F448127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 458 | 251 | 452 | 407 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100142368|Ga0068868_1001423682 |
| Length | 435 |
| Sequence | MTDQRPAGGHAANRSDAADAPRTPREEQGPEDDFDRGVKNRRAVLGDAWVDKSLDNANTFNAEFQDLITRYAWHDIWGRPGLDHTTRRLLVLGMTMGLARWEEFELHCRAAIRGGVPLASIKETLMQGAIYCGVPAANTAFKLTMDILRAEGLVPASQPLSASIRPSRHHTFSQPQLAVSVQGAGTPIVLSHALGLDQRMWDGLASTLAPRHAVLRYDHRGHGASAVPAGPYTMDELVDDAARLIREWGRGPVAWVGLSMGGMVGQGLAIRHPSLLRGLVIANSSSRYPDAAKAMWAERIAKVEQGGLAAIADMVIERYFSAAFRTEHADVVAGYRRRLLLTDPAGYAANCPAIRDVDWLDRLGEIRCPTLVIAGAQDVGAPVAMSEAMKERIPDAELVVIDAASHLSVVEQPAAFEAALDRFLVRLDGGPTPTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 7 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 164 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 237 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 240 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 241 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 242 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 243 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 245 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 247 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 248 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 249 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 250 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 251 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 0 |
| Isolates | 1.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.97 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 77.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000106 | 3300002738 | Bacteria | 74019 |
| 2 | JGI25157J39369_1000154 | 3300002741 | Bacteria | 57286 |
| 3 | JGI25152J39213_1002069 | 3300002773 | Bacteria | 7896 |
| 4 | JGI25153J46596_10000500 | 3300003215 | Bacteria | 24942 |
| 5 | JGI25153J46596_10003835 | 3300003215 | Bacteria | 8281 |
| 6 | rootH2_10039676 | 3300003320 | Bacteria | 2795 |
| 7 | rootL2_10046474 | 3300003322 | Bacteria | 1983 |
| 8 | rootL2_10050395 | 3300003322 | Bacteria | 6317 |
| 9 | rootH1_10019588 | 3300003316 | Bacteria | 4902 |
| 10 | rootH1_10019588 | 3300003323 | Bacteria | 4711 |
| 11 | Ga0055539_1000160 | 3300003752 | Bacteria | 63531 |
| 12 | Ga0055533_1000162 | 3300003756 | Bacteria | 63221 |
| 13 | Ga0055535_1000403 | 3300003761 | Bacteria | 40654 |
| 14 | Ga0055529_1000195 | 3300003763 | Bacteria | 82315 |
| 15 | Ga0055530_10003147 | 3300003791 | Bacteria | 9723 |
| 16 | Ga0065165_1007460 | 3300005262 | Bacteria | 5364 |
| 17 | Ga0070676_10094449 | 3300005328 | Bacteria | 1837 |
| 18 | Ga0070676_10163966 | 3300005328 | Bacteria | 1432 |
| 19 | Ga0070690_100078300 | 3300005330 | Bacteria | 2159 |
| 20 | Ga0070670_100005189 | 3300005331 | Bacteria | 10966 |
| 21 | Ga0070670_100021421 | 3300005331 | Bacteria | 5561 |
| 22 | Ga0070670_100078158 | 3300005331 | Bacteria | 2842 |
| 23 | Ga0070670_100097868 | 3300005331 | Bacteria | 2524 |
| 24 | Ga0070677_10002208 | 3300005333 | Bacteria | 6219 |
| 25 | Ga0070677_10011847 | 3300005333 | Bacteria | 3017 |
| 26 | Ga0070677_10012207 | 3300005333 | Bacteria | 2979 |
| 27 | Ga0068869_100007643 | 3300005334 | Bacteria | 6922 |
| 28 | Ga0070666_10048871 | 3300005335 | Bacteria | 2842 |
| 29 | Ga0070666_10155094 | 3300005335 | Bacteria | 1599 |
| 30 | Ga0070680_100004941 | 3300005336 | Bacteria | 10040 |
| 31 | Ga0068868_100022227 | 3300005338 | Bacteria | 4785 |
| 32 | Ga0068868_100142368 | 3300005338 | Bacteria | 1970 |
| 33 | Ga0070689_100012922 | 3300005340 | Bacteria | 6030 |
| 34 | Ga0070687_100040346 | 3300005343 | Bacteria | 2352 |
| 35 | Ga0070661_100165550 | 3300005344 | Bacteria | 1677 |
| 36 | Ga0070668_100011645 | 3300005347 | Bacteria | 6546 |
| 37 | Ga0070675_100000175 | 3300005354 | Bacteria | 39754 |
| 38 | Ga0070675_100002079 | 3300005354 | Bacteria | 14813 |
| 39 | Ga0070675_100016398 | 3300005354 | Bacteria | 5880 |
| 40 | Ga0070675_100028246 | 3300005354 | Bacteria | 4515 |
| 41 | Ga0070675_100033316 | 3300005354 | Bacteria | 4176 |
| 42 | Ga0070675_100037150 | 3300005354 | Bacteria | 3965 |
| 43 | Ga0070671_100001332 | 3300005355 | Bacteria | 18537 |
| 44 | Ga0070671_100011153 | 3300005355 | Bacteria | 7216 |
| 45 | Ga0070671_100011585 | 3300005355 | Bacteria | 7094 |
| 46 | Ga0070671_100079008 | 3300005355 | Bacteria | 2750 |
| 47 | Ga0070671_100093665 | 3300005355 | Bacteria | 2517 |
| 48 | Ga0070671_100147759 | 3300005355 | Bacteria | 1984 |
| 49 | Ga0070674_100004092 | 3300005356 | Bacteria | 8288 |
| 50 | Ga0070674_100022958 | 3300005356 | Bacteria | 4028 |
| 51 | Ga0070673_100016869 | 3300005364 | Bacteria | 5177 |
| 52 | Ga0070673_100049783 | 3300005364 | Bacteria | 3272 |
| 53 | Ga0070673_100219086 | 3300005364 | Bacteria | 1646 |
| 54 | Ga0070667_100001024 | 3300005367 | Bacteria | 25540 |
| 55 | Ga0070667_100005220 | 3300005367 | Bacteria | 10855 |
| 56 | Ga0070667_100005561 | 3300005367 | Bacteria | 10518 |
| 57 | Ga0070667_100046530 | 3300005367 | Bacteria | 3650 |
| 58 | Ga0070667_100132854 | 3300005367 | Bacteria | 2174 |
| 59 | Ga0070700_100037646 | 3300005441 | Bacteria | 2943 |
| 60 | Ga0070663_100167804 | 3300005455 | Bacteria | 1694 |
| 61 | Ga0070678_100003065 | 3300005456 | Bacteria | 9263 |
| 62 | Ga0070678_100108233 | 3300005456 | Bacteria | 2169 |
| 63 | Ga0070678_100180676 | 3300005456 | Bacteria | 1727 |
| 64 | Ga0070662_100002892 | 3300005457 | Bacteria | 10661 |
| 65 | Ga0070662_100030667 | 3300005457 | Bacteria | 3766 |
| 66 | Ga0070662_100051481 | 3300005457 | Bacteria | 2974 |
| 67 | Ga0070662_100219989 | 3300005457 | Bacteria | 1515 |
| 68 | Ga0068867_100000083 | 3300005459 | Bacteria | 58784 |
| 69 | Ga0068867_100000987 | 3300005459 | Bacteria | 19414 |
| 70 | Ga0068867_100011106 | 3300005459 | Bacteria | 6353 |
| 71 | Ga0068867_100013270 | 3300005459 | Bacteria | 5836 |
| 72 | Ga0068867_100167309 | 3300005459 | Bacteria | 1738 |
| 73 | Ga0070706_100000297 | 3300005467 | Bacteria | 60441 |
| 74 | Ga0070698_100167256 | 3300005471 | Bacteria | 2141 |
| 75 | Ga0070679_100008793 | 3300005530 | Bacteria | 9525 |
| 76 | Ga0068853_100027528 | 3300005539 | Bacteria | 4775 |
| 77 | Ga0068853_100095178 | 3300005539 | Bacteria | 2626 |
| 78 | Ga0068853_100243022 | 3300005539 | Bacteria | 1650 |
| 79 | Ga0070672_100002095 | 3300005543 | Bacteria | 12579 |
| 80 | Ga0070672_100008221 | 3300005543 | Bacteria | 7129 |
| 81 | Ga0070672_100020200 | 3300005543 | Bacteria | 4853 |
| 82 | Ga0070672_100035737 | 3300005543 | Bacteria | 3778 |
| 83 | Ga0070672_100180030 | 3300005543 | Bacteria | 1761 |
| 84 | Ga0070672_100182862 | 3300005543 | Bacteria | 1747 |
| 85 | Ga0070672_100230779 | 3300005543 | Bacteria | 1555 |
| 86 | Ga0070686_100107548 | 3300005544 | Bacteria | 1894 |
| 87 | Ga0070665_100025412 | 3300005548 | Bacteria | 5968 |
| 88 | Ga0070664_100057986 | 3300005564 | Bacteria | 3293 |
| 89 | Ga0070664_100106901 | 3300005564 | Bacteria | 2439 |
| 90 | Ga0068854_100045093 | 3300005578 | Bacteria | 3134 |
| 91 | Ga0068854_100048731 | 3300005578 | Bacteria | 3024 |
| 92 | Ga0068856_100022922 | 3300005614 | Bacteria | 6072 |
| 93 | Ga0068856_100042236 | 3300005614 | Bacteria | 4485 |
| 94 | Ga0068856_100346812 | 3300005614 | Bacteria | 1503 |
| 95 | Ga0070702_100067874 | 3300005615 | Bacteria | 2097 |
| 96 | Ga0068852_100030945 | 3300005616 | Bacteria | 4410 |
| 97 | Ga0068852_100033906 | 3300005616 | Bacteria | 4244 |
| 98 | Ga0068852_100053177 | 3300005616 | Bacteria | 3484 |
| 99 | Ga0068852_100072914 | 3300005616 | Bacteria | 3019 |
| 100 | Ga0068852_100131016 | 3300005616 | Bacteria | 2309 |
| 101 | Ga0068852_100134392 | 3300005616 | Bacteria | 2282 |
| 102 | Ga0068859_100012385 | 3300005617 | Bacteria | 8580 |
| 103 | Ga0068859_100023100 | 3300005617 | Bacteria | 6238 |
| 104 | Ga0068859_100119634 | 3300005617 | Bacteria | 2700 |
| 105 | Ga0068864_100000285 | 3300005618 | Bacteria | 45076 |
