Bacteria 7901
133 Ga0163162_10135158 3300013306 Bacteria 2576
134 Ga0163162_10623281 3300013306 Bacteria 1204
135 Ga0163162_10636267 3300013306 Bacteria 1191
136 Ga0157372_10874084 3300013307 Bacteria 1043
137 Ga0157375_10339669 3300013308 Bacteria 1667
138 Ga0157375_10511036 3300013308 Bacteria 1365
139 Ga0163163_10202658 3300014325 Bacteria 2032
140 Ga0163163_10344753 3300014325 Bacteria 1545
141 Ga0163163_10959077 3300014325 Bacteria 918
142 Ga0157380_10312590 3300014326 Bacteria 1453
143 Ga0157380_10339838 3300014326 Bacteria 1400
144 Ga0157380_10581605 3300014326 Bacteria 1104
145 Ga0157379_10091724 3300014968 Bacteria 2725
146 Ga0157379_10685361 3300014968 Bacteria 961
147 Ga0157376_10270962 3300014969 Bacteria 1595
148 Ga0157376_10314146 3300014969 Bacteria 1487
149 Ga0163161_10085342 3300017792 Bacteria 2329
150 Ga0209148_1000462 3300025254 Bacteria 43711
151 Ga0209455_1000870 3300025272 Bacteria 16003
152 Ga0209758_1000140 3300025297 Bacteria 174267
153 Ga0209758_1017704 3300025297 Bacteria 3529
154 Ga0209758_1025749 3300025297 Bacteria 2570
155 Ga0209256_1002028 3300025299 Bacteria 18027
156 Ga0209257_1002350 3300025304 Bacteria 19025
157 Ga0207682_10086946 3300025893 Bacteria 1349
158 Ga0207642_10011521 3300025899 Bacteria 3159
159 Ga0207710_10137763 3300025900 Bacteria 1176
160 Ga0207688_10130964 3300025901 Bacteria 1470
161 Ga0207643_10126624 3300025908 Bacteria 1517
162 Ga0207705_10084954 3300025909 Bacteria 2312
163 Ga0207707_10001429 3300025912 Bacteria 22080
164 Ga0207707_10046127 3300025912 Bacteria 3795
165 Ga0207663_10025281 3300025916 Bacteria 3430
166 Ga0207663_10222271 3300025916 Bacteria 1375
167 Ga0207662_10044481 3300025918 Bacteria 2621
168 Ga0207657_10036516 3300025919 Bacteria 4397
169 Ga0207652_10055889 3300025921 Bacteria 3397
170 Ga0207694_10231407 3300025924 Bacteria 1509
171 Ga0207700_10483640 3300025928 Bacteria 1094
172 Ga0207706_10027152 3300025933 Bacteria 5120
173 Ga0207706_10029379 3300025933 Bacteria 4907
174 Ga0207706_10063273 3300025933 Bacteria 3258
175 Ga0207706_10066608 3300025933 Bacteria 3169
176 Ga0207686_10012991 3300025934 Bacteria 4596
177 Ga0207709_10036047 3300025935 Bacteria 2929
178 Ga0207669_10489214 3300025937 Bacteria 982
179 Ga0207704_10579368 3300025938 Bacteria 916
180 Ga0207691_10013516 3300025940 Bacteria 7808
181 Ga0207691_10163515 3300025940 Bacteria 1951
182 Ga0207689_10012148 3300025942 Bacteria 7371
183 Ga0207689_10025703 3300025942 Bacteria 4933
184 Ga0207689_10239478 3300025942 Bacteria 1500
185 Ga0207712_10035509 3300025961 Bacteria 3388
186 Ga0207668_10229001 3300025972 Bacteria 1497
187 Ga0207668_10343027 3300025972 Bacteria 1246
188 Ga0207668_10383071 3300025972 Bacteria 1184
189 Ga0207640_10045787 3300025981 Bacteria 2811
190 Ga0207677_10027440 3300026023 Bacteria 3586
191 Ga0207677_10060072 3300026023 Bacteria 2626
192 Ga0207639_10169530 3300026041 Bacteria 1847
193 Ga0207678_10011242 3300026067 Bacteria 7860
194 Ga0207678_10014065 3300026067 Bacteria 7037
195 Ga0207678_10021209 3300026067 Bacteria 5695
196 Ga0207678_10031040 3300026067 Bacteria 4663
197 Ga0207678_10084356 3300026067 Bacteria 2717
198 Ga0207678_10100497 3300026067 Bacteria 2471
199 Ga0207678_10156416 3300026067 Bacteria 1946