| 106 | Ga0068864_100012085 | 3300005618 | Bacteria | 7132 |
| 107 | Ga0068864_100085801 | 3300005618 | Bacteria | 2768 |
| 108 | Ga0068864_100098799 | 3300005618 | Bacteria | 2585 |
| 109 | Ga0068864_100149564 | 3300005618 | Bacteria | 2114 |
| 110 | Ga0068861_100060160 | 3300005719 | Bacteria | 2910 |
| 111 | Ga0068861_100113833 | 3300005719 | Bacteria | 2171 |
| 112 | Ga0068851_10096157 | 3300005834 | Bacteria | 1566 |
| 113 | Ga0068870_10018620 | 3300005840 | Bacteria | 3356 |
| 114 | Ga0068870_10085200 | 3300005840 | Bacteria | 1756 |
| 115 | Ga0068863_100030622 | 3300005841 | Bacteria | 5137 |
| 116 | Ga0068863_100030895 | 3300005841 | Bacteria | 5115 |
| 117 | Ga0068863_100103244 | 3300005841 | Bacteria | 2711 |
| 118 | Ga0068863_100117748 | 3300005841 | Bacteria | 2531 |
| 119 | Ga0068858_100009225 | 3300005842 | Bacteria | 9418 |
| 120 | Ga0068858_100027308 | 3300005842 | Bacteria | 5304 |
| 121 | Ga0068858_100123943 | 3300005842 | Bacteria | 2418 |
| 122 | Ga0068860_100005320 | 3300005843 | Bacteria | 13064 |
| 123 | Ga0068860_100161162 | 3300005843 | Bacteria | 2163 |
| 124 | Ga0068862_100063764 | 3300005844 | Bacteria | 3170 |
| 125 | Ga0075362_10012171 | 3300006177 | Bacteria | 3410 |
| 126 | Ga0075367_10002856 | 3300006178 | Bacteria | 8032 |
| 127 | Ga0075367_10117942 | 3300006178 | Bacteria | 1634 |
| 128 | Ga0075366_10000426 | 3300006195 | Bacteria | 19732 |
| 129 | Ga0075366_10001145 | 3300006195 | Bacteria | 13116 |
| 130 | Ga0075366_10009886 | 3300006195 | Bacteria | 5338 |
| 131 | Ga0075366_10090114 | 3300006195 | Bacteria | 1836 |
| 132 | Ga0097621_100026225 | 3300006237 | Bacteria | 4569 |
| 133 | Ga0097621_100103666 | 3300006237 | Bacteria | 2396 |
| 134 | Ga0075370_10000072 | 3300006353 | Bacteria | 31056 |
| 135 | Ga0075370_10000553 | 3300006353 | Bacteria | 14337 |
| 136 | Ga0075370_10111116 | 3300006353 | Bacteria | 1592 |
| 137 | Ga0068871_100091051 | 3300006358 | Bacteria | 2541 |
| 138 | Ga0075429_100000204 | 3300006880 | Bacteria | 39540 |
| 139 | Ga0068865_100025432 | 3300006881 | Bacteria | 3895 |
| 140 | Ga0097620_100012386 | 3300006931 | Bacteria | 8580 |
| 141 | Ga0097620_100023100 | 3300006931 | Bacteria | 6238 |
| 142 | Ga0097620_100119634 | 3300006931 | Bacteria | 2700 |
| 143 | Ga0105240_10003000 | 3300009093 | Bacteria | 26554 |
| 144 | Ga0105240_10009833 | 3300009093 | Bacteria | 13501 |
| 145 | Ga0105240_10114573 | 3300009093 | Bacteria | 3256 |
| 146 | Ga0105245_10086657 | 3300009098 | Bacteria | 2873 |
| 147 | Ga0105243_10001223 | 3300009148 | Bacteria | 23124 |
| 148 | Ga0105243_10133312 | 3300009148 | Bacteria | 2111 |
| 149 | Ga0105242_10084594 | 3300009176 | Bacteria | 2658 |
| 150 | Ga0105242_10246362 | 3300009176 | Bacteria | 1608 |
| 151 | Ga0105248_10036112 | 3300009177 | Bacteria | 5527 |
| 152 | Ga0105248_10257025 | 3300009177 | Bacteria | 1966 |
| 153 | Ga0105237_10034870 | 3300009545 | Bacteria | 5092 |
| 154 | Ga0105237_10121759 | 3300009545 | Bacteria | 2604 |
| 155 | Ga0105238_10069954 | 3300009551 | Bacteria | 3509 |
| 156 | Ga0105238_10220774 | 3300009551 | Bacteria | 1871 |
| 157 | Ga0105249_10032996 | 3300009553 | Bacteria | 4686 |
| 158 | Ga0105239_10000417 | 3300010375 | Bacteria | 62040 |
| 159 | Ga0157369_10389242 | 3300013105 | Bacteria | 1447 |
| 160 | Ga0157374_10010807 | 3300013296 | Bacteria | 7874 |
| 161 | Ga0163162_10058814 | 3300013306 | Bacteria | 3874 |
| 162 | Ga0163162_10098721 | 3300013306 | Bacteria | 3010 |
| 163 | Ga0163162_10178021 | 3300013306 | Bacteria | 2252 |
| 164 | Ga0157372_10380026 | 3300013307 | Bacteria | 1646 |
| 165 | Ga0157375_10012669 | 3300013308 | Bacteria | 7485 |
| 166 | Ga0157375_10025277 | 3300013308 | Bacteria | 5514 |
| 167 | Ga0157375_10042236 | 3300013308 | Bacteria | 4412 |
| 168 | Ga0157375_10097173 | 3300013308 | Bacteria | 3019 |
| 169 | Ga0163163_10007398 | 3300014325 | Bacteria | 9694 |
| 170 | Ga0163163_10216762 | 3300014325 | Bacteria | 1963 |
| 171 | Ga0157380_10033653 | 3300014326 | Bacteria | 3947 |
| 172 | Ga0157380_10064322 | 3300014326 | Bacteria | 2944 |
| 173 | Ga0157380_10116368 | 3300014326 | Bacteria | 2256 |
| 174 | Ga0157377_10000104 | 3300014745 | Bacteria | 58794 |
| 175 | Ga0157379_10002716 | 3300014968 | Bacteria | 14935 |
| 176 | Ga0157379_10033102 | 3300014968 | Bacteria | 4609 |
| 177 | Ga0157376_10046425 | 3300014969 | Bacteria | 3582 |
| 178 | Ga0157376_10109533 | 3300014969 | Bacteria | 2428 |
| 179 | Ga0163161_10003223 | 3300017792 | Bacteria | 11481 |
| 180 | Ga0163161_10028113 | 3300017792 | Bacteria | 3991 |
| 181 | Ga0163161_10064080 | 3300017792 | Bacteria | 2680 |
| 182 | Ga0213872_10032634 | 3300021361 | Bacteria | 2386 |
| 183 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 184 | Ga0209563_100192 | 3300025230 | Bacteria | 33961 |
| 185 | Ga0207427_101622 | 3300025231 | Bacteria | 7628 |
| 186 | Ga0209258_100291 | 3300025242 | Bacteria | 82373 |
| 187 | Ga0207425_1000652 | 3300025245 | Bacteria | 19165 |
| 188 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 189 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 190 | Ga0209677_100085 | 3300025253 | Bacteria | 116046 |
| 191 | Ga0209677_100107 | 3300025253 | Bacteria | 89035 |
| 192 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 193 | Ga0209759_1010280 | 3300025256 | Bacteria | 2752 |
| 194 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 195 | Ga0209455_1000208 | 3300025272 | Bacteria | 83420 |
| 196 | Ga0209673_1012585 | 3300025273 | Bacteria | 3399 |
| 197 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 198 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 199 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 200 | Ga0209050_1000198 | 3300025298 | Bacteria | 134820 |
| 201 | Ga0209051_1000354 | 3300025303 | Bacteria | 68119 |
| 202 | Ga0209051_1007471 | 3300025303 | Bacteria | 5965 |
| 203 | Ga0207697_10008003 | 3300025315 | Bacteria | 4667 |
| 204 | Ga0207682_10003348 | 3300025893 | Bacteria | 6990 |
| 205 | Ga0207682_10016719 | 3300025893 | Bacteria | 2862 |
| 206 | Ga0207680_10006829 | 3300025903 | Bacteria | 5540 |
| 207 | Ga0207680_10177315 | 3300025903 | Bacteria | 1439 |
| 208 | Ga0207645_10010246 | 3300025907 | Bacteria | 6442 |
| 209 | Ga0207645_10020090 | 3300025907 | Bacteria | 4374 |
| 210 | Ga0207645_10037095 | 3300025907 | Bacteria | 3129 |
| 211 | Ga0207643_10023279 | 3300025908 | Bacteria | 3415 |
| 212 | Ga0207684_10006695 | 3300025910 | Bacteria | 10469 |
| 213 | Ga0207695_10004036 | 3300025913 | Bacteria | 20195 |
| 214 | Ga0207695_10022029 | 3300025913 | Bacteria | 7250 |
| 215 | Ga0207695_10080481 | 3300025913 | Bacteria | 3299 |
| 216 | Ga0207671_10042127 | 3300025914 | Bacteria | 3380 |
| 217 | Ga0207660_10118156 | 3300025917 | Bacteria | 2005 |
| 218 | Ga0207662_10058424 | 3300025918 | Bacteria | 2309 |
| 219 | Ga0207657_10035681 | 3300025919 | Bacteria | 4458 |
| 220 | Ga0207649_10142761 | 3300025920 | Bacteria | 1640 |
| 221 | Ga0207652_10079422 | 3300025921 | Bacteria | 2866 |
| 222 | Ga0207681_10023280 | 3300025923 | Bacteria | 3959 |
| 223 | Ga0207681_10102948 | 3300025923 | Bacteria | 2062 |
| 224 | Ga0207681_10142182 | 3300025923 | Bacteria | 1788 |
| 225 | Ga0207694_10044865 | 3300025924 | Bacteria | 3413 |
| 226 | Ga0207650_10000618 | 3300025925 | Bacteria | 28421 |
| 227 | Ga0207650_10001257 | 3300025925 | Bacteria | 18423 |
| 228 | Ga0207650_10015367 | 3300025925 | Bacteria | 5330 |
| 229 | Ga0207650_10052005 | 3300025925 | Bacteria | 3033 |
| 230 | Ga0207650_10160947 | 3300025925 | Bacteria | 1778 |
| 231 | Ga0207659_10000081 | 3300025926 | Bacteria | 58985 |
| 232 | Ga0207659_10000677 | 3300025926 | Bacteria | 20212 |
| 233 | Ga0207659_10005890 | 3300025926 | Bacteria | 7483 |
| 234 | Ga0207687_10040555 | 3300025927 | Bacteria | 3192 |
| 235 | Ga0207644_10000608 | 3300025931 | Bacteria | 22775 |
| 236 | Ga0207644_10007142 | 3300025931 | Bacteria | 7276 |
| 237 | Ga0207644_10007292 | 3300025931 | Bacteria | 7198 |
| 238 | Ga0207644_10026684 | 3300025931 | Bacteria | 3984 |
| 239 | Ga0207644_10093348 | 3300025931 | Bacteria | 2247 |
| 240 | Ga0207644_10131544 | 3300025931 | Bacteria | 1916 |
| 241 | Ga0207706_10000544 | 3300025933 | Bacteria | 39990 |
| 242 | Ga0207706_10019930 | 3300025933 | Bacteria | 6028 |
| 243 | Ga0207706_10031357 | 3300025933 | Bacteria | 4736 |
| 244 | Ga0207706_10040396 | 3300025933 | Bacteria | 4134 |
| 245 | Ga0207706_10141600 | 3300025933 | Bacteria | 2116 |
| 246 | Ga0207706_10252623 | 3300025933 | Bacteria | 1540 |
| 247 | Ga0207686_10042692 | 3300025934 | Bacteria | 2774 |
| 248 | Ga0207709_10003449 | 3300025935 | Bacteria | 9399 |
| 249 | Ga0207709_10136768 | 3300025935 | Bacteria | 1679 |
| 250 | Ga0207670_10002024 | 3300025936 | Bacteria | 10641 |
| 251 | Ga0207669_10002305 | 3300025937 | Bacteria | 8117 |
| 252 | Ga0207669_10068345 | 3300025937 | Bacteria | 2218 |
| 253 | Ga0207704_10029680 | 3300025938 | Bacteria | 3054 |
| 254 | Ga0207704_10040177 | 3300025938 | Bacteria | 2731 |
| 255 | Ga0207704_10057312 | 3300025938 | Bacteria | 2392 |
| 256 | Ga0207691_10001539 | 3300025940 | Bacteria | 22944 |
| 257 | Ga0207691_10004718 | 3300025940 | Bacteria | 13191 |
| 258 | Ga0207691_10033002 | 3300025940 | Bacteria | 4822 |
| 259 | Ga0207691_10050243 | 3300025940 | Bacteria | 3818 |
| 260 | Ga0207691_10052068 | 3300025940 | Bacteria | 3740 |
| 261 | Ga0207691_10102281 | 3300025940 | Bacteria | 2556 |
| 262 | Ga0207691_10271501 | 3300025940 | Bacteria | 1460 |
| 263 | Ga0207711_10018083 | 3300025941 | Bacteria | 5860 |
| 264 | Ga0207711_10262883 | 3300025941 | Bacteria | 1586 |
| 265 | Ga0207689_10000910 | 3300025942 | Bacteria | 28375 |
| 266 | Ga0207689_10007414 | 3300025942 | Bacteria | 9619 |
| 267 | Ga0207689_10009348 | 3300025942 | Bacteria | 8468 |
| 268 | Ga0207689_10071646 | 3300025942 | Bacteria | 2847 |
| 269 | Ga0207689_10154379 | 3300025942 | Bacteria | 1892 |
| 270 | Ga0207661_10117555 | 3300025944 | Bacteria | 2259 |
| 271 | Ga0207651_10000149 | 3300025960 | Bacteria | 30455 |
| 272 | Ga0207651_10002411 | 3300025960 | Bacteria | 8929 |
| 273 | Ga0207651_10046319 | 3300025960 | Bacteria | 2923 |
| 274 | Ga0207651_10102271 | 3300025960 | Bacteria | 2129 |
| 275 | Ga0207712_10038171 | 3300025961 | Bacteria | 3283 |
| 276 | Ga0207668_10026369 | 3300025972 | Bacteria | 3772 |
| 277 | Ga0207640_10037131 | 3300025981 | Bacteria | 3063 |
| 278 | Ga0207658_10000692 | 3300025986 | Bacteria | 29298 |
| 279 | Ga0207658_10002216 | 3300025986 | Bacteria | 14427 |
| 280 | Ga0207658_10007279 | 3300025986 | Bacteria | 7546 |
| 281 | Ga0207658_10093310 | 3300025986 | Bacteria | 2340 |
| 282 | Ga0207658_10268878 | 3300025986 | Bacteria | 1456 |
| 283 | Ga0207677_10001033 | 3300026023 | Bacteria | 15329 |
| 284 | Ga0207703_10000699 | 3300026035 | Bacteria | 33208 |
| 285 | Ga0207703_10003861 | 3300026035 | Bacteria | 12452 |
| 286 | Ga0207639_10032951 | 3300026041 | Bacteria | 3819 |
| 287 | Ga0207639_10084466 | 3300026041 | Bacteria | 2522 |
| 288 | Ga0207639_10106339 | 3300026041 | Bacteria | 2277 |
| 289 | Ga0207639_10141067 | 3300026041 | Bacteria | 2008 |
| 290 | Ga0207678_10004524 | 3300026067 | Bacteria | 12505 |
| 291 | Ga0207678_10134598 | 3300026067 | Bacteria | 2109 |
| 292 | Ga0207678_10227042 | 3300026067 | Bacteria | 1598 |
| 293 | Ga0207708_10050726 | 3300026075 | Bacteria | 3159 |
| 294 | Ga0207702_10289570 | 3300026078 | Bacteria | 1551 |
| 295 | Ga0207641_10000568 | 3300026088 | Bacteria | 41284 |
| 296 | Ga0207641_10002869 | 3300026088 | Bacteria | 15635 |
| 297 | Ga0207641_10015026 | 3300026088 | Bacteria | 6345 |
| 298 | Ga0207648_10000243 | 3300026089 | Bacteria | 58746 |
| 299 | Ga0207648_10012371 | 3300026089 | Bacteria | 7989 |
| 300 | Ga0207648_10016616 | 3300026089 | Bacteria | 6718 |
| 301 | Ga0207648_10040454 | 3300026089 | Bacteria | 4096 |
| 302 | Ga0207648_10046980 | 3300026089 | Bacteria | 3785 |
| 303 | Ga0207648_10049293 | 3300026089 | Bacteria | 3685 |
| 304 | Ga0207648_10077747 | 3300026089 | Bacteria | 2894 |
| 305 | Ga0207648_10123455 | 3300026089 | Bacteria | 2277 |
| 306 | Ga0207676_10000579 | 3300026095 | Bacteria | 30134 |
| 307 | Ga0207676_10013589 | 3300026095 | Bacteria | 5843 |
| 308 | Ga0207676_10015089 | 3300026095 | Bacteria | 5571 |
| 309 | Ga0207676_10030474 | 3300026095 | Bacteria | 4050 |
| 310 | Ga0207674_10002965 | 3300026116 | Bacteria | 21073 |
| 311 | Ga0207674_10039004 | 3300026116 | Bacteria | 4926 |
| 312 | Ga0207674_10088791 | 3300026116 | Bacteria | 3084 |
| 313 | Ga0207675_100026430 | 3300026118 | Bacteria | 5404 |
| 314 | Ga0207675_100033725 | 3300026118 | Bacteria | 4770 |
| 315 | Ga0207683_10004555 | 3300026121 | Bacteria | 11938 |
| 316 | Ga0207683_10008444 | 3300026121 | Bacteria | 8816 |
| 317 | Ga0207683_10071747 | 3300026121 | Bacteria | 3062 |
| 318 | Ga0207683_10083064 | 3300026121 | Bacteria | 2846 |
| 319 | Ga0207683_10198804 | 3300026121 | Bacteria | 1822 |
| 320 | Ga0207698_10010818 | 3300026142 | Bacteria | 5887 |
| 321 | Ga0207698_10039393 | 3300026142 | Bacteria | 3501 |
| 322 | Ga0207698_10065559 | 3300026142 | Bacteria | 2853 |
| 323 | Ga0207698_10094802 | 3300026142 | Bacteria | 2455 |
| 324 | Ga0207698_10104500 | 3300026142 | Bacteria | 2357 |
| 325 | Ga0209813_10006689 | 3300027866 | Bacteria | 2855 |
| 326 | Ga0268266_10043231 | 3300028379 | Bacteria | 3850 |
| 327 | Ga0268264_10004518 | 3300028381 | Bacteria | 11868 |
| 328 | Ga0268264_10008447 | 3300028381 | Bacteria | 8564 |
| 329 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 330 | Ga0307517_10009033 | 3300028786 | Bacteria | 14208 |
| 331 | Ga0307515_10011006 | 3300028794 | Bacteria | 17234 |
| 332 | Ga0307515_10092827 | 3300028794 | Bacteria | 3751 |
| 333 | Ga0307515_10161317 | 3300028794 | Bacteria | 2285 |
| 334 | Ga0307511_10040472 | 3300030521 | Bacteria | 3957 |
| 335 | Ga0307512_10011610 | 3300030522 | Bacteria | 8338 |
| 336 | Ga0307512_10072037 | 3300030522 | Bacteria | 2560 |
| 337 | Ga0307513_10180327 | 3300031456 | Bacteria | 1976 |
| 338 | Ga0307509_10023159 | 3300031507 | Bacteria | 6983 |
| 339 | Ga0307509_10087769 | 3300031507 | Bacteria | 3194 |
| 340 | Ga0307509_10205035 | 3300031507 | Bacteria | 1803 |
| 341 | Ga0307408_100034057 | 3300031548 | Bacteria | 3564 |
| 342 | Ga0307508_10012345 | 3300031616 | Bacteria | 7811 |
| 343 | Ga0307514_10071694 | 3300031649 | Bacteria | 2597 |
| 344 | Ga0307516_10004252 | 3300031730 | Bacteria | 17809 |
| 345 | Ga0307516_10195093 | 3300031730 | Bacteria | 1748 |
| 346 | Ga0307405_10008952 | 3300031731 | Bacteria | 5109 |
| 347 | Ga0307413_10010111 | 3300031824 | Bacteria | 4556 |
| 348 | Ga0307410_10013056 | 3300031852 | Bacteria | 4831 |
| 349 | Ga0307410_10029462 | 3300031852 | Bacteria | 3496 |
| 350 | Ga0307406_10037678 | 3300031901 | Bacteria | 2988 |
| 351 | Ga0307407_10001640 | 3300031903 | Bacteria | 8275 |
| 352 | Ga0307412_10027381 | 3300031911 | Bacteria | 3553 |
| 353 | Ga0307409_100002330 | 3300031995 | Bacteria | 9868 |
| 354 | Ga0307416_100019940 | 3300032002 | Bacteria | 4769 |
| 355 | Ga0307411_10044584 | 3300032005 | Bacteria | 2846 |
| 356 | Ga0307411_10065075 | 3300032005 | Bacteria | 2444 |
| 357 | Ga0307510_10006149 | 3300033180 | Bacteria | 14304 |
| 358 | Ga0307510_10030374 | 3300033180 | Bacteria | 6124 |
| 359 | Ga0307510_10086896 | 3300033180 | Bacteria | 2996 |
| 360 | Ga0373934_0019456 | 3300035086 | Bacteria | 2606 |
| 361 | Ga0373946_0043955 | 3300035171 | Bacteria | 1843 |
| 362 | Ga0373924_0017724 | 3300035410 | Bacteria | 2736 |
| 363 | Ga0373931_0107344 | 3300035691 | Bacteria | 1579 |
| 364 | Ga0373937_0071619 | 3300036401 | Bacteria | 3197 |
| 365 | Ga0373937_0072728 | 3300036401 | Bacteria | 3172 |
| 366 | Ga0373937_0078716 | 3300036401 | Bacteria | 3047 |
| 367 | Ga0373937_0117163 | 3300036401 | Bacteria | 2481 |
| 368 | Ga0395898_0010903 | 3300037466 | Bacteria | 9484 |