200 Ga0207678_10264040 3300026067 Bacteria 1476
201 Ga0207678_10273009 3300026067 Bacteria 1450
202 Ga0207708_10060639 3300026075 Bacteria 2887
203 Ga0207708_10171012 3300026075 Bacteria 1721
204 Ga0207648_10010726 3300026089 Bacteria 8662
205 Ga0207675_100031707 3300026118 Bacteria 4924
206 Ga0207675_100186034 3300026118 Bacteria 1991
207 Ga0207675_100228575 3300026118 Bacteria 1794
208 Ga0207683_10048458 3300026121 Bacteria 3720
209 Ga0207683_10063932 3300026121 Bacteria 3242
210 Ga0207683_10174913 3300026121 Bacteria 1945
211 Ga0207698_10040306 3300026142 Bacteria 3469
212 Ga0209179_1001150 3300027512 Bacteria 3102
213 Ga0209983_1036254 3300027665 Bacteria 1060
214 Ga0209813_10072617 3300027866 Bacteria 1122
215 Ga0207428_10124214 3300027907 Bacteria 1977
216 Ga0268266_10027379 3300028379 Bacteria 4847
217 Ga0268266_10066199 3300028379 Bacteria 3124
218 Ga0268266_10137830 3300028379 Bacteria 2187
219 Ga0268266_10143370 3300028379 Bacteria 2145
220 Ga0268266_10256099 3300028379 Bacteria 1620
221 Ga0268266_10631075 3300028379 Bacteria 1030
222 Ga0268265_10254158 3300028380 Bacteria 1558
223 Ga0268264_10054016 3300028381 Bacteria 3353
224 Ga0307517_10057283 3300028786 Bacteria 3779
225 Ga0307408_100061913 3300031548 Bacteria 2733
226 Ga0307408_100105705 3300031548 Bacteria 2153
227 Ga0307408_100355376 3300031548 Bacteria 1245
228 Ga0316579_10030348 3300031691 Bacteria 2470
229 Ga0316579_10053303 3300031691 Bacteria 1895
230 Ga0307516_10071747 3300031730 Bacteria 3324
231 Ga0307516_10316716 3300031730 Bacteria 1232
232 Ga0307405_10022480 3300031731 Bacteria 3566
233 Ga0307413_10085861 3300031824 Bacteria 2033
234 Ga0307412_10031710 3300031911 Bacteria 3341
235 Ga0307412_10116224 3300031911 Bacteria 1919
236 Ga0307412_10170044 3300031911 Bacteria 1629
237 Ga0307409_100676868 3300031995 Bacteria 1028
238 Ga0307416_100110595 3300032002 Bacteria 2420
239 Ga0307416_100256404 3300032002 Bacteria 1706
240 Ga0307414_10370567 3300032004 Bacteria 1235
241 Ga0316583_10002192 3300032133 Bacteria 6732
242 Ga0373923_0043350 3300035111 Bacteria 1862
243 Ga0373960_0030425 3300035121 Bacteria 1504
244 Ga0373946_0026613 3300035171 Bacteria 2283
245 Ga0373931_0012556 3300035691 Bacteria 4106
246 Ga0373931_0112332 3300035691 Bacteria 1547
247 Ga0373935_0010119 3300035692 Bacteria 5648
248 Ga0373935_0048326 3300035692 Bacteria 2694
249 Ga0373927_0027596 3300035695 Bacteria 3706
250 Ga0316582_0000859 3300036647 Bacteria 12375
251 Ga0316582_0086236 3300036647 Bacteria 2059
252 Ga0316582_0152131 3300036647 Bacteria 1564
253 Ga0316584_0089973 3300036712 Bacteria 2298
254 Ga0373925_0032199 3300037068 Bacteria 3858
255 Ga0451797_0244539 3300041453 Bacteria 908
256 Ga0451807_2326971 3300041486 Bacteria 1191
257 Ga0439458_0004268 3300042157 Bacteria 3297
258 Ga0466968_0095348 3300044735 Bacteria 1323
259 Ga0451576_0096917 3300045051 Bacteria 3068
260 Ga0495603_0050930 3300046455 Bacteria 2461
261 Ga0495603_0095020 3300046455 Bacteria 1741
262 Ga0495603_0140100 3300046455 Bacteria 1407
263 Ga0495629_0006842 3300046459 Bacteria 8425
264 Ga0495629_0188132 3300046459 Bacteria 1429
265 Ga0495638_0000150 3300046460 Bacteria 109804
266 Ga0495641_0044684 3300046461 Bacteria 2042