| 369 | Ga0395905_0032910 | 3300037471 | Bacteria | 4874 |
| 370 | Ga0395901_0001277 | 3300038443 | Bacteria | 26706 |
| 371 | Ga0395901_0135480 | 3300038443 | Bacteria | 2589 |
| 372 | Ga0436365_1520872 | 3300039437 | Bacteria | 3249 |
| 373 | Ga0436361_0033961 | 3300039447 | Bacteria | 8485 |
| 374 | Ga0436361_0253740 | 3300039447 | Bacteria | 1599 |
| 375 | Ga0466969_0013456 | 3300044656 | Bacteria | 4309 |
| 376 | Ga0466972_0001691 | 3300044658 | Bacteria | 10798 |
| 377 | Ga0466972_0062386 | 3300044658 | Bacteria | 1786 |
| 378 | Ga0466965_0010136 | 3300044683 | Bacteria | 4387 |
| 379 | Ga0466965_0046648 | 3300044683 | Bacteria | 2145 |
| 380 | Ga0466966_0000198 | 3300044684 | Bacteria | 40082 |
| 381 | Ga0466961_0100184 | 3300044693 | Bacteria | 1825 |
| 382 | Ga0466971_0018442 | 3300044719 | Bacteria | 3090 |
| 383 | Ga0466968_0064083 | 3300044735 | Bacteria | 1589 |
| 384 | Ga0466970_0043415 | 3300044765 | Bacteria | 2392 |
| 385 | Ga0466959_0011815 | 3300045049 | Bacteria | 6286 |
| 386 | Ga0466967_0087582 | 3300045976 | Bacteria | 2823 |
| 387 | Ga0495592_0000563 | 3300046454 | Bacteria | 26400 |
| 388 | Ga0495629_0011433 | 3300046459 | Bacteria | 6448 |
| 389 | Ga0495650_0001099 | 3300046471 | Bacteria | 29653 |
| 390 | Ga0495650_0021704 | 3300046471 | Bacteria | 3092 |
| 391 | Ga0495639_0025631 | 3300046475 | Bacteria | 2601 |
| 392 | Ga0495585_0007400 | 3300046492 | Bacteria | 6724 |
| 393 | Ga0495583_0000313 | 3300046506 | Bacteria | 76539 |
| 394 | Ga0495606_0001607 | 3300046507 | Bacteria | 29481 |
| 395 | Ga0495610_0075164 | 3300046512 | Bacteria | 1565 |
| 396 | Ga0495620_0063020 | 3300046515 | Bacteria | 1538 |
| 397 | Ga0495630_0043660 | 3300046517 | Bacteria | 3350 |
| 398 | Ga0495632_0004566 | 3300046519 | Bacteria | 9381 |
| 399 | Ga0495597_0012015 | 3300046542 | Bacteria | 4185 |
| 400 | Ga0495645_0196141 | 3300046543 | Bacteria | 1373 |
| 401 | Ga0495625_0038139 | 3300046660 | Bacteria | 3519 |
| 402 | Ga0495647_0007450 | 3300046681 | Bacteria | 3667 |
| 403 | Ga0495649_0000665 | 3300046694 | Bacteria | 28093 |
| 404 | Ga0495649_0004511 | 3300046694 | Bacteria | 9091 |
| 405 | Ga0495589_0011372 | 3300046794 | Bacteria | 4622 |
| 406 | Ga0495687_000212 | 3300047443 | Bacteria | 83406 |
| 407 | Ga0495687_027767 | 3300047443 | Bacteria | 2643 |
| 408 | Ga0495687_030268 | 3300047443 | Bacteria | 2493 |
| 409 | Ga0495593_0051554 | 3300047673 | Bacteria | 2177 |
| 410 | Ga0496100_0260356 | 3300048903 | Bacteria | 1286 |
| 411 | Ga0496104_0359702 | 3300048907 | Bacteria | 1368 |
| 412 | Ga0496106_0012394 | 3300048909 | Bacteria | 6296 |
| 413 | Ga0496108_0087912 | 3300048911 | Bacteria | 2640 |
| 414 | Ga0496109_0097654 | 3300048912 | Bacteria | 2723 |
| 415 | Ga0495682_0039386 | 3300049460 | Bacteria | 1735 |
| 416 | Ga0501032_0116349 | 3300049569 | Bacteria | 1768 |
| 417 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 418 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 419 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 420 | Ga0501048_0000091 | 3300049582 | Bacteria | 48347 |
| 421 | Ga0501044_0095119 | 3300049823 | Bacteria | 3003 |
| 422 | Ga0501045_0002645 | 3300049824 | Bacteria | 12208 |
| 423 | nmdc:mga03n38_78306_c1 | 3300050490 | Bacteria | 1547 |
| 424 | nmdc:mga0k408_2101_c1 | 3300050493 | Bacteria | 10666 |
| 425 | nmdc:mga0k408_601_c1 | 3300050493 | Bacteria | 19883 |
| 426 | nmdc:mga0k408_617_c1 | 3300050493 | Bacteria | 19608 |
| 427 | nmdc:mga06z11_11256_c1 | 3300050494 | Bacteria | 3851 |
| 428 | nmdc:mga04h51_6317_c1 | 3300050495 | Bacteria | 3067 |
| 429 | nmdc:mga07m45_133_c1 | 3300050496 | Bacteria | 29501 |
| 430 | nmdc:mga07m45_247_c1 | 3300050496 | Bacteria | 21997 |
| 431 | nmdc:mga07m45_33411_c1 | 3300050496 | Bacteria | 2857 |
| 432 | nmdc:mga07m45_47322_c1 | 3300050496 | Bacteria | 2418 |
| 433 | nmdc:mga07m45_55707_c1 | 3300050496 | Bacteria | 2235 |
| 434 | nmdc:mga09592_7090_c1 | 3300050508 | Bacteria | 9109 |
| 435 | Ga0500635_0000072 | 3300053080 | Bacteria | 66335 |
| 436 | Ga0500635_0024039 | 3300053080 | Bacteria | 1908 |
| 437 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 438 | Ga0500578_0013231 | 3300053086 | Bacteria | 5319 |
| 439 | Ga0500578_0112880 | 3300053086 | Bacteria | 1712 |
| 440 | Ga0500646_0000644 | 3300053090 | Bacteria | 10009 |
| 441 | Ga0500650_0068642 | 3300053098 | Bacteria | 1657 |
| 442 | Ga0500594_0003767 | 3300053118 | Bacteria | 3338 |
| 443 | Ga0500628_004783 | 3300053129 | Bacteria | 2247 |
| 444 | Ga0500642_0001752 | 3300053130 | Bacteria | 6256 |
| 445 | Ga0500652_001055 | 3300053131 | Bacteria | 8942 |
| 446 | Ga0500559_0000092 | 3300053136 | Bacteria | 71917 |
| 447 | Ga0500559_0027221 | 3300053136 | Bacteria | 2439 |
| 448 | Ga0500568_0003764 | 3300053139 | Bacteria | 8304 |
| 449 | Ga0500622_0000311 | 3300053156 | Bacteria | 49557 |
| 450 | Ga0500622_0000585 | 3300053156 | Bacteria | 33068 |
| 451 | Ga0500645_007537 | 3300053730 | Bacteria | 3779 |
| 452 | Ga0466962_0025684 | 3300061719 | Bacteria | 2827 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10050395 | rootL2_100503952 | 371 |
| 2 | 3300028794 | Ga0307515_10161317 | Ga0307515_101613172 | 380 |
| 3 | 3300005328 | Ga0070676_10163966 | Ga0070676_101639662 | 382 |
| 4 | 3300005330 | Ga0070690_100078300 | Ga0070690_1000783002 | 382 |
| 5 | 3300005333 | Ga0070677_10012207 | Ga0070677_100122072 | 382 |
| 6 | 3300005334 | Ga0068869_100007643 | Ga0068869_1000076433 | 382 |
| 7 | 3300005335 | Ga0070666_10048871 | Ga0070666_100488712 | 382 |
| 8 | 3300005343 | Ga0070687_100040346 | Ga0070687_1000403462 | 382 |
| 9 | 3300005347 | Ga0070668_100011645 | Ga0070668_1000116453 | 382 |
| 10 | 3300005354 | Ga0070675_100037150 | Ga0070675_1000371502 | 382 |
| 11 | 3300005356 | Ga0070674_100022958 | Ga0070674_1000229583 | 382 |
| 12 | 3300005367 | Ga0070667_100046530 | Ga0070667_1000465302 | 382 |
| 13 | 3300005441 | Ga0070700_100037646 | Ga0070700_1000376462 | 382 |
| 14 | 3300005457 | Ga0070662_100030667 | Ga0070662_1000306671 | 382 |
| 15 | 3300005459 | Ga0068867_100011106 | Ga0068867_1000111066 | 382 |
| 16 | 3300005543 | Ga0070672_100035737 | Ga0070672_1000357372 | 382 |
| 17 | 3300005616 | Ga0068852_100030945 | Ga0068852_1000309452 | 382 |
| 18 | 3300005617 | Ga0068859_100023100 | Ga0068859_1000231005 | 382 |
| 19 | 3300005618 | Ga0068864_100098799 | Ga0068864_1000987992 | 382 |
| 20 | 3300005841 | Ga0068863_100030895 | Ga0068863_1000308953 | 382 |
| 21 | 3300005842 | Ga0068858_100123943 | Ga0068858_1001239432 | 382 |
| 22 | 3300005843 | Ga0068860_100005320 | Ga0068860_1000053203 | 382 |
| 23 | 3300005844 | Ga0068862_100063764 | Ga0068862_1000637642 | 382 |
| 24 | 3300006931 | Ga0097620_100023100 | Ga0097620_1000231005 | 382 |
| 25 | 3300009176 | Ga0105242_10246362 | Ga0105242_102463622 | 382 |
| 26 | 3300009177 | Ga0105248_10257025 | Ga0105248_102570252 | 382 |
| 27 | 3300013306 | Ga0163162_10098721 | Ga0163162_100987212 | 382 |
| 28 | 3300013308 | Ga0157375_10097173 | Ga0157375_100971732 | 382 |
| 29 | 3300014326 | Ga0157380_10033653 | Ga0157380_100336533 | 382 |
| 30 | 3300014968 | Ga0157379_10002716 | Ga0157379_100027169 | 382 |
| 31 | 3300017792 | Ga0163161_10064080 | Ga0163161_100640802 | 382 |
| 32 | 3300025893 | Ga0207682_10016719 | Ga0207682_100167192 | 382 |
| 33 | 3300025903 | Ga0207680_10006829 | Ga0207680_100068292 | 382 |
| 34 | 3300025907 | Ga0207645_10020090 | Ga0207645_100200903 | 382 |
| 35 | 3300025918 | Ga0207662_10058424 | Ga0207662_100584242 | 382 |
| 36 | 3300025923 | Ga0207681_10023280 | Ga0207681_100232802 | 382 |
| 37 | 3300025933 | Ga0207706_10019930 | Ga0207706_100199303 | 382 |
| 38 | 3300025938 | Ga0207704_10029680 | Ga0207704_100296801 | 382 |
| 39 | 3300025942 | Ga0207689_10007414 | Ga0207689_100074142 | 382 |
| 40 | 3300025972 | Ga0207668_10026369 | Ga0207668_100263693 | 382 |
| 41 | 3300025986 | Ga0207658_10002216 | Ga0207658_100022166 | 382 |
| 42 | 3300026067 | Ga0207678_10134598 | Ga0207678_101345982 | 382 |
| 43 | 3300026075 | Ga0207708_10050726 | Ga0207708_100507263 | 382 |
| 44 | 3300026088 | Ga0207641_10002869 | Ga0207641_100028693 | 382 |
| 45 | 3300026089 | Ga0207648_10049293 | Ga0207648_100492933 | 382 |
| 46 | 3300026095 | Ga0207676_10030474 | Ga0207676_100304743 | 382 |
| 47 | 3300026121 | Ga0207683_10083064 | Ga0207683_100830642 | 382 |
| 48 | 3300026142 | Ga0207698_10065559 | Ga0207698_100655592 | 382 |
| 49 | 3300028381 | Ga0268264_10004518 | Ga0268264_100045182 | 382 |
| 50 | 3300046459 | Ga0495629_0011433 | Ga0495629_0011433_2581_3813 | 383 |
| 51 | 3300046681 | Ga0495647_0007450 | Ga0495647_0007450_2123_3355 | 383 |
| 52 | 3300025920 | Ga0207649_10142761 | Ga0207649_101427612 | 386 |
| 53 | 3300026041 | Ga0207639_10032951 | Ga0207639_100329512 | 386 |
| 54 | 3300005354 | Ga0070675_100028246 | Ga0070675_1000282463 | 388 |
| 55 | 3300025907 | Ga0207645_10010246 | Ga0207645_100102462 | 388 |
| 56 | 3300025942 | Ga0207689_10154379 | Ga0207689_101543792 | 388 |
| 57 | 3300025944 | Ga0207661_10117555 | Ga0207661_101175552 | 388 |
| 58 | 3300013307 | Ga0157372_10380026 | Ga0157372_103800262 | 389 |
| 59 | 3300036401 | Ga0373937_0078716 | Ga0373937_0078716_1759_2991 | 389 |
| 60 | 3300046542 | Ga0495597_0012015 | Ga0495597_0012015_1030_2265 | 390 |
| 61 | 3300047443 | Ga0495687_000212 | Ga0495687_000212_73236_74471 | 390 |
| 62 | 3300005355 | Ga0070671_100147759 | Ga0070671_1001477592 | 391 |
| 63 | 3300005459 | Ga0068867_100167309 | Ga0068867_1001673092 | 391 |
| 64 | 3300025931 | Ga0207644_10093348 | Ga0207644_100933482 | 391 |
| 65 | 3300026089 | Ga0207648_10040454 | Ga0207648_100404542 | 391 |
| 66 | 3300026116 | Ga0207674_10039004 | Ga0207674_100390042 | 391 |
| 67 | 3300031507 | Ga0307509_10023159 | Ga0307509_100231594 | 392 |
| 68 | 3300028794 | Ga0307515_10011006 | Ga0307515_1001100612 | 393 |
| 69 | 3300030522 | Ga0307512_10072037 | Ga0307512_100720372 | 393 |
| 70 | 3300031507 | Ga0307509_10087769 | Ga0307509_100877692 | 393 |
| 71 | 3300033180 | Ga0307510_10086896 | Ga0307510_100868962 | 393 |
| 72 | 3300028786 | Ga0307517_10009033 | Ga0307517_100090336 | 394 |
| 73 | 3300031456 | Ga0307513_10180327 | Ga0307513_101803272 | 395 |
| 74 | 3300031616 | Ga0307508_10012345 | Ga0307508_100123458 | 395 |
| 75 | iso_pu_bacteria | 2585428058 | 2587731589 | 395 |
| 76 | iso_pu_bacteria | 2585428057 | 2587725050 | 397 |
| 77 | iso_pu_bacteria | 2588253510 | 2588292555 | 397 |
| 78 | iso_pu_bacteria | 2643221592 | 2643968070 | 397 |
| 79 | iso_pu_bacteria | 2643221625 | 2644142574 | 397 |
| 80 | iso_pu_bacteria | 2643221648 | 2644276927 | 397 |
| 81 | 3300025303 | Ga0209051_1000354 | Ga0209051_100035446 | 398 |
| 82 | iso_pu_bacteria | 2643221654 | 2644301835 | 398 |
| 83 | 3300005335 | Ga0070666_10155094 | Ga0070666_101550942 | 399 |
| 84 | 3300005364 | Ga0070673_100016869 | Ga0070673_1000168692 | 399 |
| 85 | 3300005367 | Ga0070667_100005561 | Ga0070667_1000055617 | 399 |
| 86 | 3300005543 | Ga0070672_100180030 | Ga0070672_1001800302 | 399 |
| 87 | 3300005842 | Ga0068858_100009225 | Ga0068858_1000092253 | 399 |
| 88 | 3300006353 | Ga0075370_10111116 | Ga0075370_101111162 | 399 |
| 89 | 3300014326 | Ga0157380_10064322 | Ga0157380_100643223 | 399 |
| 90 | 3300025903 | Ga0207680_10177315 | Ga0207680_101773151 | 399 |
| 91 | 3300025940 | Ga0207691_10050243 | Ga0207691_100502433 | 399 |
| 92 | 3300026035 | Ga0207703_10003861 | Ga0207703_100038613 | 399 |
| 93 | 3300026142 | Ga0207698_10104500 | Ga0207698_101045002 | 399 |
| 94 | 3300028381 | Ga0268264_10008447 | Ga0268264_100084473 | 399 |
| 95 | 3300048907 | Ga0496104_0359702 | Ga0496104_0359702_54_1274 | 399 |
| 96 | 3300050496 | nmdc:mga07m45_47322_c1 | nmdc:mga07m45_47322_c1_99_1313 | 399 |
| 97 | 3300050496 | nmdc:mga07m45_55707_c1 | nmdc:mga07m45_55707_c1_197_1399 | 399 |
| 98 | 3300005336 | Ga0070680_100004941 | Ga0070680_1000049412 | 400 |
| 99 | 3300005354 | Ga0070675_100033316 | Ga0070675_1000333162 | 400 |
| 100 | 3300005457 | Ga0070662_100002892 | Ga0070662_1000028927 | 400 |
| 101 | 3300005459 | Ga0068867_100000083 | Ga0068867_10000008344 | 400 |
| 102 | 3300005530 | Ga0070679_100008793 | Ga0070679_1000087939 | 400 |
| 103 | 3300005539 | Ga0068853_100027528 | Ga0068853_1000275284 | 400 |
| 104 | 3300005539 | Ga0068853_100095178 | Ga0068853_1000951782 | 400 |
| 105 | 3300005614 | Ga0068856_100042236 | Ga0068856_1000422361 | 400 |
| 106 | 3300005614 | Ga0068856_100346812 | Ga0068856_1003468122 | 400 |
| 107 | 3300005616 | Ga0068852_100053177 | Ga0068852_1000531772 | 400 |
| 108 | 3300005841 | Ga0068863_100030622 | Ga0068863_1000306223 | 400 |
| 109 | 3300009093 | Ga0105240_10003000 | Ga0105240_1000300013 | 400 |
| 110 | 3300009148 | Ga0105243_10001223 | Ga0105243_1000122314 | 400 |
| 111 | 3300009545 | Ga0105237_10121759 | Ga0105237_101217592 | 400 |
| 112 | 3300009551 | Ga0105238_10069954 | Ga0105238_100699543 | 400 |
| 113 | 3300009551 | Ga0105238_10220774 | Ga0105238_102207742 | 400 |
| 114 | 3300010375 | Ga0105239_10000417 | Ga0105239_100004179 | 400 |
| 115 | 3300013105 | Ga0157369_10389242 | Ga0157369_103892421 | 400 |
| 116 | 3300013296 | Ga0157374_10010807 | Ga0157374_100108075 | 400 |
| 117 | 3300014745 | Ga0157377_10000104 | Ga0157377_1000010410 | 400 |
| 118 | 3300025913 | Ga0207695_10004036 | Ga0207695_1000403610 | 400 |
| 119 | 3300025917 | Ga0207660_10118156 | Ga0207660_101181562 | 400 |
| 120 | 3300025919 | Ga0207657_10035681 | Ga0207657_100356814 | 400 |
| 121 | 3300025921 | Ga0207652_10079422 | Ga0207652_100794222 | 400 |
| 122 | 3300025924 | Ga0207694_10044865 | Ga0207694_100448653 | 400 |
| 123 | 3300025931 | Ga0207644_10131544 | Ga0207644_101315442 | 400 |
| 124 | 3300025933 | Ga0207706_10000544 | Ga0207706_1000054428 | 400 |
| 125 | 3300025933 | Ga0207706_10031357 | Ga0207706_100313573 | 400 |
| 126 | 3300025935 | Ga0207709_10003449 | Ga0207709_100034495 | 400 |
| 127 | 3300025942 | Ga0207689_10000910 | Ga0207689_1000091020 | 400 |
| 128 | 3300026041 | Ga0207639_10084466 | Ga0207639_100844662 | 400 |
| 129 | 3300026041 | Ga0207639_10106339 | Ga0207639_101063392 | 400 |
| 130 | 3300026067 | Ga0207678_10004524 | Ga0207678_100045242 | 400 |
| 131 | 3300026078 | Ga0207702_10289570 | Ga0207702_102895702 | 400 |
| 132 | 3300026089 | Ga0207648_10000243 | Ga0207648_1000024310 | 400 |
| 133 | 3300026142 | Ga0207698_10010818 | Ga0207698_100108184 | 400 |
| 134 | 3300031995 | Ga0307409_100002330 | Ga0307409_1000023309 | 400 |
| 135 | 3300032005 | Ga0307411_10065075 | Ga0307411_100650752 | 400 |
| 136 | 3300036401 | Ga0373937_0072728 | Ga0373937_0072728_731_1963 | 400 |
| 137 | 3300037471 | Ga0395905_0032910 | Ga0395905_0032910_1116_2324 | 400 |
| 138 | 3300039437 | Ga0436365_1520872 | Ga0436365_1520872_19_1242 | 400 |
| 139 | 3300044656 | Ga0466969_0013456 | Ga0466969_0013456_2893_4101 | 400 |
| 140 | 3300044658 | Ga0466972_0001691 | Ga0466972_0001691_8295_9506 | 400 |
| 141 | 3300044658 | Ga0466972_0062386 | Ga0466972_0062386_27_1235 | 400 |
| 142 | 3300044683 | Ga0466965_0010136 | Ga0466965_0010136_108_1316 | 400 |
| 143 | 3300044683 | Ga0466965_0046648 | Ga0466965_0046648_500_1708 | 400 |
| 144 | 3300044765 | Ga0466970_0043415 | Ga0466970_0043415_651_1859 | 400 |
| 145 | 3300045049 | Ga0466959_0011815 | Ga0466959_0011815_1466_2674 | 400 |
| 146 | 3300046471 | Ga0495650_0001099 | Ga0495650_0001099_8768_9976 | 400 |
| 147 | 3300047443 | Ga0495687_027767 | Ga0495687_027767_1117_2370 | 400 |
| 148 | 3300047443 | Ga0495687_030268 | Ga0495687_030268_145_1377 | 400 |
| 149 | 3300049569 | Ga0501032_0116349 | Ga0501032_0116349_25_1227 | 400 |
| 150 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_210248_211450 | 400 |
| 151 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_80386_81588 | 400 |
| 152 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_80066_81268 | 400 |