267 Ga0495580_0165364 3300046472 Bacteria 1530
268 Ga0495582_0010966 3300046473 Bacteria 4988
269 Ga0495582_0084691 3300046473 Bacteria 1762
270 Ga0495639_0027324 3300046475 Bacteria 2525
271 Ga0495639_0051454 3300046475 Bacteria 1873
272 Ga0495662_0181482 3300046476 Bacteria 1037
273 Ga0495585_0208797 3300046492 Bacteria 991
274 Ga0495585_0263143 3300046492 Bacteria 857
275 Ga0495594_0028219 3300046499 Bacteria 3027
276 Ga0495594_0064465 3300046499 Bacteria 2031
277 Ga0495596_0065875 3300046500 Bacteria 1409
278 Ga0495596_0075070 3300046500 Bacteria 1313
279 Ga0495606_0000903 3300046507 Bacteria 44130
280 Ga0495610_0105999 3300046512 Bacteria 1252
281 Ga0495610_0145983 3300046512 Unclassified 1013
282 Ga0495616_0130537 3300046513 Bacteria 1152
283 Ga0495620_0097427 3300046515 Bacteria 1175
284 Ga0495631_0072995 3300046518 Bacteria 1482
285 Ga0495644_0036069 3300046523 Bacteria 1866
286 Ga0495648_0086271 3300046524 Bacteria 1771
287 Ga0495648_0202395 3300046524 Bacteria 993
288 Ga0495640_0157280 3300046533 Bacteria 1458
289 Ga0495609_0044941 3300046538 Bacteria 1980
290 Ga0495622_0132183 3300046557 Bacteria 1136
291 Ga0495656_0037223 3300046615 Bacteria 2008
292 Ga0495668_0178890 3300046616 Bacteria 1162
293 Ga0495634_0112918 3300046642 Bacteria 1746
294 Ga0495625_0001809 3300046660 Bacteria 24504
295 Ga0495625_0024193 3300046660 Bacteria 4627
296 Ga0495625_0059452 3300046660 Bacteria 2712
297 Ga0495625_0159338 3300046660 Bacteria 1513
298 Ga0495635_0142287 3300046663 Bacteria 1633
299 Ga0495659_0012271 3300046664 Bacteria 2772
300 Ga0495661_0017097 3300046665 Bacteria 4793
301 Ga0495661_0183756 3300046665 Bacteria 1106
302 Ga0495646_0144108 3300046680 Bacteria 1330
303 Ga0495658_0008531 3300046683 Bacteria 5082
304 Ga0495658_0118866 3300046683 Bacteria 1596
305 Ga0495669_0084839 3300046684 Bacteria 1457
306 Ga0495613_0005999 3300046689 Bacteria 9096
307 Ga0495624_0101728 3300046690 Bacteria 1769
308 Ga0495670_0055160 3300046691 Bacteria 1992
309 Ga0495671_0228243 3300046692 Bacteria 901
310 Ga0495649_0023140 3300046694 Bacteria 3471
311 Ga0495649_0137567 3300046694 Bacteria 1287
312 Ga0495581_0138802 3300047315 Bacteria 1417
313 Ga0495581_0255099 3300047315 Bacteria 1026
314 Ga0495674_0210941 3300047319 Bacteria 1608
315 Ga0495676_0085929 3300047321 Bacteria 2369
316 Ga0495677_0036356 3300047445 Bacteria 1799
317 Ga0495681_0132240 3300047470 Bacteria 1061
318 Ga0495686_0000013 3300047472 Bacteria 489656
319 Ga0495686_0123605 3300047472 Bacteria 1540
320 Ga0495593_0015498 3300047673 Bacteria 4316
321 Ga0495593_0072596 3300047673 Bacteria 1786
322 Ga0495615_0026962 3300048090 Bacteria 1345
323 Ga0496100_0057817 3300048903 Bacteria 2542
324 Ga0496100_0114227 3300048903 Bacteria 1881
325 Ga0496101_0060471 3300048904 Bacteria 2749
326 Ga0496101_0120763 3300048904 Bacteria 1981
327 Ga0496102_0032216 3300048905 Bacteria 4709
328 Ga0496102_0056888 3300048905 Bacteria 3569
329 Ga0496102_0069162 3300048905 Bacteria 3241
330 Ga0496102_0145034 3300048905 Bacteria 2228
331 Ga0496102_0212613 3300048905 Bacteria 1823
332 Ga0496102_0293788 3300048905 Bacteria 1532
333 Ga0496102_0334550 3300048905 Bacteria 1426
334 Ga0496103_0388564 3300048906 Bacteria 896
335 Ga0496104_0119992 3300048907 Bacteria 2525