| 153 | 3300049582 | Ga0501048_0000091 | Ga0501048_0000091_39072_40274 | 400 |
| 154 | 3300049823 | Ga0501044_0095119 | Ga0501044_0095119_466_1668 | 400 |
| 155 | 3300049824 | Ga0501045_0002645 | Ga0501045_0002645_8457_9659 | 400 |
| 156 | 3300061719 | Ga0466962_0025684 | Ga0466962_0025684_1084_2292 | 400 |
| 157 | 3300002773 | JGI25152J39213_1002069 | JGI25152J39213_10020697 | 401 |
| 158 | 3300003215 | JGI25153J46596_10000500 | JGI25153J46596_100005004 | 401 |
| 159 | 3300003215 | JGI25153J46596_10003835 | JGI25153J46596_100038355 | 401 |
| 160 | 3300003791 | Ga0055530_10003147 | Ga0055530_100031473 | 401 |
| 161 | 3300005262 | Ga0065165_1007460 | Ga0065165_10074602 | 401 |
| 162 | 3300005328 | Ga0070676_10094449 | Ga0070676_100944491 | 401 |
| 163 | 3300005331 | Ga0070670_100005189 | Ga0070670_1000051892 | 401 |
| 164 | 3300005331 | Ga0070670_100021421 | Ga0070670_1000214213 | 401 |
| 165 | 3300005331 | Ga0070670_100078158 | Ga0070670_1000781582 | 401 |
| 166 | 3300005331 | Ga0070670_100097868 | Ga0070670_1000978682 | 401 |
| 167 | 3300005333 | Ga0070677_10002208 | Ga0070677_100022083 | 401 |
| 168 | 3300005333 | Ga0070677_10011847 | Ga0070677_100118473 | 401 |
| 169 | 3300005338 | Ga0068868_100022227 | Ga0068868_1000222272 | 401 |
| 170 | 3300005338 | Ga0068868_100142368 | Ga0068868_1001423682 | 401 |
| 171 | 3300005340 | Ga0070689_100012922 | Ga0070689_1000129223 | 401 |
| 172 | 3300005344 | Ga0070661_100165550 | Ga0070661_1001655501 | 401 |
| 173 | 3300005354 | Ga0070675_100000175 | Ga0070675_10000017529 | 401 |
| 174 | 3300005354 | Ga0070675_100002079 | Ga0070675_1000020793 | 401 |
| 175 | 3300005354 | Ga0070675_100016398 | Ga0070675_1000163985 | 401 |
| 176 | 3300005355 | Ga0070671_100001332 | Ga0070671_10000133211 | 401 |
| 177 | 3300005355 | Ga0070671_100011153 | Ga0070671_1000111533 | 401 |
| 178 | 3300005355 | Ga0070671_100011585 | Ga0070671_1000115853 | 401 |
| 179 | 3300005355 | Ga0070671_100079008 | Ga0070671_1000790082 | 401 |
| 180 | 3300005355 | Ga0070671_100093665 | Ga0070671_1000936652 | 401 |
| 181 | 3300005356 | Ga0070674_100004092 | Ga0070674_1000040923 | 401 |
| 182 | 3300005364 | Ga0070673_100049783 | Ga0070673_1000497832 | 401 |
| 183 | 3300005364 | Ga0070673_100219086 | Ga0070673_1002190861 | 401 |
| 184 | 3300005367 | Ga0070667_100005220 | Ga0070667_1000052203 | 401 |
| 185 | 3300005367 | Ga0070667_100132854 | Ga0070667_1001328541 | 401 |
| 186 | 3300005455 | Ga0070663_100167804 | Ga0070663_1001678041 | 401 |
| 187 | 3300005456 | Ga0070678_100003065 | Ga0070678_1000030655 | 401 |
| 188 | 3300005456 | Ga0070678_100108233 | Ga0070678_1001082331 | 401 |
| 189 | 3300005456 | Ga0070678_100180676 | Ga0070678_1001806761 | 401 |
| 190 | 3300005457 | Ga0070662_100051481 | Ga0070662_1000514811 | 401 |
| 191 | 3300005457 | Ga0070662_100219989 | Ga0070662_1002199891 | 401 |
| 192 | 3300005459 | Ga0068867_100000987 | Ga0068867_1000009876 | 401 |
| 193 | 3300005459 | Ga0068867_100013270 | Ga0068867_1000132702 | 401 |
| 194 | 3300005467 | Ga0070706_100000297 | Ga0070706_10000029756 | 401 |
| 195 | 3300005471 | Ga0070698_100167256 | Ga0070698_1001672561 | 401 |
| 196 | 3300005539 | Ga0068853_100243022 | Ga0068853_1002430222 | 401 |
| 197 | 3300005543 | Ga0070672_100002095 | Ga0070672_10000209514 | 401 |
| 198 | 3300005543 | Ga0070672_100008221 | Ga0070672_1000082213 | 401 |
| 199 | 3300005543 | Ga0070672_100020200 | Ga0070672_1000202002 | 401 |
| 200 | 3300005543 | Ga0070672_100182862 | Ga0070672_1001828622 | 401 |
| 201 | 3300005543 | Ga0070672_100230779 | Ga0070672_1002307792 | 401 |
| 202 | 3300005544 | Ga0070686_100107548 | Ga0070686_1001075482 | 401 |
| 203 | 3300005548 | Ga0070665_100025412 | Ga0070665_1000254123 | 401 |
| 204 | 3300005564 | Ga0070664_100057986 | Ga0070664_1000579862 | 401 |
| 205 | 3300005564 | Ga0070664_100106901 | Ga0070664_1001069012 | 401 |
| 206 | 3300005578 | Ga0068854_100045093 | Ga0068854_1000450933 | 401 |
| 207 | 3300005578 | Ga0068854_100048731 | Ga0068854_1000487312 | 401 |
| 208 | 3300005615 | Ga0070702_100067874 | Ga0070702_1000678742 | 401 |
| 209 | 3300005616 | Ga0068852_100033906 | Ga0068852_1000339063 | 401 |
| 210 | 3300005616 | Ga0068852_100072914 | Ga0068852_1000729143 | 401 |
| 211 | 3300005616 | Ga0068852_100131016 | Ga0068852_1001310162 | 401 |
| 212 | 3300005616 | Ga0068852_100134392 | Ga0068852_1001343921 | 401 |
| 213 | 3300005617 | Ga0068859_100012385 | Ga0068859_1000123851 | 401 |
| 214 | 3300005617 | Ga0068859_100119634 | Ga0068859_1001196342 | 401 |
| 215 | 3300005618 | Ga0068864_100000285 | Ga0068864_10000028510 | 401 |
| 216 | 3300005618 | Ga0068864_100012085 | Ga0068864_1000120852 | 401 |
| 217 | 3300005618 | Ga0068864_100085801 | Ga0068864_1000858012 | 401 |
| 218 | 3300005618 | Ga0068864_100149564 | Ga0068864_1001495641 | 401 |
| 219 | 3300005719 | Ga0068861_100060160 | Ga0068861_1000601602 | 401 |
| 220 | 3300005834 | Ga0068851_10096157 | Ga0068851_100961571 | 401 |
| 221 | 3300005840 | Ga0068870_10018620 | Ga0068870_100186202 | 401 |
| 222 | 3300005840 | Ga0068870_10085200 | Ga0068870_100852002 | 401 |
| 223 | 3300005841 | Ga0068863_100103244 | Ga0068863_1001032442 | 401 |
| 224 | 3300005841 | Ga0068863_100117748 | Ga0068863_1001177482 | 401 |
| 225 | 3300005842 | Ga0068858_100027308 | Ga0068858_1000273084 | 401 |
| 226 | 3300005843 | Ga0068860_100161162 | Ga0068860_1001611622 | 401 |
| 227 | 3300006177 | Ga0075362_10012171 | Ga0075362_100121713 | 401 |
| 228 | 3300006178 | Ga0075367_10002856 | Ga0075367_100028562 | 401 |
| 229 | 3300006178 | Ga0075367_10117942 | Ga0075367_101179421 | 401 |
| 230 | 3300006195 | Ga0075366_10000426 | Ga0075366_1000042613 | 401 |
| 231 | 3300006195 | Ga0075366_10001145 | Ga0075366_1000114510 | 401 |
| 232 | 3300006195 | Ga0075366_10090114 | Ga0075366_100901141 | 401 |
| 233 | 3300006237 | Ga0097621_100026225 | Ga0097621_1000262254 | 401 |
| 234 | 3300006237 | Ga0097621_100103666 | Ga0097621_1001036662 | 401 |
| 235 | 3300006353 | Ga0075370_10000072 | Ga0075370_100000729 | 401 |
| 236 | 3300006353 | Ga0075370_10000553 | Ga0075370_1000055317 | 401 |
| 237 | 3300006358 | Ga0068871_100091051 | Ga0068871_1000910512 | 401 |
| 238 | 3300006880 | Ga0075429_100000204 | Ga0075429_10000020436 | 401 |
| 239 | 3300006881 | Ga0068865_100025432 | Ga0068865_1000254322 | 401 |
| 240 | 3300006931 | Ga0097620_100012386 | Ga0097620_1000123861 | 401 |
| 241 | 3300006931 | Ga0097620_100119634 | Ga0097620_1001196342 | 401 |
| 242 | 3300009098 | Ga0105245_10086657 | Ga0105245_100866573 | 401 |
| 243 | 3300009148 | Ga0105243_10133312 | Ga0105243_101333122 | 401 |
| 244 | 3300009176 | Ga0105242_10084594 | Ga0105242_100845942 | 401 |
| 245 | 3300009177 | Ga0105248_10036112 | Ga0105248_100361125 | 401 |
| 246 | 3300009545 | Ga0105237_10034870 | Ga0105237_100348701 | 401 |
| 247 | 3300009553 | Ga0105249_10032996 | Ga0105249_100329963 | 401 |
| 248 | 3300013306 | Ga0163162_10058814 | Ga0163162_100588144 | 401 |
| 249 | 3300013306 | Ga0163162_10178021 | Ga0163162_101780212 | 401 |
| 250 | 3300013308 | Ga0157375_10012669 | Ga0157375_100126692 | 401 |
| 251 | 3300013308 | Ga0157375_10025277 | Ga0157375_100252773 | 401 |
| 252 | 3300013308 | Ga0157375_10042236 | Ga0157375_100422362 | 401 |
| 253 | 3300014325 | Ga0163163_10007398 | Ga0163163_100073986 | 401 |
| 254 | 3300014325 | Ga0163163_10216762 | Ga0163163_102167622 | 401 |
| 255 | 3300014326 | Ga0157380_10116368 | Ga0157380_101163682 | 401 |
| 256 | 3300014968 | Ga0157379_10033102 | Ga0157379_100331022 | 401 |
| 257 | 3300014969 | Ga0157376_10046425 | Ga0157376_100464252 | 401 |
| 258 | 3300014969 | Ga0157376_10109533 | Ga0157376_101095332 | 401 |
| 259 | 3300017792 | Ga0163161_10003223 | Ga0163161_100032238 | 401 |
| 260 | 3300017792 | Ga0163161_10028113 | Ga0163161_100281134 | 401 |
| 261 | 3300021361 | Ga0213872_10032634 | Ga0213872_100326342 | 401 |
| 262 | 3300025245 | Ga0207425_1000652 | Ga0207425_100065217 | 401 |
| 263 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027263 | 401 |
| 264 | 3300025273 | Ga0209673_1012585 | Ga0209673_10125852 | 401 |
| 265 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014519 | 401 |
| 266 | 3300025297 | Ga0209758_1000193 | Ga0209758_100019344 | 401 |
| 267 | 3300025297 | Ga0209758_1000208 | Ga0209758_100020874 | 401 |
| 268 | 3300025298 | Ga0209050_1000198 | Ga0209050_100019862 | 401 |
| 269 | 3300025315 | Ga0207697_10008003 | Ga0207697_100080032 | 401 |
| 270 | 3300025893 | Ga0207682_10003348 | Ga0207682_100033482 | 401 |
| 271 | 3300025907 | Ga0207645_10037095 | Ga0207645_100370953 | 401 |
| 272 | 3300025908 | Ga0207643_10023279 | Ga0207643_100232792 | 401 |
| 273 | 3300025910 | Ga0207684_10006695 | Ga0207684_100066951 | 401 |
| 274 | 3300025914 | Ga0207671_10042127 | Ga0207671_100421271 | 401 |
| 275 | 3300025923 | Ga0207681_10102948 | Ga0207681_101029481 | 401 |
| 276 | 3300025923 | Ga0207681_10142182 | Ga0207681_101421822 | 401 |
| 277 | 3300025925 | Ga0207650_10000618 | Ga0207650_1000061814 | 401 |
| 278 | 3300025925 | Ga0207650_10001257 | Ga0207650_100012578 | 401 |
| 279 | 3300025925 | Ga0207650_10015367 | Ga0207650_100153673 | 401 |
| 280 | 3300025925 | Ga0207650_10052005 | Ga0207650_100520052 | 401 |
| 281 | 3300025925 | Ga0207650_10160947 | Ga0207650_101609472 | 401 |
| 282 | 3300025926 | Ga0207659_10000081 | Ga0207659_1000008143 | 401 |
| 283 | 3300025926 | Ga0207659_10000677 | Ga0207659_1000067717 | 401 |
| 284 | 3300025926 | Ga0207659_10005890 | Ga0207659_100058903 | 401 |
| 285 | 3300025927 | Ga0207687_10040555 | Ga0207687_100405552 | 401 |
| 286 | 3300025931 | Ga0207644_10000608 | Ga0207644_1000060815 | 401 |
| 287 | 3300025931 | Ga0207644_10007142 | Ga0207644_100071423 | 401 |
| 288 | 3300025931 | Ga0207644_10007292 | Ga0207644_100072925 | 401 |
| 289 | 3300025931 | Ga0207644_10026684 | Ga0207644_100266842 | 401 |
| 290 | 3300025933 | Ga0207706_10040396 | Ga0207706_100403963 | 401 |
| 291 | 3300025933 | Ga0207706_10141600 | Ga0207706_101416002 | 401 |
| 292 | 3300025933 | Ga0207706_10252623 | Ga0207706_102526231 | 401 |
| 293 | 3300025934 | Ga0207686_10042692 | Ga0207686_100426923 | 401 |
| 294 | 3300025935 | Ga0207709_10136768 | Ga0207709_101367682 | 401 |
| 295 | 3300025936 | Ga0207670_10002024 | Ga0207670_100020247 | 401 |
| 296 | 3300025937 | Ga0207669_10002305 | Ga0207669_100023053 | 401 |
| 297 | 3300025937 | Ga0207669_10068345 | Ga0207669_100683452 | 401 |
| 298 | 3300025938 | Ga0207704_10040177 | Ga0207704_100401773 | 401 |
| 299 | 3300025938 | Ga0207704_10057312 | Ga0207704_100573122 | 401 |
| 300 | 3300025940 | Ga0207691_10001539 | Ga0207691_1000153914 | 401 |
| 301 | 3300025940 | Ga0207691_10004718 | Ga0207691_1000471814 | 401 |
| 302 | 3300025940 | Ga0207691_10033002 | Ga0207691_100330024 | 401 |
| 303 | 3300025940 | Ga0207691_10052068 | Ga0207691_100520682 | 401 |
| 304 | 3300025940 | Ga0207691_10102281 | Ga0207691_101022812 | 401 |
| 305 | 3300025940 | Ga0207691_10271501 | Ga0207691_102715011 | 401 |
| 306 | 3300025941 | Ga0207711_10018083 | Ga0207711_100180834 | 401 |
| 307 | 3300025941 | Ga0207711_10262883 | Ga0207711_102628832 | 401 |
| 308 | 3300025942 | Ga0207689_10009348 | Ga0207689_100093483 | 401 |
| 309 | 3300025960 | Ga0207651_10000149 | Ga0207651_1000014927 | 401 |
| 310 | 3300025960 | Ga0207651_10002411 | Ga0207651_100024116 | 401 |
| 311 | 3300025960 | Ga0207651_10046319 | Ga0207651_100463192 | 401 |
| 312 | 3300025960 | Ga0207651_10102271 | Ga0207651_101022712 | 401 |
| 313 | 3300025961 | Ga0207712_10038171 | Ga0207712_100381711 | 401 |
| 314 | 3300025981 | Ga0207640_10037131 | Ga0207640_100371312 | 401 |
| 315 | 3300025986 | Ga0207658_10007279 | Ga0207658_100072794 | 401 |
| 316 | 3300025986 | Ga0207658_10093310 | Ga0207658_100933102 | 401 |
| 317 | 3300025986 | Ga0207658_10268878 | Ga0207658_102688782 | 401 |
| 318 | 3300026023 | Ga0207677_10001033 | Ga0207677_100010338 | 401 |
| 319 | 3300026035 | Ga0207703_10000699 | Ga0207703_1000069919 | 401 |
| 320 | 3300026041 | Ga0207639_10141067 | Ga0207639_101410671 | 401 |
| 321 | 3300026067 | Ga0207678_10227042 | Ga0207678_102270422 | 401 |
| 322 | 3300026088 | Ga0207641_10000568 | Ga0207641_1000056826 | 401 |
| 323 | 3300026088 | Ga0207641_10015026 | Ga0207641_100150264 | 401 |
| 324 | 3300026089 | Ga0207648_10012371 | Ga0207648_100123715 | 401 |
| 325 | 3300026089 | Ga0207648_10016616 | Ga0207648_100166165 | 401 |
| 326 | 3300026089 | Ga0207648_10046980 | Ga0207648_100469802 | 401 |
| 327 | 3300026089 | Ga0207648_10077747 | Ga0207648_100777472 | 401 |
| 328 | 3300026089 | Ga0207648_10123455 | Ga0207648_101234552 | 401 |
| 329 | 3300026095 | Ga0207676_10000579 | Ga0207676_1000057919 | 401 |
| 330 | 3300026095 | Ga0207676_10013589 | Ga0207676_100135893 | 401 |
| 331 | 3300026095 | Ga0207676_10015089 | Ga0207676_100150892 | 401 |
| 332 | 3300026116 | Ga0207674_10088791 | Ga0207674_100887911 | 401 |
| 333 | 3300026118 | Ga0207675_100026430 | Ga0207675_1000264304 | 401 |
| 334 | 3300026121 | Ga0207683_10004555 | Ga0207683_100045555 | 401 |
| 335 | 3300026121 | Ga0207683_10008444 | Ga0207683_100084446 | 401 |
| 336 | 3300026121 | Ga0207683_10071747 | Ga0207683_100717471 | 401 |
| 337 | 3300026121 | Ga0207683_10198804 | Ga0207683_101988042 | 401 |
| 338 | 3300026142 | Ga0207698_10039393 | Ga0207698_100393932 | 401 |
| 339 | 3300026142 | Ga0207698_10094802 | Ga0207698_100948022 | 401 |
| 340 | 3300027866 | Ga0209813_10006689 | Ga0209813_100066892 | 401 |
| 341 | 3300030522 | Ga0307512_10011610 | Ga0307512_100116102 | 401 |
| 342 | 3300031507 | Ga0307509_10205035 | Ga0307509_102050351 | 401 |
| 343 | 3300031548 | Ga0307408_100034057 | Ga0307408_1000340572 | 401 |
| 344 | 3300031649 | Ga0307514_10071694 | Ga0307514_100716942 | 401 |
| 345 | 3300031730 | Ga0307516_10004252 | Ga0307516_1000425217 | 401 |
| 346 | 3300031730 | Ga0307516_10195093 | Ga0307516_101950932 | 401 |
| 347 | 3300031731 | Ga0307405_10008952 | Ga0307405_100089522 | 401 |
| 348 | 3300031824 | Ga0307413_10010111 | Ga0307413_100101114 | 401 |
| 349 | 3300031852 | Ga0307410_10013056 | Ga0307410_100130561 | 401 |
| 350 | 3300031852 | Ga0307410_10029462 | Ga0307410_100294623 | 401 |
| 351 | 3300031901 | Ga0307406_10037678 | Ga0307406_100376782 | 401 |
| 352 | 3300031903 | Ga0307407_10001640 | Ga0307407_100016403 | 401 |
| 353 | 3300031911 | Ga0307412_10027381 | Ga0307412_100273811 | 401 |
| 354 | 3300032002 | Ga0307416_100019940 | Ga0307416_1000199404 | 401 |
| 355 | 3300032005 | Ga0307411_10044584 | Ga0307411_100445842 | 401 |
| 356 | 3300033180 | Ga0307510_10006149 | Ga0307510_1000614913 | 401 |
| 357 | 3300033180 | Ga0307510_10030374 | Ga0307510_100303742 | 401 |
| 358 | 3300035171 | Ga0373946_0043955 | Ga0373946_0043955_15_1265 | 401 |
| 359 | 3300035410 | Ga0373924_0017724 | Ga0373924_0017724_116_1351 | 401 |
| 360 | 3300035691 | Ga0373931_0107344 | Ga0373931_0107344_81_1304 | 401 |
| 361 | 3300036401 | Ga0373937_0117163 | Ga0373937_0117163_116_1351 | 401 |
| 362 | 3300039447 | Ga0436361_0033961 | Ga0436361_0033961_2240_3445 | 401 |
| 363 | 3300039447 | Ga0436361_0253740 | Ga0436361_0253740_137_1342 | 401 |
| 364 | 3300046454 | Ga0495592_0000563 | Ga0495592_0000563_12933_14153 | 401 |
| 365 | 3300046492 | Ga0495585_0007400 | Ga0495585_0007400_4418_5623 | 401 |
| 366 | 3300046512 | Ga0495610_0075164 | Ga0495610_0075164_303_1550 | 401 |
| 367 | 3300046515 | Ga0495620_0063020 | Ga0495620_0063020_59_1315 | 401 |
| 368 | 3300046517 | Ga0495630_0043660 | Ga0495630_0043660_2018_3238 | 401 |
| 369 | 3300046519 | Ga0495632_0004566 | Ga0495632_0004566_5139_6374 | 401 |
| 370 | 3300046660 | Ga0495625_0038139 | Ga0495625_0038139_1954_3189 | 401 |
| 371 | 3300046694 | Ga0495649_0004511 | Ga0495649_0004511_1383_2618 | 401 |
| 372 | 3300047673 | Ga0495593_0051554 | Ga0495593_0051554_466_1686 | 401 |
| 373 | 3300048903 | Ga0496100_0260356 | Ga0496100_0260356_36_1259 | 401 |