336 Ga0496104_0155689 3300048907 Bacteria 2193
337 Ga0496105_0385956 3300048908 Bacteria 1114
338 Ga0496106_0011117 3300048909 Bacteria 6657
339 Ga0496106_0128575 3300048909 Bacteria 1985
340 Ga0496106_0140854 3300048909 Bacteria 1897
341 Ga0496106_0441147 3300048909 Bacteria 1046
342 Ga0496106_0541263 3300048909 Bacteria 934
343 Ga0496107_0026368 3300048910 Bacteria 4119
344 Ga0496107_0030984 3300048910 Bacteria 3814
345 Ga0496107_0069619 3300048910 Bacteria 2554
346 Ga0496108_0001200 3300048911 Bacteria 20310
347 Ga0496108_0519367 3300048911 Bacteria 1040
348 Ga0496109_0003922 3300048912 Bacteria 12432
349 Ga0496109_0308020 3300048912 Bacteria 1494
350 Ga0496110_0218571 3300048913 Bacteria 1733
351 Ga0496110_0289418 3300048913 Bacteria 1492
352 Ga0496112_0250273 3300048915 Bacteria 1723
353 Ga0496112_0389546 3300048915 Bacteria 1334
354 Ga0496113_0265796 3300048916 Bacteria 1371
355 Ga0496113_0413414 3300048916 Bacteria 1083
356 Ga0496114_0657001 3300048917 Bacteria 922
357 Ga0496115_0027901 3300048918 Bacteria 4420
358 Ga0496115_0035076 3300048918 Bacteria 3968
359 Ga0496115_0128425 3300048918 Bacteria 2089
360 Ga0496117_0169467 3300048920 Bacteria 1269
361 Ga0496118_0239691 3300048921 Bacteria 1039
362 Ga0496121_0078638 3300048924 Bacteria 2621
363 Ga0496121_0112308 3300048924 Bacteria 2076
364 Ga0496125_0001203 3300048928 Bacteria 38917
365 Ga0496125_0040419 3300048928 Bacteria 4002
366 Ga0496126_0013029 3300048929 Bacteria 8485
367 Ga0496126_0026642 3300048929 Bacteria 5539
368 Ga0496126_0120839 3300048929 Bacteria 2272
369 Ga0495682_0050787 3300049460 Bacteria 1509
370 Ga0501031_0288295 3300049568 Bacteria 1064
371 Ga0501032_0049685 3300049569 Bacteria 2830
372 Ga0501034_0075156 3300049571 Bacteria 3386
373 Ga0501039_0060554 3300049575 Bacteria 2932
374 Ga0501039_0207323 3300049575 Bacteria 1541
375 Ga0501042_0130089 3300049578 Bacteria 1814
376 Ga0501067_0281580 3300049583 Bacteria 926
377 Ga0501072_0113920 3300049588 Bacteria 2153
378 Ga0501076_0495285 3300049592 Bacteria 1007
379 Ga0501079_0158868 3300049741 Bacteria 1762
380 Ga0501035_0042519 3300049822 Bacteria 4098
381 nmdc:mga03683_98912_c1 3300050489 Bacteria 1280
382 nmdc:mga03n38_2842_c1 3300050490 Bacteria 5449
383 nmdc:mga00v17_133402_c1 3300050491 Unclassified 1588
384 nmdc:mga00v17_30196_c1 3300050491 Unclassified 3187
385 nmdc:mga0yw44_16666_c1 3300050492 Bacteria 3977
386 nmdc:mga0yw44_268478_c1 3300050492 Bacteria 1138
387 nmdc:mga0yw44_289388_c1 3300050492 Unclassified 1096
388 nmdc:mga0yw44_43963_c1 3300050492 Plasmid 2670
389 nmdc:mga0k408_96842_c1 3300050493 Bacteria 1737
390 nmdc:mga06z11_11035_c1 3300050494 Bacteria 3877
391 nmdc:mga06z11_36982_c1 3300050494 Bacteria 2414
392 nmdc:mga06z11_398340_c1 3300050494 Bacteria 828
393 nmdc:mga04h51_36574_c1 3300050495 Bacteria 1580
394 nmdc:mga05p37_201494_c1 3300050507 Bacteria 2410
395 nmdc:mga05p37_256241_c1 3300050507 Bacteria 2096
396 nmdc:mga05p37_576628_c1 3300050507 Bacteria 1275
397 nmdc:mga0qj67_341692_c1 3300050509 Unclassified 1211
398 nmdc:mga06r32_133350_c1 3300050510 Bacteria 2458
399 nmdc:mga06r32_161908_c1 3300050510 Bacteria 2220
400 nmdc:mga06r32_466044_c1 3300050510 Unclassified 1242
401 Ga0495619_0054293 3300053085 Bacteria 2651
402 Ga0500643_044272 3300053087 Bacteria 1294
403 Ga0500641_0005591 3300053096 Bacteria 4451
404 Ga0500641_0017892 3300053096 Bacteria 2658
405 Ga0500641_0019903 3300053096 Bacteria 2542
406 Ga0500562_004881 3300053108 Bacteria 3378
407 Ga0500562_013051 3300053108 Bacteria 2117
408 Ga0500607_063058 3300053121 Bacteria 1935
409 Ga0500652_001145 3300053131 Bacteria 8502
410 Ga0500658_0039796 3300053134 Bacteria 1880
411 Ga0500577_0000378 3300053142 Bacteria 11339
412 Ga0500586_000574 3300053145 Bacteria 7459
413 Ga0500616_0000036 3300053153 Bacteria 390769
414 Ga0500616_0002488 3300053153 Bacteria 15274
415 Ga0500616_0063653 3300053153 Bacteria 1901
416 Ga0500616_0070832 3300053153 Bacteria 1778
417 Ga0501082_0439416 3300060353 Bacteria 1140
418 2513696481 2513237101 Bacteria 7952346
419 2513872913 2513237139 Bacteria 8737671
420 2514013672 2513237161 Bacteria 8871253
421 2596375236 2595698237 Bacteria 6712432
422 2617347371 2617270735 Bacteria 9163226
423 2723842987 2721755755 Bacteria 8322773
424 2792460865 2791355048 Bacteria 5832535
425 2793082458
426 2805915189 2802429603 Bacteria 8777136
427 2824602900 2824600985 Bacteria 8488197
428 2824611877 2824609381 Bacteria 8672835
429 2824660931 2824653114 Bacteria 8493680
430 2824701494 2824696289 Bacteria 8335049
431 2824752328 2824746037 Bacteria 7911610
432 2824780879 2824773399 Bacteria 8360218
433 2829748386 2829745981 Bacteria 5406054
434 2840882693 2840878972 Bacteria 5483153
435 2843745475 2843744320 Bacteria 5659202
436 2847946712 2847939898 Bacteria 8606328
437 2849079169 2849076700 Bacteria 7039503
438 2849561088 2849560528 Bacteria 5393480
439 2849578553 2849573788 Bacteria 5421256
440 2851157124 2851153111 Bacteria 5542585
441 2857514162 2857509624 Bacteria 7472071
442 2857529811 2857524615 Bacteria 6615449
443 2861695749 2861691609 Bacteria 5628931
444 2874606358 2874604998 Bacteria 7834745
445 2885373011 2885366525 Bacteria 8326213
446 2888425712 2888419890 Bacteria 7857137
447 2889033716 2889033259 Bacteria 9099371
448 2902407546 2902405164 Bacteria 6784948
449 2922390145 2922386360 Bacteria 7017218
450 2922400651 2922393267 Bacteria 8285685
451 2928126553 2928125067 Bacteria 5937560
452 3003672152 3003665799 Bacteria 7279786
453 3003672513 3003665799 Bacteria 7279786
454 3005510472 3005506211 Bacteria 6943378
455 8006966615 8006964411 Bacteria 8966052
456 8006989459 8006984368 Bacteria 9651211
457 8006997926 8006994254 Bacteria 8309700
458 8056674954 8056673599 Bacteria 7871253
459 rootH1_10270102
460 JGI25406J46586_10005123
461 JGI25153J46596_10000703
462 JGI25153J46596_10004919
463 rootL2_10113382
464 rootL2_10338969
465 JGI25404J52841_10000420
466 Ga0055531_10004834
467 Ga0065165_1004197
468 Ga0065165_1005620
469 Ga0070658_10109157
470 Ga0070658_10499897
471 Ga0068869_100019026
472 Ga0070680_100022165
473 Ga0070682_100166421
474 Ga0070682_100498859
475 Ga0070687_100038286
476 Ga0070668_100011610
477 Ga0070668_100025351
478 Ga0070668_100055140
479 Ga0070668_100063510
480 Ga0070668_100132939
481 Ga0070668_100341187
482 Ga0070668_100452108
483 Ga0070669_100094933
484 Ga0070669_100391214
485 Ga0070671_100408620
486 Ga0070674_100218409
487 Ga0070674_100589632
488 Ga0070659_100297076
489 Ga0070667_100072674
490 Ga0070701_10149865
491 Ga0070700_100332209
492 Ga0070663_100098802
493 Ga0070663_100201170
494 Ga0070663_100463718
495 Ga0070678_100057226
496 Ga0070678_100078023
497 Ga0070678_100142272
498 Ga0070678_100164067
499 Ga0070662_100004117
500 Ga0070662_100041912
501 Ga0070662_100269699
502 Ga0070681_10023400
503 Ga0068867_100094913
504 Ga0070699_100269739
505 Ga0070679_100347652
506 Ga0070684_100524671
507 Ga0070697_100348268
508 Ga0068853_100246480
509 Ga0070696_100074679
510 Ga0070665_100029095
511 Ga0070665_100088317
512 Ga0070665_100119765
513 Ga0070665_100183221
514 Ga0070665_100208593
515 Ga0070665_100366664
516 Ga0070665_100423184
517 Ga0070665_100461335
518 Ga0070665_100608800
519 Ga0070704_100265120
520 Ga0070664_100551324
521 Ga0068854_100083307
522 Ga0070702_100016652
523 Ga0068859_100026003
524 Ga0068866_10041919
525 Ga0068861_100091001
526 Ga0068861_100162636
527 Ga0068861_100348834
528 Ga0068861_100376096
529 Ga0068870_10054031
530 Ga0068870_10224909
531 Ga0068860_100064619
532 Ga0068860_100081532
533 Ga0068862_100047142
534 Ga0068862_100081382
535 Ga0068862_100099275
536 Ga0068862_100214149
537 Ga0081455_10012953
538 Ga0081540_1006401
539 Ga0081539_10000737
540 Ga0075365_10003516
541 Ga0075365_10037539
542 Ga0075365_10171178
543 Ga0075365_10178371
544 Ga0075365_10242126
545 Ga0075368_10046577
546 Ga0075363_100025060
547 Ga0075363_100220975
548 Ga0075364_10082837
549 Ga0075364_10122698
550 Ga0075362_10012399
551 Ga0075367_10035342
552 Ga0075367_10089796
553 Ga0075369_10102051
554 Ga0075370_10011359
555 Ga0075428_100047973
556 Ga0075428_100217122
557 Ga0075428_100475264
558 Ga0075428_100788626
559 Ga0075430_100136898
560 Ga0075431_100570145
561 Ga0068865_100004347
562 Ga0068865_100395353
563 Ga0097620_100026006
564 Ga0075435_100152784
565 Ga0099795_10002852
566 Ga0105250_10067158
567 Ga0111539_10084388
568 Ga0111539_10417720
569 Ga0111539_10649828
570 Ga0105245_10004015
571 Ga0105245_10068840
572 Ga0105245_10237560
573 Ga0105245_10453838
574 Ga0105247_10119257
575 Ga0105247_10263119
576 Ga0114129_10165922
577 Ga0114129_10496696
578 Ga0105243_10160096
579 Ga0105242_10048044
580 Ga0105248_10520662
581 Ga0105238_10124884
582 Ga0105249_10067607
583 Ga0099796_10031571
584 Ga0105246_10164114
585 Ga0105246_10233375
586 Ga0105246_10464767
587 Ga0105246_10617121
588 Ga0157374_10063432
589 Ga0157374_10516437
590 Ga0157378_10011054
591 Ga0163162_10135158
592 Ga0163162_10623281
593 Ga0163162_10636267
594 Ga0157372_10874084
595 Ga0157375_10339669
596 Ga0157375_10511036
597 Ga0163163_10202658
598 Ga0163163_10344753
599 Ga0163163_10959077
600 Ga0157380_10312590
601 Ga0157380_10339838
602 Ga0157380_10581605
603 Ga0157379_10091724
604 Ga0157379_10685361
605 Ga0157376_10270962
606 Ga0157376_10314146
607 Ga0163161_10085342
608 Ga0209148_1000462
609 Ga0209455_1000870
610 Ga0209758_1000140
611 Ga0209758_1017704
612 Ga0209758_1025749
613 Ga0209256_1002028
614 Ga0209257_1002350
615 Ga0207682_10086946
616 Ga0207642_10011521
617 Ga0207710_10137763
618 Ga0207688_10130964
619 Ga0207643_10126624
620 Ga0207705_10084954
621 Ga0207707_10001429
622 Ga0207707_10046127
623 Ga0207663_10025281
624 Ga0207663_10222271
625 Ga0207662_10044481
626 Ga0207657_10036516
627 Ga0207652_10055889
628 Ga0207694_10231407
629 Ga0207700_10483640
630 Ga0207706_10027152
631 Ga0207706_10029379
632 Ga0207706_10063273
633 Ga0207706_10066608
634 Ga0207686_10012991
635 Ga0207709_10036047
636 Ga0207669_10489214
637 Ga0207704_10579368
638 Ga0207691_10013516
639 Ga0207691_10163515
640 Ga0207689_10012148
641 Ga0207689_10025703
642 Ga0207689_10239478
643 Ga0207712_10035509
644 Ga0207668_10229001
645 Ga0207668_10343027
646 Ga0207668_10383071
647 Ga0207640_10045787
648 Ga0207677_10027440
649 Ga0207677_10060072
650 Ga0207639_10169530
651 Ga0207678_10011242
652 Ga0207678_10014065
653 Ga0207678_10021209
654 Ga0207678_10031040
655 Ga0207678_10084356
656 Ga0207678_10100497
657 Ga0207678_10156416
658 Ga0207678_10264040
659 Ga0207678_10273009
660 Ga0207708_10060639
661 Ga0207708_10171012
662 Ga0207648_10010726
663 Ga0207675_100031707
664 Ga0207675_100186034
665 Ga0207675_100228575
666 Ga0207683_10048458
667 Ga0207683_10063932
668 Ga0207683_10174913
669 Ga0207698_10040306
670 Ga0209179_1001150
671 Ga0209983_1036254
672 Ga0209813_10072617
673 Ga0207428_10124214
674 Ga0268266_10027379
675 Ga0268266_10066199
676 Ga0268266_10137830
677 Ga0268266_10143370
678 Ga0268266_10256099
679 Ga0268266_10631075
680 Ga0268265_10254158
681 Ga0268264_10054016
682 Ga0307517_10057283
683 Ga0307408_100061913
684 Ga0307408_100105705
685 Ga0307408_100355376
686 Ga0316579_10030348
687 Ga0316579_10053303
688 Ga0307516_10071747
689 Ga0307516_10316716
690 Ga0307405_10022480
691 Ga0307413_10085861
692 Ga0307412_10031710
693 Ga0307412_10116224
694 Ga0307412_10170044
695 Ga0307409_100676868
696 Ga0307416_100110595
697 Ga0307416_100256404
698 Ga0307414_10370567
699 Ga0316583_10002192
700 Ga0373923_0043350
701 Ga0373960_0030425
702 Ga0373946_0026613
703 Ga0373931_0012556
704 Ga0373931_0112332
705 Ga0373935_0010119
706 Ga0373935_0048326
707 Ga0373927_0027596
708 Ga0316582_0000859
709 Ga0316582_0086236
710 Ga0316582_0152131
711 Ga0316584_0089973
712 Ga0373925_0032199
713 Ga0451797_0244539
714 Ga0451807_2326971
715 Ga0439458_0004268
716 Ga0466968_0095348
717 Ga0451576_0096917
718 Ga0495603_0050930
719 Ga0495603_0095020
720 Ga0495603_0140100
721 Ga0495629_0006842
722 Ga0495629_0188132
723 Ga0495638_0000150
724 Ga0495641_0044684
725 Ga0495580_0165364
726 Ga0495582_0010966
727 Ga0495582_0084691
728 Ga0495639_0027324
729 Ga0495639_0051454
730 Ga0495662_0181482
731 Ga0495585_0208797
732 Ga0495585_0263143
733 Ga0495594_0028219
734 Ga0495594_0064465
735 Ga0495596_0065875
736 Ga0495596_0075070
737 Ga0495606_0000903
738 Ga0495610_0105999
739 Ga0495610_0145983
740 Ga0495616_0130537
741 Ga0495620_0097427
742 Ga0495631_0072995
743 Ga0495644_0036069
744 Ga0495648_0086271
745 Ga0495648_0202395
746 Ga0495640_0157280
747 Ga0495609_0044941
748 Ga0495622_0132183
749 Ga0495656_0037223
750 Ga0495668_0178890
751 Ga0495634_0112918
752 Ga0495625_0001809
753 Ga0495625_0024193
754 Ga0495625_0059452
755 Ga0495625_0159338
756 Ga0495635_0142287
757 Ga0495659_0012271
758 Ga0495661_0017097
759 Ga0495661_0183756
760 Ga0495646_0144108
761 Ga0495658_0008531
762 Ga0495658_0118866
763 Ga0495669_0084839
764 Ga0495613_0005999
765 Ga0495624_0101728
766 Ga0495670_0055160
767 Ga0495671_0228243
768 Ga0495649_0023140
769 Ga0495649_0137567
770 Ga0495581_0138802
771 Ga0495581_0255099
772 Ga0495674_0210941
773 Ga0495676_0085929
774 Ga0495677_0036356
775 Ga0495681_0132240
776 Ga0495686_0000013
777 Ga0495686_0123605
778 Ga0495593_0015498
779 Ga0495593_0072596
780 Ga0495615_0026962
781 Ga0496100_0057817
782 Ga0496100_0114227
783 Ga0496101_0060471
784 Ga0496101_0120763
785 Ga0496102_0032216
786 Ga0496102_0056888
787 Ga0496102_0069162
788 Ga0496102_0145034
789 Ga0496102_0212613
790 Ga0496102_0293788
791 Ga0496102_0334550
792 Ga0496103_0388564
793 Ga0496104_0119992
794 Ga0496104_0155689
795 Ga0496105_0385956
796 Ga0496106_0011117
797 Ga0496106_0128575
798 Ga0496106_0140854
799 Ga0496106_0441147
800 Ga0496106_0541263
801 Ga0496107_0026368
802 Ga0496107_0030984
803 Ga0496107_0069619
804 Ga0496108_0001200
805 Ga0496108_0519367
806 Ga0496109_0003922
807 Ga0496109_0308020
808 Ga0496110_0218571
809 Ga0496110_0289418
810 Ga0496112_0250273
811 Ga0496112_0389546
812 Ga0496113_0265796
813 Ga0496113_0413414
814 Ga0496114_0657001
815 Ga0496115_0027901
816 Ga0496115_0035076
817 Ga0496115_0128425
818 Ga0496117_0169467
819 Ga0496118_0239691
820 Ga0496121_0078638
821 Ga0496121_0112308
822 Ga0496125_0001203
823 Ga0496125_0040419
824 Ga0496126_0013029
825 Ga0496126_0026642
826 Ga0496126_0120839
827 Ga0495682_0050787
828 Ga0501031_0288295
829 Ga0501032_0049685
830 Ga0501034_0075156
831 Ga0501039_0060554
832 Ga0501039_0207323
833 Ga0501042_0130089
834 Ga0501067_0281580
835 Ga0501072_0113920
836 Ga0501076_0495285
837 Ga0501079_0158868
838 Ga0501035_0042519
839 nmdc:mga03683_98912_c1
840 nmdc:mga03n38_2842_c1
841 nmdc:mga00v17_133402_c1
842 nmdc:mga00v17_30196_c1
843 nmdc:mga0yw44_16666_c1
844 nmdc:mga0yw44_268478_c1
845 nmdc:mga0yw44_289388_c1
846 nmdc:mga0yw44_43963_c1
847 nmdc:mga0k408_96842_c1
848 nmdc:mga06z11_11035_c1
849 nmdc:mga06z11_36982_c1
850 nmdc:mga06z11_398340_c1
851 nmdc:mga04h51_36574_c1
852 nmdc:mga05p37_201494_c1
853 nmdc:mga05p37_256241_c1
854 nmdc:mga05p37_576628_c1
855 nmdc:mga0qj67_341692_c1
856 nmdc:mga06r32_133350_c1
857 nmdc:mga06r32_161908_c1
858 nmdc:mga06r32_466044_c1
859 Ga0495619_0054293
860 Ga0500643_044272
861 Ga0500641_0005591
862 Ga0500641_0017892
863 Ga0500641_0019903
864 Ga0500562_004881
865 Ga0500562_013051
866 Ga0500607_063058
867 Ga0500652_001145
868 Ga0500658_0039796
869 Ga0500577_0000378
870 Ga0500586_000574
871 Ga0500616_0000036
872 Ga0500616_0002488
873 Ga0500616_0063653
874 Ga0500616_0070832
875 Ga0501082_0439416
876 2513696481
877 2513872913
878 2514013672
879 2596375236
880 2617347371
881 2723842987
882 2792460865
883 2793082458
884 2805915189
885 2824602900
886 2824611877
887 2824660931
888 2824701494
889 2824752328
890 2824780879
891 2829748386
892 2840882693
893 2843745475
894 2847946712
895 2849079169
896 2849561088
897 2849578553
898 2851157124
899 2857514162
900 2857529811
901 2861695749
902 2874606358
903 2885373011
904 2888425712
905 2889033716
906 2902407546
907 2922390145
908 2922400651
909 2928126553
910 3003672152
911 3003672513
912 3005510472
913 8006966615
914 8006989459
915 8006997926
916 8056674954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00520

Ion_trans

Ion transport protein

170

254

0.87

PF07885

Ion_trans_2

Ion channel

176

252

0.82

Map