| 374 | 3300048909 | Ga0496106_0012394 | Ga0496106_0012394_3938_5185 | 401 |
| 375 | 3300048911 | Ga0496108_0087912 | Ga0496108_0087912_1117_2349 | 401 |
| 376 | 3300049460 | Ga0495682_0039386 | Ga0495682_0039386_361_1596 | 401 |
| 377 | 3300050490 | nmdc:mga03n38_78306_c1 | nmdc:mga03n38_78306_c1_43_1278 | 401 |
| 378 | 3300050493 | nmdc:mga0k408_2101_c1 | nmdc:mga0k408_2101_c1_3019_4287 | 401 |
| 379 | 3300050493 | nmdc:mga0k408_601_c1 | nmdc:mga0k408_601_c1_10216_11451 | 401 |
| 380 | 3300050493 | nmdc:mga0k408_617_c1 | nmdc:mga0k408_617_c1_13306_14541 | 401 |
| 381 | 3300050494 | nmdc:mga06z11_11256_c1 | nmdc:mga06z11_11256_c1_2472_3707 | 401 |
| 382 | 3300050495 | nmdc:mga04h51_6317_c1 | nmdc:mga04h51_6317_c1_1800_3035 | 401 |
| 383 | 3300050496 | nmdc:mga07m45_133_c1 | nmdc:mga07m45_133_c1_23793_25028 | 401 |
| 384 | 3300050496 | nmdc:mga07m45_247_c1 | nmdc:mga07m45_247_c1_2669_3904 | 401 |
| 385 | 3300050496 | nmdc:mga07m45_33411_c1 | nmdc:mga07m45_33411_c1_811_2070 | 401 |
| 386 | 3300050508 | nmdc:mga09592_7090_c1 | nmdc:mga09592_7090_c1_3754_5004 | 401 |
| 387 | 3300053086 | Ga0500578_0000006 | Ga0500578_0000006_185558_186766 | 401 |
| 388 | 3300053086 | Ga0500578_0013231 | Ga0500578_0013231_144_1391 | 401 |
| 389 | 3300053086 | Ga0500578_0112880 | Ga0500578_0112880_346_1554 | 401 |
| 390 | 3300053090 | Ga0500646_0000644 | Ga0500646_0000644_7811_9094 | 401 |
| 391 | 3300053098 | Ga0500650_0068642 | Ga0500650_0068642_73_1356 | 401 |
| 392 | 3300053118 | Ga0500594_0003767 | Ga0500594_0003767_1706_2953 | 401 |
| 393 | 3300053129 | Ga0500628_004783 | Ga0500628_004783_86_1294 | 401 |
| 394 | 3300053130 | Ga0500642_0001752 | Ga0500642_0001752_3931_5214 | 401 |
| 395 | 3300053131 | Ga0500652_001055 | Ga0500652_001055_6672_7955 | 401 |
| 396 | 3300053136 | Ga0500559_0000092 | Ga0500559_0000092_66813_68060 | 401 |
| 397 | 3300053139 | Ga0500568_0003764 | Ga0500568_0003764_7002_8258 | 401 |
| 398 | 3300053156 | Ga0500622_0000311 | Ga0500622_0000311_13433_14641 | 401 |
| 399 | 3300053156 | Ga0500622_0000585 | Ga0500622_0000585_844_2091 | 401 |
| 400 | 3300053730 | Ga0500645_007537 | Ga0500645_007537_1424_2671 | 401 |
| 401 | 3300003320 | rootH2_10039676 | rootH2_100396762 | 402 |
| 402 | 3300003322 | rootL2_10046474 | rootL2_100464742 | 402 |
| 403 | 3300003323 | rootH1_10019588 | rootH1_100195882 | 402 |
| 404 | 3300003752 | Ga0055539_1000160 | Ga0055539_100016046 | 402 |
| 405 | 3300003756 | Ga0055533_1000162 | Ga0055533_100016246 | 402 |
| 406 | 3300005367 | Ga0070667_100001024 | Ga0070667_10000102423 | 402 |
| 407 | 3300005719 | Ga0068861_100113833 | Ga0068861_1001138332 | 402 |
| 408 | 3300006195 | Ga0075366_10009886 | Ga0075366_100098866 | 402 |
| 409 | 3300009093 | Ga0105240_10009833 | Ga0105240_100098339 | 402 |
| 410 | 3300009093 | Ga0105240_10114573 | Ga0105240_101145732 | 402 |
| 411 | 3300025226 | Ga0209674_100003 | Ga0209674_1000039 | 402 |
| 412 | 3300025230 | Ga0209563_100192 | Ga0209563_1001929 | 402 |
| 413 | 3300025231 | Ga0207427_101622 | Ga0207427_1016225 | 402 |
| 414 | 3300025253 | Ga0209677_100107 | Ga0209677_1001079 | 402 |
| 415 | 3300025913 | Ga0207695_10022029 | Ga0207695_100220295 | 402 |
| 416 | 3300025913 | Ga0207695_10080481 | Ga0207695_100804812 | 402 |
| 417 | 3300025942 | Ga0207689_10071646 | Ga0207689_100716463 | 402 |
| 418 | 3300025986 | Ga0207658_10000692 | Ga0207658_1000069223 | 402 |
| 419 | 3300026118 | Ga0207675_100033725 | Ga0207675_1000337255 | 402 |
| 420 | 3300028379 | Ga0268266_10043231 | Ga0268266_100432312 | 402 |
| 421 | 3300028794 | Ga0307515_10092827 | Ga0307515_100928272 | 402 |
| 422 | 3300030521 | Ga0307511_10040472 | Ga0307511_100404722 | 402 |
| 423 | 3300035086 | Ga0373934_0019456 | Ga0373934_0019456_216_1427 | 402 |
| 424 | 3300036401 | Ga0373937_0071619 | Ga0373937_0071619_271_1506 | 402 |
| 425 | 3300037466 | Ga0395898_0010903 | Ga0395898_0010903_7537_8748 | 402 |
| 426 | 3300038443 | Ga0395901_0001277 | Ga0395901_0001277_20905_22116 | 402 |
| 427 | 3300045976 | Ga0466967_0087582 | Ga0466967_0087582_1033_2241 | 402 |
| 428 | 3300046506 | Ga0495583_0000313 | Ga0495583_0000313_44849_46057 | 402 |
| 429 | 3300046507 | Ga0495606_0001607 | Ga0495606_0001607_4538_5746 | 402 |
| 430 | 3300046543 | Ga0495645_0196141 | Ga0495645_0196141_30_1265 | 402 |
| 431 | 3300046694 | Ga0495649_0000665 | Ga0495649_0000665_2742_3950 | 402 |
| 432 | 3300046794 | Ga0495589_0011372 | Ga0495589_0011372_645_1853 | 402 |
| 433 | 3300053080 | Ga0500635_0000072 | Ga0500635_0000072_43629_44837 | 402 |
| 434 | 3300053080 | Ga0500635_0024039 | Ga0500635_0024039_169_1377 | 402 |
| 435 | 3300053136 | Ga0500559_0027221 | Ga0500559_0027221_389_1597 | 402 |
| 436 | 3300028666 | Ga0265336_10000003 | Ga0265336_10000003301 | 403 |
| 437 | 3300046475 | Ga0495639_0025631 | Ga0495639_0025631_745_1956 | 403 |
| 438 | 3300003761 | Ga0055535_1000403 | Ga0055535_10004034 | 404 |
| 439 | 3300003763 | Ga0055529_1000195 | Ga0055529_10001954 | 404 |
| 440 | 3300025242 | Ga0209258_100291 | Ga0209258_1002915 | 404 |
| 441 | 3300025256 | Ga0209759_1010280 | Ga0209759_10102803 | 404 |
| 442 | 3300025272 | Ga0209455_1000208 | Ga0209455_100020869 | 404 |
| 443 | 3300025303 | Ga0209051_1007471 | Ga0209051_10074711 | 404 |
| 444 | 3300048912 | Ga0496109_0097654 | Ga0496109_0097654_684_1904 | 404 |
| 445 | 3300002738 | JGI25154J39366_1000106 | JGI25154J39366_100010644 | 406 |
| 446 | 3300002741 | JGI25157J39369_1000154 | JGI25157J39369_100015426 | 406 |
| 447 | 3300005614 | Ga0068856_100022922 | Ga0068856_1000229223 | 406 |
| 448 | 3300025246 | Ga0209646_1000127 | Ga0209646_1000127108 | 406 |
| 449 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004850 | 406 |
| 450 | 3300025253 | Ga0209677_100085 | Ga0209677_10008579 | 406 |
| 451 | 3300025256 | Ga0209759_1000129 | Ga0209759_100012926 | 406 |
| 452 | 3300026116 | Ga0207674_10002965 | Ga0207674_1000296517 | 406 |
| 453 | 3300038443 | Ga0395901_0135480 | Ga0395901_0135480_806_2026 | 406 |
| 454 | 3300044684 | Ga0466966_0000198 | Ga0466966_0000198_21237_22457 | 406 |
| 455 | 3300044693 | Ga0466961_0100184 | Ga0466961_0100184_22_1242 | 406 |
| 456 | 3300044719 | Ga0466971_0018442 | Ga0466971_0018442_1620_2840 | 406 |
| 457 | 3300044735 | Ga0466968_0064083 | Ga0466968_0064083_10_1230 | 406 |
| 458 | 3300046471 | Ga0495650_0021704 | Ga0495650_0021704_636_1880 | 406 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xua-assembly1.cif.gz_A | crystal structure of the enol-lactonase from burkholderia xenovorans lb400 | 0.9465 | 149 | 402 |
| 3om8-assembly1.cif.gz_B | the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 | 0.9312 | 136 | 404 |
| 3om8-assembly1.cif.gz_B | the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 | 0.9244 | 136 | 404 |
| 7dq9-assembly4.cif.gz_D | crystal structure of a type-a feruloyl esterase from gut alistipes shahii | 0.9117 | 141 | 401 |
| 7dq9-assembly3.cif.gz_C | crystal structure of a type-a feruloyl esterase from gut alistipes shahii | 0.9097 | 141 | 401 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9511 | 149 | 402 | 3.40.50.1820 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9322 | 136 | 404 | 3.40.50.1820 |
| 3om8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9253 | 136 | 404 | 3.40.50.1820 |
| 2xuaH00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9109 | 149 | 402 | 3.40.50.1820 |
| af_Q5AMS7_12_264_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9051 | 159 | 404 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C8AF80-F1-model_v4 | Alpha/beta fold hydrolase | 0.9883 | 234 | 403 |
GO:0016787
|
| AF-A0A4Q3Y227-F1-model_v4 | Alpha/beta fold hydrolase | 0.971 | 155 | 402 |
GO:0016020
GO:0016787 |
| AF-A0A1G6W3E4-F1-model_v4 | 3-oxoadipate enol-lactonase | 0.9701 | 152 | 405 |
|
| AF-A0A3M2ERI7-F1-model_v4 | deleted | 0.969 | 140 | 402 |
|
| AF-A0A4R7PNY0-F1-model_v4 | deleted | 0.9689 | 152 | 402 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar