F448127

General Info

Members Datasets Scaffolds Average Seq Length
458 251 452 407

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100142368|Ga0068868_1001423682
Length 435
Sequence MTDQRPAGGHAANRSDAADAPRTPREEQGPEDDFDRGVKNRRAVLGDAWVDKSLDNANTFNAEFQDLITRYAWHDIWGRPGLDHTTRRLLVLGMTMGLARWEEFELHCRAAIRGGVPLASIKETLMQGAIYCGVPAANTAFKLTMDILRAEGLVPASQPLSASIRPSRHHTFSQPQLAVSVQGAGTPIVLSHALGLDQRMWDGLASTLAPRHAVLRYDHRGHGASAVPAGPYTMDELVDDAARLIREWGRGPVAWVGLSMGGMVGQGLAIRHPSLLRGLVIANSSSRYPDAAKAMWAERIAKVEQGGLAAIADMVIERYFSAAFRTEHADVVAGYRRRLLLTDPAGYAANCPAIRDVDWLDRLGEIRCPTLVIAGAQDVGAPVAMSEAMKERIPDAELVVIDAASHLSVVEQPAAFEAALDRFLVRLDGGPTPTR

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.97
Nodule 0
Rhizoplane 1.09
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 7.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000106 3300002738 Bacteria 74019
2 JGI25157J39369_1000154 3300002741 Bacteria 57286
3 JGI25152J39213_1002069 3300002773 Bacteria 7896
4 JGI25153J46596_10000500 3300003215 Bacteria 24942
5 JGI25153J46596_10003835 3300003215 Bacteria 8281
6 rootH2_10039676 3300003320 Bacteria 2795
7 rootL2_10046474 3300003322 Bacteria 1983
8 rootL2_10050395 3300003322 Bacteria 6317
9 rootH1_10019588 3300003316 Bacteria 4902
10 rootH1_10019588 3300003323 Bacteria 4711
11 Ga0055539_1000160 3300003752 Bacteria 63531
12 Ga0055533_1000162 3300003756 Bacteria 63221
13 Ga0055535_1000403 3300003761 Bacteria 40654
14 Ga0055529_1000195 3300003763 Bacteria 82315
15 Ga0055530_10003147 3300003791 Bacteria 9723
16 Ga0065165_1007460 3300005262 Bacteria 5364
17 Ga0070676_10094449 3300005328 Bacteria 1837
18 Ga0070676_10163966 3300005328 Bacteria 1432
19 Ga0070690_100078300 3300005330 Bacteria 2159
20 Ga0070670_100005189 3300005331 Bacteria 10966
21 Ga0070670_100021421 3300005331 Bacteria 5561
22 Ga0070670_100078158 3300005331 Bacteria 2842
23 Ga0070670_100097868 3300005331 Bacteria 2524
24 Ga0070677_10002208 3300005333 Bacteria 6219
25 Ga0070677_10011847 3300005333 Bacteria 3017
26 Ga0070677_10012207 3300005333 Bacteria 2979
27 Ga0068869_100007643 3300005334 Bacteria 6922
28 Ga0070666_10048871 3300005335 Bacteria 2842
29 Ga0070666_10155094 3300005335 Bacteria 1599
30 Ga0070680_100004941 3300005336 Bacteria 10040
31 Ga0068868_100022227 3300005338 Bacteria 4785
32 Ga0068868_100142368 3300005338 Bacteria 1970
33 Ga0070689_100012922 3300005340 Bacteria 6030
34 Ga0070687_100040346 3300005343 Bacteria 2352
35 Ga0070661_100165550 3300005344 Bacteria 1677
36 Ga0070668_100011645 3300005347 Bacteria 6546
37 Ga0070675_100000175 3300005354 Bacteria 39754
38 Ga0070675_100002079 3300005354 Bacteria 14813
39 Ga0070675_100016398 3300005354 Bacteria 5880
40 Ga0070675_100028246 3300005354 Bacteria 4515
41 Ga0070675_100033316 3300005354 Bacteria 4176
42 Ga0070675_100037150 3300005354 Bacteria 3965
43 Ga0070671_100001332 3300005355 Bacteria 18537
44 Ga0070671_100011153 3300005355 Bacteria 7216
45 Ga0070671_100011585 3300005355 Bacteria 7094
46 Ga0070671_100079008 3300005355 Bacteria 2750
47 Ga0070671_100093665 3300005355 Bacteria 2517
48 Ga0070671_100147759 3300005355 Bacteria 1984
49 Ga0070674_100004092 3300005356 Bacteria 8288
50 Ga0070674_100022958 3300005356 Bacteria 4028
51 Ga0070673_100016869 3300005364 Bacteria 5177
52 Ga0070673_100049783 3300005364 Bacteria 3272
53 Ga0070673_100219086 3300005364 Bacteria 1646
54 Ga0070667_100001024 3300005367 Bacteria 25540
55 Ga0070667_100005220 3300005367 Bacteria 10855
56 Ga0070667_100005561 3300005367 Bacteria 10518
57 Ga0070667_100046530 3300005367 Bacteria 3650
58 Ga0070667_100132854 3300005367 Bacteria 2174
59 Ga0070700_100037646 3300005441 Bacteria 2943
60 Ga0070663_100167804 3300005455 Bacteria 1694
61 Ga0070678_100003065 3300005456 Bacteria 9263
62 Ga0070678_100108233 3300005456 Bacteria 2169
63 Ga0070678_100180676 3300005456 Bacteria 1727
64 Ga0070662_100002892 3300005457 Bacteria 10661
65 Ga0070662_100030667 3300005457 Bacteria 3766
66 Ga0070662_100051481 3300005457 Bacteria 2974
67 Ga0070662_100219989 3300005457 Bacteria 1515
68 Ga0068867_100000083 3300005459 Bacteria 58784
69 Ga0068867_100000987 3300005459 Bacteria 19414
70 Ga0068867_100011106 3300005459 Bacteria 6353
71 Ga0068867_100013270 3300005459 Bacteria 5836
72 Ga0068867_100167309 3300005459 Bacteria 1738
73 Ga0070706_100000297 3300005467 Bacteria 60441
74 Ga0070698_100167256 3300005471 Bacteria 2141
75 Ga0070679_100008793 3300005530 Bacteria 9525
76 Ga0068853_100027528 3300005539 Bacteria 4775
77 Ga0068853_100095178 3300005539 Bacteria 2626
78 Ga0068853_100243022 3300005539 Bacteria 1650
79 Ga0070672_100002095 3300005543 Bacteria 12579
80 Ga0070672_100008221 3300005543 Bacteria 7129
81 Ga0070672_100020200 3300005543 Bacteria 4853
82 Ga0070672_100035737 3300005543 Bacteria 3778
83 Ga0070672_100180030 3300005543 Bacteria 1761
84 Ga0070672_100182862 3300005543 Bacteria 1747
85 Ga0070672_100230779 3300005543 Bacteria 1555
86 Ga0070686_100107548 3300005544 Bacteria 1894
87 Ga0070665_100025412 3300005548 Bacteria 5968
88 Ga0070664_100057986 3300005564 Bacteria 3293
89 Ga0070664_100106901 3300005564 Bacteria 2439
90 Ga0068854_100045093 3300005578 Bacteria 3134
91 Ga0068854_100048731 3300005578 Bacteria 3024
92 Ga0068856_100022922 3300005614 Bacteria 6072
93 Ga0068856_100042236 3300005614 Bacteria 4485
94 Ga0068856_100346812 3300005614 Bacteria 1503
95 Ga0070702_100067874 3300005615 Bacteria 2097
96 Ga0068852_100030945 3300005616 Bacteria 4410
97 Ga0068852_100033906 3300005616 Bacteria 4244
98 Ga0068852_100053177 3300005616 Bacteria 3484
99 Ga0068852_100072914 3300005616 Bacteria 3019
100 Ga0068852_100131016 3300005616 Bacteria 2309
101 Ga0068852_100134392 3300005616 Bacteria 2282
102 Ga0068859_100012385 3300005617 Bacteria 8580
103 Ga0068859_100023100 3300005617 Bacteria 6238
104 Ga0068859_100119634 3300005617 Bacteria 2700
105 Ga0068864_100000285 3300005618 Bacteria 45076
106 Ga0068864_100012085 3300005618 Bacteria 7132
107 Ga0068864_100085801 3300005618 Bacteria 2768
108 Ga0068864_100098799 3300005618 Bacteria 2585
109 Ga0068864_100149564 3300005618 Bacteria 2114
110 Ga0068861_100060160 3300005719 Bacteria 2910
111 Ga0068861_100113833 3300005719 Bacteria 2171
112 Ga0068851_10096157 3300005834 Bacteria 1566
113 Ga0068870_10018620 3300005840 Bacteria 3356
114 Ga0068870_10085200 3300005840 Bacteria 1756
115 Ga0068863_100030622 3300005841 Bacteria 5137
116 Ga0068863_100030895 3300005841 Bacteria 5115
117 Ga0068863_100103244 3300005841 Bacteria 2711
118 Ga0068863_100117748 3300005841 Bacteria 2531
119 Ga0068858_100009225 3300005842 Bacteria 9418
120 Ga0068858_100027308 3300005842 Bacteria 5304
121 Ga0068858_100123943 3300005842 Bacteria 2418
122 Ga0068860_100005320 3300005843 Bacteria 13064
123 Ga0068860_100161162 3300005843 Bacteria 2163
124 Ga0068862_100063764 3300005844 Bacteria 3170
125 Ga0075362_10012171 3300006177 Bacteria 3410
126 Ga0075367_10002856 3300006178 Bacteria 8032
127 Ga0075367_10117942 3300006178 Bacteria 1634
128 Ga0075366_10000426 3300006195 Bacteria 19732
129 Ga0075366_10001145 3300006195 Bacteria 13116
130 Ga0075366_10009886 3300006195 Bacteria 5338
131 Ga0075366_10090114 3300006195 Bacteria 1836
132 Ga0097621_100026225 3300006237 Bacteria 4569
133 Ga0097621_100103666 3300006237 Bacteria 2396
134 Ga0075370_10000072 3300006353 Bacteria 31056
135 Ga0075370_10000553 3300006353 Bacteria 14337
136 Ga0075370_10111116 3300006353 Bacteria 1592
137 Ga0068871_100091051 3300006358 Bacteria 2541
138 Ga0075429_100000204 3300006880 Bacteria 39540
139 Ga0068865_100025432 3300006881 Bacteria 3895
140 Ga0097620_100012386 3300006931 Bacteria 8580
141 Ga0097620_100023100 3300006931 Bacteria 6238
142 Ga0097620_100119634 3300006931 Bacteria 2700
143 Ga0105240_10003000 3300009093 Bacteria 26554
144 Ga0105240_10009833 3300009093 Bacteria 13501
145 Ga0105240_10114573 3300009093 Bacteria 3256
146 Ga0105245_10086657 3300009098 Bacteria 2873
147 Ga0105243_10001223 3300009148 Bacteria 23124
148 Ga0105243_10133312 3300009148 Bacteria 2111
149 Ga0105242_10084594 3300009176 Bacteria 2658
150 Ga0105242_10246362 3300009176 Bacteria 1608
151 Ga0105248_10036112 3300009177 Bacteria 5527
152 Ga0105248_10257025 3300009177 Bacteria 1966
153 Ga0105237_10034870 3300009545 Bacteria 5092
154 Ga0105237_10121759 3300009545 Bacteria 2604
155 Ga0105238_10069954 3300009551 Bacteria 3509
156 Ga0105238_10220774 3300009551 Bacteria 1871
157 Ga0105249_10032996 3300009553 Bacteria 4686
158 Ga0105239_10000417 3300010375 Bacteria 62040
159 Ga0157369_10389242 3300013105 Bacteria 1447
160 Ga0157374_10010807 3300013296 Bacteria 7874
161 Ga0163162_10058814 3300013306 Bacteria 3874
162 Ga0163162_10098721 3300013306 Bacteria 3010
163 Ga0163162_10178021 3300013306 Bacteria 2252
164 Ga0157372_10380026 3300013307 Bacteria 1646
165 Ga0157375_10012669 3300013308 Bacteria 7485
166 Ga0157375_10025277 3300013308 Bacteria 5514
167 Ga0157375_10042236 3300013308 Bacteria 4412
168 Ga0157375_10097173 3300013308 Bacteria 3019
169 Ga0163163_10007398 3300014325 Bacteria 9694
170 Ga0163163_10216762 3300014325 Bacteria 1963
171 Ga0157380_10033653 3300014326 Bacteria 3947
172 Ga0157380_10064322 3300014326 Bacteria 2944
173 Ga0157380_10116368 3300014326 Bacteria 2256
174 Ga0157377_10000104 3300014745 Bacteria 58794
175 Ga0157379_10002716 3300014968 Bacteria 14935
176 Ga0157379_10033102 3300014968 Bacteria 4609
177 Ga0157376_10046425 3300014969 Bacteria 3582
178 Ga0157376_10109533 3300014969 Bacteria 2428
179 Ga0163161_10003223 3300017792 Bacteria 11481
180 Ga0163161_10028113 3300017792 Bacteria 3991
181 Ga0163161_10064080 3300017792 Bacteria 2680
182 Ga0213872_10032634 3300021361 Bacteria 2386
183 Ga0209674_100003 3300025226 Bacteria 2196646
184 Ga0209563_100192 3300025230 Bacteria 33961
185 Ga0207427_101622 3300025231 Bacteria 7628
186 Ga0209258_100291 3300025242 Bacteria 82373
187 Ga0207425_1000652 3300025245 Bacteria 19165
188 Ga0209646_1000127 3300025246 Bacteria 131920
189 Ga0209026_1000004 3300025250 Bacteria 949012
190 Ga0209677_100085 3300025253 Bacteria 116046
191 Ga0209677_100107 3300025253 Bacteria 89035
192 Ga0209759_1000129 3300025256 Bacteria 131961
193 Ga0209759_1010280 3300025256 Bacteria 2752
194 Ga0209129_1000027 3300025258 Bacteria 409587
195 Ga0209455_1000208 3300025272 Bacteria 83420
196 Ga0209673_1012585 3300025273 Bacteria 3399
197 Ga0209564_1000014 3300025295 Bacteria 621501
198 Ga0209758_1000193 3300025297 Bacteria 134744
199 Ga0209758_1000208 3300025297 Bacteria 128596
200 Ga0209050_1000198 3300025298 Bacteria 134820
201 Ga0209051_1000354 3300025303 Bacteria 68119
202 Ga0209051_1007471 3300025303 Bacteria 5965
203 Ga0207697_10008003 3300025315 Bacteria 4667
204 Ga0207682_10003348 3300025893 Bacteria 6990
205 Ga0207682_10016719 3300025893 Bacteria 2862
206 Ga0207680_10006829 3300025903 Bacteria 5540
207 Ga0207680_10177315 3300025903 Bacteria 1439
208 Ga0207645_10010246 3300025907 Bacteria 6442
209 Ga0207645_10020090 3300025907 Bacteria 4374
210 Ga0207645_10037095 3300025907 Bacteria 3129
211 Ga0207643_10023279 3300025908 Bacteria 3415
212 Ga0207684_10006695 3300025910 Bacteria 10469
213 Ga0207695_10004036 3300025913 Bacteria 20195
214 Ga0207695_10022029 3300025913 Bacteria 7250
215 Ga0207695_10080481 3300025913 Bacteria 3299
216 Ga0207671_10042127 3300025914 Bacteria 3380
217 Ga0207660_10118156 3300025917 Bacteria 2005
218 Ga0207662_10058424 3300025918 Bacteria 2309
219 Ga0207657_10035681 3300025919 Bacteria 4458
220 Ga0207649_10142761 3300025920 Bacteria 1640
221 Ga0207652_10079422 3300025921 Bacteria 2866
222 Ga0207681_10023280 3300025923 Bacteria 3959
223 Ga0207681_10102948 3300025923 Bacteria 2062
224 Ga0207681_10142182 3300025923 Bacteria 1788
225 Ga0207694_10044865 3300025924 Bacteria 3413
226 Ga0207650_10000618 3300025925 Bacteria 28421
227 Ga0207650_10001257 3300025925 Bacteria 18423
228 Ga0207650_10015367 3300025925 Bacteria 5330
229 Ga0207650_10052005 3300025925 Bacteria 3033
230 Ga0207650_10160947 3300025925 Bacteria 1778
231 Ga0207659_10000081 3300025926 Bacteria 58985
232 Ga0207659_10000677 3300025926 Bacteria 20212
233 Ga0207659_10005890 3300025926 Bacteria 7483
234 Ga0207687_10040555 3300025927 Bacteria 3192
235 Ga0207644_10000608 3300025931 Bacteria 22775
236 Ga0207644_10007142 3300025931 Bacteria 7276
237 Ga0207644_10007292 3300025931 Bacteria 7198
238 Ga0207644_10026684 3300025931 Bacteria 3984
239 Ga0207644_10093348 3300025931 Bacteria 2247
240 Ga0207644_10131544 3300025931 Bacteria 1916
241 Ga0207706_10000544 3300025933 Bacteria 39990
242 Ga0207706_10019930 3300025933 Bacteria 6028
243 Ga0207706_10031357 3300025933 Bacteria 4736
244 Ga0207706_10040396 3300025933 Bacteria 4134
245 Ga0207706_10141600 3300025933 Bacteria 2116
246 Ga0207706_10252623 3300025933 Bacteria 1540
247 Ga0207686_10042692 3300025934 Bacteria 2774
248 Ga0207709_10003449 3300025935 Bacteria 9399
249 Ga0207709_10136768 3300025935 Bacteria 1679
250 Ga0207670_10002024 3300025936 Bacteria 10641
251 Ga0207669_10002305 3300025937 Bacteria 8117
252 Ga0207669_10068345 3300025937 Bacteria 2218
253 Ga0207704_10029680 3300025938 Bacteria 3054
254 Ga0207704_10040177 3300025938 Bacteria 2731
255 Ga0207704_10057312 3300025938 Bacteria 2392
256 Ga0207691_10001539 3300025940 Bacteria 22944
257 Ga0207691_10004718 3300025940 Bacteria 13191
258 Ga0207691_10033002 3300025940 Bacteria 4822
259 Ga0207691_10050243 3300025940 Bacteria 3818
260 Ga0207691_10052068 3300025940 Bacteria 3740
261 Ga0207691_10102281 3300025940 Bacteria 2556
262 Ga0207691_10271501 3300025940 Bacteria 1460
263 Ga0207711_10018083 3300025941 Bacteria 5860
264 Ga0207711_10262883 3300025941 Bacteria 1586
265 Ga0207689_10000910 3300025942 Bacteria 28375
266 Ga0207689_10007414 3300025942 Bacteria 9619
267 Ga0207689_10009348 3300025942 Bacteria 8468
268 Ga0207689_10071646 3300025942 Bacteria 2847
269 Ga0207689_10154379 3300025942 Bacteria 1892
270 Ga0207661_10117555 3300025944 Bacteria 2259
271 Ga0207651_10000149 3300025960 Bacteria 30455
272 Ga0207651_10002411 3300025960 Bacteria 8929
273 Ga0207651_10046319 3300025960 Bacteria 2923
274 Ga0207651_10102271 3300025960 Bacteria 2129
275 Ga0207712_10038171 3300025961 Bacteria 3283
276 Ga0207668_10026369 3300025972 Bacteria 3772
277 Ga0207640_10037131 3300025981 Bacteria 3063
278 Ga0207658_10000692 3300025986 Bacteria 29298
279 Ga0207658_10002216 3300025986 Bacteria 14427
280 Ga0207658_10007279 3300025986 Bacteria 7546
281 Ga0207658_10093310 3300025986 Bacteria 2340
282 Ga0207658_10268878 3300025986 Bacteria 1456
283 Ga0207677_10001033 3300026023 Bacteria 15329
284 Ga0207703_10000699 3300026035 Bacteria 33208
285 Ga0207703_10003861 3300026035 Bacteria 12452
286 Ga0207639_10032951 3300026041 Bacteria 3819
287 Ga0207639_10084466 3300026041 Bacteria 2522
288 Ga0207639_10106339 3300026041 Bacteria 2277
289 Ga0207639_10141067 3300026041 Bacteria 2008
290 Ga0207678_10004524 3300026067 Bacteria 12505
291 Ga0207678_10134598 3300026067 Bacteria 2109
292 Ga0207678_10227042 3300026067 Bacteria 1598
293 Ga0207708_10050726 3300026075 Bacteria 3159
294 Ga0207702_10289570 3300026078 Bacteria 1551
295 Ga0207641_10000568 3300026088 Bacteria 41284
296 Ga0207641_10002869 3300026088 Bacteria 15635
297 Ga0207641_10015026 3300026088 Bacteria 6345
298 Ga0207648_10000243 3300026089 Bacteria 58746
299 Ga0207648_10012371 3300026089 Bacteria 7989
300 Ga0207648_10016616 3300026089 Bacteria 6718
301 Ga0207648_10040454 3300026089 Bacteria 4096
302 Ga0207648_10046980 3300026089 Bacteria 3785
303 Ga0207648_10049293 3300026089 Bacteria 3685
304 Ga0207648_10077747 3300026089 Bacteria 2894
305 Ga0207648_10123455 3300026089 Bacteria 2277
306 Ga0207676_10000579 3300026095 Bacteria 30134
307 Ga0207676_10013589 3300026095 Bacteria 5843
308 Ga0207676_10015089 3300026095 Bacteria 5571
309 Ga0207676_10030474 3300026095 Bacteria 4050
310 Ga0207674_10002965 3300026116 Bacteria 21073
311 Ga0207674_10039004 3300026116 Bacteria 4926
312 Ga0207674_10088791 3300026116 Bacteria 3084
313 Ga0207675_100026430 3300026118 Bacteria 5404
314 Ga0207675_100033725 3300026118 Bacteria 4770
315 Ga0207683_10004555 3300026121 Bacteria 11938
316 Ga0207683_10008444 3300026121 Bacteria 8816
317 Ga0207683_10071747 3300026121 Bacteria 3062
318 Ga0207683_10083064 3300026121 Bacteria 2846
319 Ga0207683_10198804 3300026121 Bacteria 1822
320 Ga0207698_10010818 3300026142 Bacteria 5887
321 Ga0207698_10039393 3300026142 Bacteria 3501
322 Ga0207698_10065559 3300026142 Bacteria 2853
323 Ga0207698_10094802 3300026142 Bacteria 2455
324 Ga0207698_10104500 3300026142 Bacteria 2357
325 Ga0209813_10006689 3300027866 Bacteria 2855
326 Ga0268266_10043231 3300028379 Bacteria 3850
327 Ga0268264_10004518 3300028381 Bacteria 11868
328 Ga0268264_10008447 3300028381 Bacteria 8564
329 Ga0265336_10000003 3300028666 Bacteria 423158
330 Ga0307517_10009033 3300028786 Bacteria 14208
331 Ga0307515_10011006 3300028794 Bacteria 17234
332 Ga0307515_10092827 3300028794 Bacteria 3751
333 Ga0307515_10161317 3300028794 Bacteria 2285
334 Ga0307511_10040472 3300030521 Bacteria 3957
335 Ga0307512_10011610 3300030522 Bacteria 8338
336 Ga0307512_10072037 3300030522 Bacteria 2560
337 Ga0307513_10180327 3300031456 Bacteria 1976
338 Ga0307509_10023159 3300031507 Bacteria 6983
339 Ga0307509_10087769 3300031507 Bacteria 3194
340 Ga0307509_10205035 3300031507 Bacteria 1803
341 Ga0307408_100034057 3300031548 Bacteria 3564
342 Ga0307508_10012345 3300031616 Bacteria 7811
343 Ga0307514_10071694 3300031649 Bacteria 2597
344 Ga0307516_10004252 3300031730 Bacteria 17809
345 Ga0307516_10195093 3300031730 Bacteria 1748
346 Ga0307405_10008952 3300031731 Bacteria 5109
347 Ga0307413_10010111 3300031824 Bacteria 4556
348 Ga0307410_10013056 3300031852 Bacteria 4831
349 Ga0307410_10029462 3300031852 Bacteria 3496
350 Ga0307406_10037678 3300031901 Bacteria 2988
351 Ga0307407_10001640 3300031903 Bacteria 8275
352 Ga0307412_10027381 3300031911 Bacteria 3553
353 Ga0307409_100002330 3300031995 Bacteria 9868
354 Ga0307416_100019940 3300032002 Bacteria 4769
355 Ga0307411_10044584 3300032005 Bacteria 2846
356 Ga0307411_10065075 3300032005 Bacteria 2444
357 Ga0307510_10006149 3300033180 Bacteria 14304
358 Ga0307510_10030374 3300033180 Bacteria 6124
359 Ga0307510_10086896 3300033180 Bacteria 2996
360 Ga0373934_0019456 3300035086 Bacteria 2606
361 Ga0373946_0043955 3300035171 Bacteria 1843
362 Ga0373924_0017724 3300035410 Bacteria 2736
363 Ga0373931_0107344 3300035691 Bacteria 1579
364 Ga0373937_0071619 3300036401 Bacteria 3197
365 Ga0373937_0072728 3300036401 Bacteria 3172
366 Ga0373937_0078716 3300036401 Bacteria 3047
367 Ga0373937_0117163 3300036401 Bacteria 2481
368 Ga0395898_0010903 3300037466 Bacteria 9484
369 Ga0395905_0032910 3300037471 Bacteria 4874
370 Ga0395901_0001277 3300038443 Bacteria 26706
371 Ga0395901_0135480 3300038443 Bacteria 2589
372 Ga0436365_1520872 3300039437 Bacteria 3249
373 Ga0436361_0033961 3300039447 Bacteria 8485
374 Ga0436361_0253740 3300039447 Bacteria 1599
375 Ga0466969_0013456 3300044656 Bacteria 4309
376 Ga0466972_0001691 3300044658 Bacteria 10798
377 Ga0466972_0062386 3300044658 Bacteria 1786
378 Ga0466965_0010136 3300044683 Bacteria 4387
379 Ga0466965_0046648 3300044683 Bacteria 2145
380 Ga0466966_0000198 3300044684 Bacteria 40082
381 Ga0466961_0100184 3300044693 Bacteria 1825
382 Ga0466971_0018442 3300044719 Bacteria 3090
383 Ga0466968_0064083 3300044735 Bacteria 1589
384 Ga0466970_0043415 3300044765 Bacteria 2392
385 Ga0466959_0011815 3300045049 Bacteria 6286
386 Ga0466967_0087582 3300045976 Bacteria 2823
387 Ga0495592_0000563 3300046454 Bacteria 26400
388 Ga0495629_0011433 3300046459 Bacteria 6448
389 Ga0495650_0001099 3300046471 Bacteria 29653
390 Ga0495650_0021704 3300046471 Bacteria 3092
391 Ga0495639_0025631 3300046475 Bacteria 2601
392 Ga0495585_0007400 3300046492 Bacteria 6724
393 Ga0495583_0000313 3300046506 Bacteria 76539
394 Ga0495606_0001607 3300046507 Bacteria 29481
395 Ga0495610_0075164 3300046512 Bacteria 1565
396 Ga0495620_0063020 3300046515 Bacteria 1538
397 Ga0495630_0043660 3300046517 Bacteria 3350
398 Ga0495632_0004566 3300046519 Bacteria 9381
399 Ga0495597_0012015 3300046542 Bacteria 4185
400 Ga0495645_0196141 3300046543 Bacteria 1373
401 Ga0495625_0038139 3300046660 Bacteria 3519
402 Ga0495647_0007450 3300046681 Bacteria 3667
403 Ga0495649_0000665 3300046694 Bacteria 28093
404 Ga0495649_0004511 3300046694 Bacteria 9091
405 Ga0495589_0011372 3300046794 Bacteria 4622
406 Ga0495687_000212 3300047443 Bacteria 83406
407 Ga0495687_027767 3300047443 Bacteria 2643
408 Ga0495687_030268 3300047443 Bacteria 2493
409 Ga0495593_0051554 3300047673 Bacteria 2177
410 Ga0496100_0260356 3300048903 Bacteria 1286
411 Ga0496104_0359702 3300048907 Bacteria 1368
412 Ga0496106_0012394 3300048909 Bacteria 6296
413 Ga0496108_0087912 3300048911 Bacteria 2640
414 Ga0496109_0097654 3300048912 Bacteria 2723
415 Ga0495682_0039386 3300049460 Bacteria 1735
416 Ga0501032_0116349 3300049569 Bacteria 1768
417 Ga0501043_0000004 3300049579 Bacteria 291085
418 Ga0501046_0000016 3300049580 Bacteria 234374
419 Ga0501047_0000012 3300049581 Bacteria 368824
420 Ga0501048_0000091 3300049582 Bacteria 48347
421 Ga0501044_0095119 3300049823 Bacteria 3003
422 Ga0501045_0002645 3300049824 Bacteria 12208
423 nmdc:mga03n38_78306_c1 3300050490 Bacteria 1547
424 nmdc:mga0k408_2101_c1 3300050493 Bacteria 10666
425 nmdc:mga0k408_601_c1 3300050493 Bacteria 19883
426 nmdc:mga0k408_617_c1 3300050493 Bacteria 19608
427 nmdc:mga06z11_11256_c1 3300050494 Bacteria 3851
428 nmdc:mga04h51_6317_c1 3300050495 Bacteria 3067
429 nmdc:mga07m45_133_c1 3300050496 Bacteria 29501
430 nmdc:mga07m45_247_c1 3300050496 Bacteria 21997
431 nmdc:mga07m45_33411_c1 3300050496 Bacteria 2857
432 nmdc:mga07m45_47322_c1 3300050496 Bacteria 2418
433 nmdc:mga07m45_55707_c1 3300050496 Bacteria 2235
434 nmdc:mga09592_7090_c1 3300050508 Bacteria 9109
435 Ga0500635_0000072 3300053080 Bacteria 66335
436 Ga0500635_0024039 3300053080 Bacteria 1908
437 Ga0500578_0000006 3300053086 Bacteria 234598
438 Ga0500578_0013231 3300053086 Bacteria 5319
439 Ga0500578_0112880 3300053086 Bacteria 1712
440 Ga0500646_0000644 3300053090 Bacteria 10009
441 Ga0500650_0068642 3300053098 Bacteria 1657
442 Ga0500594_0003767 3300053118 Bacteria 3338
443 Ga0500628_004783 3300053129 Bacteria 2247
444 Ga0500642_0001752 3300053130 Bacteria 6256
445 Ga0500652_001055 3300053131 Bacteria 8942
446 Ga0500559_0000092 3300053136 Bacteria 71917
447 Ga0500559_0027221 3300053136 Bacteria 2439
448 Ga0500568_0003764 3300053139 Bacteria 8304
449 Ga0500622_0000311 3300053156 Bacteria 49557
450 Ga0500622_0000585 3300053156 Bacteria 33068
451 Ga0500645_007537 3300053730 Bacteria 3779
452 Ga0466962_0025684 3300061719 Bacteria 2827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10050395 rootL2_100503952 371
2 3300028794 Ga0307515_10161317 Ga0307515_101613172 380
3 3300005328 Ga0070676_10163966 Ga0070676_101639662 382
4 3300005330 Ga0070690_100078300 Ga0070690_1000783002 382
5 3300005333 Ga0070677_10012207 Ga0070677_100122072 382
6 3300005334 Ga0068869_100007643 Ga0068869_1000076433 382
7 3300005335 Ga0070666_10048871 Ga0070666_100488712 382
8 3300005343 Ga0070687_100040346 Ga0070687_1000403462 382
9 3300005347 Ga0070668_100011645 Ga0070668_1000116453 382
10 3300005354 Ga0070675_100037150 Ga0070675_1000371502 382
11 3300005356 Ga0070674_100022958 Ga0070674_1000229583 382
12 3300005367 Ga0070667_100046530 Ga0070667_1000465302 382
13 3300005441 Ga0070700_100037646 Ga0070700_1000376462 382
14 3300005457 Ga0070662_100030667 Ga0070662_1000306671 382
15 3300005459 Ga0068867_100011106 Ga0068867_1000111066 382
16 3300005543 Ga0070672_100035737 Ga0070672_1000357372 382
17 3300005616 Ga0068852_100030945 Ga0068852_1000309452 382
18 3300005617 Ga0068859_100023100 Ga0068859_1000231005 382
19 3300005618 Ga0068864_100098799 Ga0068864_1000987992 382
20 3300005841 Ga0068863_100030895 Ga0068863_1000308953 382
21 3300005842 Ga0068858_100123943 Ga0068858_1001239432 382
22 3300005843 Ga0068860_100005320 Ga0068860_1000053203 382
23 3300005844 Ga0068862_100063764 Ga0068862_1000637642 382
24 3300006931 Ga0097620_100023100 Ga0097620_1000231005 382
25 3300009176 Ga0105242_10246362 Ga0105242_102463622 382
26 3300009177 Ga0105248_10257025 Ga0105248_102570252 382
27 3300013306 Ga0163162_10098721 Ga0163162_100987212 382
28 3300013308 Ga0157375_10097173 Ga0157375_100971732 382
29 3300014326 Ga0157380_10033653 Ga0157380_100336533 382
30 3300014968 Ga0157379_10002716 Ga0157379_100027169 382
31 3300017792 Ga0163161_10064080 Ga0163161_100640802 382
32 3300025893 Ga0207682_10016719 Ga0207682_100167192 382
33 3300025903 Ga0207680_10006829 Ga0207680_100068292 382
34 3300025907 Ga0207645_10020090 Ga0207645_100200903 382
35 3300025918 Ga0207662_10058424 Ga0207662_100584242 382
36 3300025923 Ga0207681_10023280 Ga0207681_100232802 382
37 3300025933 Ga0207706_10019930 Ga0207706_100199303 382
38 3300025938 Ga0207704_10029680 Ga0207704_100296801 382
39 3300025942 Ga0207689_10007414 Ga0207689_100074142 382
40 3300025972 Ga0207668_10026369 Ga0207668_100263693 382
41 3300025986 Ga0207658_10002216 Ga0207658_100022166 382
42 3300026067 Ga0207678_10134598 Ga0207678_101345982 382
43 3300026075 Ga0207708_10050726 Ga0207708_100507263 382
44 3300026088 Ga0207641_10002869 Ga0207641_100028693 382
45 3300026089 Ga0207648_10049293 Ga0207648_100492933 382
46 3300026095 Ga0207676_10030474 Ga0207676_100304743 382
47 3300026121 Ga0207683_10083064 Ga0207683_100830642 382
48 3300026142 Ga0207698_10065559 Ga0207698_100655592 382
49 3300028381 Ga0268264_10004518 Ga0268264_100045182 382
50 3300046459 Ga0495629_0011433 Ga0495629_0011433_2581_3813 383
51 3300046681 Ga0495647_0007450 Ga0495647_0007450_2123_3355 383
52 3300025920 Ga0207649_10142761 Ga0207649_101427612 386
53 3300026041 Ga0207639_10032951 Ga0207639_100329512 386
54 3300005354 Ga0070675_100028246 Ga0070675_1000282463 388
55 3300025907 Ga0207645_10010246 Ga0207645_100102462 388
56 3300025942 Ga0207689_10154379 Ga0207689_101543792 388
57 3300025944 Ga0207661_10117555 Ga0207661_101175552 388
58 3300013307 Ga0157372_10380026 Ga0157372_103800262 389
59 3300036401 Ga0373937_0078716 Ga0373937_0078716_1759_2991 389
60 3300046542 Ga0495597_0012015 Ga0495597_0012015_1030_2265 390
61 3300047443 Ga0495687_000212 Ga0495687_000212_73236_74471 390
62 3300005355 Ga0070671_100147759 Ga0070671_1001477592 391
63 3300005459 Ga0068867_100167309 Ga0068867_1001673092 391
64 3300025931 Ga0207644_10093348 Ga0207644_100933482 391
65 3300026089 Ga0207648_10040454 Ga0207648_100404542 391
66 3300026116 Ga0207674_10039004 Ga0207674_100390042 391
67 3300031507 Ga0307509_10023159 Ga0307509_100231594 392
68 3300028794 Ga0307515_10011006 Ga0307515_1001100612 393
69 3300030522 Ga0307512_10072037 Ga0307512_100720372 393
70 3300031507 Ga0307509_10087769 Ga0307509_100877692 393
71 3300033180 Ga0307510_10086896 Ga0307510_100868962 393
72 3300028786 Ga0307517_10009033 Ga0307517_100090336 394
73 3300031456 Ga0307513_10180327 Ga0307513_101803272 395
74 3300031616 Ga0307508_10012345 Ga0307508_100123458 395
75 iso_pu_bacteria 2585428058 2587731589 395
76 iso_pu_bacteria 2585428057 2587725050 397
77 iso_pu_bacteria 2588253510 2588292555 397
78 iso_pu_bacteria 2643221592 2643968070 397
79 iso_pu_bacteria 2643221625 2644142574 397
80 iso_pu_bacteria 2643221648 2644276927 397
81 3300025303 Ga0209051_1000354 Ga0209051_100035446 398
82 iso_pu_bacteria 2643221654 2644301835 398
83 3300005335 Ga0070666_10155094 Ga0070666_101550942 399
84 3300005364 Ga0070673_100016869 Ga0070673_1000168692 399
85 3300005367 Ga0070667_100005561 Ga0070667_1000055617 399
86 3300005543 Ga0070672_100180030 Ga0070672_1001800302 399
87 3300005842 Ga0068858_100009225 Ga0068858_1000092253 399
88 3300006353 Ga0075370_10111116 Ga0075370_101111162 399
89 3300014326 Ga0157380_10064322 Ga0157380_100643223 399
90 3300025903 Ga0207680_10177315 Ga0207680_101773151 399
91 3300025940 Ga0207691_10050243 Ga0207691_100502433 399
92 3300026035 Ga0207703_10003861 Ga0207703_100038613 399
93 3300026142 Ga0207698_10104500 Ga0207698_101045002 399
94 3300028381 Ga0268264_10008447 Ga0268264_100084473 399
95 3300048907 Ga0496104_0359702 Ga0496104_0359702_54_1274 399
96 3300050496 nmdc:mga07m45_47322_c1 nmdc:mga07m45_47322_c1_99_1313 399
97 3300050496 nmdc:mga07m45_55707_c1 nmdc:mga07m45_55707_c1_197_1399 399
98 3300005336 Ga0070680_100004941 Ga0070680_1000049412 400
99 3300005354 Ga0070675_100033316 Ga0070675_1000333162 400
100 3300005457 Ga0070662_100002892 Ga0070662_1000028927 400
101 3300005459 Ga0068867_100000083 Ga0068867_10000008344 400
102 3300005530 Ga0070679_100008793 Ga0070679_1000087939 400
103 3300005539 Ga0068853_100027528 Ga0068853_1000275284 400
104 3300005539 Ga0068853_100095178 Ga0068853_1000951782 400
105 3300005614 Ga0068856_100042236 Ga0068856_1000422361 400
106 3300005614 Ga0068856_100346812 Ga0068856_1003468122 400
107 3300005616 Ga0068852_100053177 Ga0068852_1000531772 400
108 3300005841 Ga0068863_100030622 Ga0068863_1000306223 400
109 3300009093 Ga0105240_10003000 Ga0105240_1000300013 400
110 3300009148 Ga0105243_10001223 Ga0105243_1000122314 400
111 3300009545 Ga0105237_10121759 Ga0105237_101217592 400
112 3300009551 Ga0105238_10069954 Ga0105238_100699543 400
113 3300009551 Ga0105238_10220774 Ga0105238_102207742 400
114 3300010375 Ga0105239_10000417 Ga0105239_100004179 400
115 3300013105 Ga0157369_10389242 Ga0157369_103892421 400
116 3300013296 Ga0157374_10010807 Ga0157374_100108075 400
117 3300014745 Ga0157377_10000104 Ga0157377_1000010410 400
118 3300025913 Ga0207695_10004036 Ga0207695_1000403610 400
119 3300025917 Ga0207660_10118156 Ga0207660_101181562 400
120 3300025919 Ga0207657_10035681 Ga0207657_100356814 400
121 3300025921 Ga0207652_10079422 Ga0207652_100794222 400
122 3300025924 Ga0207694_10044865 Ga0207694_100448653 400
123 3300025931 Ga0207644_10131544 Ga0207644_101315442 400
124 3300025933 Ga0207706_10000544 Ga0207706_1000054428 400
125 3300025933 Ga0207706_10031357 Ga0207706_100313573 400
126 3300025935 Ga0207709_10003449 Ga0207709_100034495 400
127 3300025942 Ga0207689_10000910 Ga0207689_1000091020 400
128 3300026041 Ga0207639_10084466 Ga0207639_100844662 400
129 3300026041 Ga0207639_10106339 Ga0207639_101063392 400
130 3300026067 Ga0207678_10004524 Ga0207678_100045242 400
131 3300026078 Ga0207702_10289570 Ga0207702_102895702 400
132 3300026089 Ga0207648_10000243 Ga0207648_1000024310 400
133 3300026142 Ga0207698_10010818 Ga0207698_100108184 400
134 3300031995 Ga0307409_100002330 Ga0307409_1000023309 400
135 3300032005 Ga0307411_10065075 Ga0307411_100650752 400
136 3300036401 Ga0373937_0072728 Ga0373937_0072728_731_1963 400
137 3300037471 Ga0395905_0032910 Ga0395905_0032910_1116_2324 400
138 3300039437 Ga0436365_1520872 Ga0436365_1520872_19_1242 400
139 3300044656 Ga0466969_0013456 Ga0466969_0013456_2893_4101 400
140 3300044658 Ga0466972_0001691 Ga0466972_0001691_8295_9506 400
141 3300044658 Ga0466972_0062386 Ga0466972_0062386_27_1235 400
142 3300044683 Ga0466965_0010136 Ga0466965_0010136_108_1316 400
143 3300044683 Ga0466965_0046648 Ga0466965_0046648_500_1708 400
144 3300044765 Ga0466970_0043415 Ga0466970_0043415_651_1859 400
145 3300045049 Ga0466959_0011815 Ga0466959_0011815_1466_2674 400
146 3300046471 Ga0495650_0001099 Ga0495650_0001099_8768_9976 400
147 3300047443 Ga0495687_027767 Ga0495687_027767_1117_2370 400
148 3300047443 Ga0495687_030268 Ga0495687_030268_145_1377 400
149 3300049569 Ga0501032_0116349 Ga0501032_0116349_25_1227 400
150 3300049579 Ga0501043_0000004 Ga0501043_0000004_210248_211450 400
151 3300049580 Ga0501046_0000016 Ga0501046_0000016_80386_81588 400
152 3300049581 Ga0501047_0000012 Ga0501047_0000012_80066_81268 400
153 3300049582 Ga0501048_0000091 Ga0501048_0000091_39072_40274 400
154 3300049823 Ga0501044_0095119 Ga0501044_0095119_466_1668 400
155 3300049824 Ga0501045_0002645 Ga0501045_0002645_8457_9659 400
156 3300061719 Ga0466962_0025684 Ga0466962_0025684_1084_2292 400
157 3300002773 JGI25152J39213_1002069 JGI25152J39213_10020697 401
158 3300003215 JGI25153J46596_10000500 JGI25153J46596_100005004 401
159 3300003215 JGI25153J46596_10003835 JGI25153J46596_100038355 401
160 3300003791 Ga0055530_10003147 Ga0055530_100031473 401
161 3300005262 Ga0065165_1007460 Ga0065165_10074602 401
162 3300005328 Ga0070676_10094449 Ga0070676_100944491 401
163 3300005331 Ga0070670_100005189 Ga0070670_1000051892 401
164 3300005331 Ga0070670_100021421 Ga0070670_1000214213 401
165 3300005331 Ga0070670_100078158 Ga0070670_1000781582 401
166 3300005331 Ga0070670_100097868 Ga0070670_1000978682 401
167 3300005333 Ga0070677_10002208 Ga0070677_100022083 401
168 3300005333 Ga0070677_10011847 Ga0070677_100118473 401
169 3300005338 Ga0068868_100022227 Ga0068868_1000222272 401
170 3300005338 Ga0068868_100142368 Ga0068868_1001423682 401
171 3300005340 Ga0070689_100012922 Ga0070689_1000129223 401
172 3300005344 Ga0070661_100165550 Ga0070661_1001655501 401
173 3300005354 Ga0070675_100000175 Ga0070675_10000017529 401
174 3300005354 Ga0070675_100002079 Ga0070675_1000020793 401
175 3300005354 Ga0070675_100016398 Ga0070675_1000163985 401
176 3300005355 Ga0070671_100001332 Ga0070671_10000133211 401
177 3300005355 Ga0070671_100011153 Ga0070671_1000111533 401
178 3300005355 Ga0070671_100011585 Ga0070671_1000115853 401
179 3300005355 Ga0070671_100079008 Ga0070671_1000790082 401
180 3300005355 Ga0070671_100093665 Ga0070671_1000936652 401
181 3300005356 Ga0070674_100004092 Ga0070674_1000040923 401
182 3300005364 Ga0070673_100049783 Ga0070673_1000497832 401
183 3300005364 Ga0070673_100219086 Ga0070673_1002190861 401
184 3300005367 Ga0070667_100005220 Ga0070667_1000052203 401
185 3300005367 Ga0070667_100132854 Ga0070667_1001328541 401
186 3300005455 Ga0070663_100167804 Ga0070663_1001678041 401
187 3300005456 Ga0070678_100003065 Ga0070678_1000030655 401
188 3300005456 Ga0070678_100108233 Ga0070678_1001082331 401
189 3300005456 Ga0070678_100180676 Ga0070678_1001806761 401
190 3300005457 Ga0070662_100051481 Ga0070662_1000514811 401
191 3300005457 Ga0070662_100219989 Ga0070662_1002199891 401
192 3300005459 Ga0068867_100000987 Ga0068867_1000009876 401
193 3300005459 Ga0068867_100013270 Ga0068867_1000132702 401
194 3300005467 Ga0070706_100000297 Ga0070706_10000029756 401
195 3300005471 Ga0070698_100167256 Ga0070698_1001672561 401
196 3300005539 Ga0068853_100243022 Ga0068853_1002430222 401
197 3300005543 Ga0070672_100002095 Ga0070672_10000209514 401
198 3300005543 Ga0070672_100008221 Ga0070672_1000082213 401
199 3300005543 Ga0070672_100020200 Ga0070672_1000202002 401
200 3300005543 Ga0070672_100182862 Ga0070672_1001828622 401
201 3300005543 Ga0070672_100230779 Ga0070672_1002307792 401
202 3300005544 Ga0070686_100107548 Ga0070686_1001075482 401
203 3300005548 Ga0070665_100025412 Ga0070665_1000254123 401
204 3300005564 Ga0070664_100057986 Ga0070664_1000579862 401
205 3300005564 Ga0070664_100106901 Ga0070664_1001069012 401
206 3300005578 Ga0068854_100045093 Ga0068854_1000450933 401
207 3300005578 Ga0068854_100048731 Ga0068854_1000487312 401
208 3300005615 Ga0070702_100067874 Ga0070702_1000678742 401
209 3300005616 Ga0068852_100033906 Ga0068852_1000339063 401
210 3300005616 Ga0068852_100072914 Ga0068852_1000729143 401
211 3300005616 Ga0068852_100131016 Ga0068852_1001310162 401
212 3300005616 Ga0068852_100134392 Ga0068852_1001343921 401
213 3300005617 Ga0068859_100012385 Ga0068859_1000123851 401
214 3300005617 Ga0068859_100119634 Ga0068859_1001196342 401
215 3300005618 Ga0068864_100000285 Ga0068864_10000028510 401
216 3300005618 Ga0068864_100012085 Ga0068864_1000120852 401
217 3300005618 Ga0068864_100085801 Ga0068864_1000858012 401
218 3300005618 Ga0068864_100149564 Ga0068864_1001495641 401
219 3300005719 Ga0068861_100060160 Ga0068861_1000601602 401
220 3300005834 Ga0068851_10096157 Ga0068851_100961571 401
221 3300005840 Ga0068870_10018620 Ga0068870_100186202 401
222 3300005840 Ga0068870_10085200 Ga0068870_100852002 401
223 3300005841 Ga0068863_100103244 Ga0068863_1001032442 401
224 3300005841 Ga0068863_100117748 Ga0068863_1001177482 401
225 3300005842 Ga0068858_100027308 Ga0068858_1000273084 401
226 3300005843 Ga0068860_100161162 Ga0068860_1001611622 401
227 3300006177 Ga0075362_10012171 Ga0075362_100121713 401
228 3300006178 Ga0075367_10002856 Ga0075367_100028562 401
229 3300006178 Ga0075367_10117942 Ga0075367_101179421 401
230 3300006195 Ga0075366_10000426 Ga0075366_1000042613 401
231 3300006195 Ga0075366_10001145 Ga0075366_1000114510 401
232 3300006195 Ga0075366_10090114 Ga0075366_100901141 401
233 3300006237 Ga0097621_100026225 Ga0097621_1000262254 401
234 3300006237 Ga0097621_100103666 Ga0097621_1001036662 401
235 3300006353 Ga0075370_10000072 Ga0075370_100000729 401
236 3300006353 Ga0075370_10000553 Ga0075370_1000055317 401
237 3300006358 Ga0068871_100091051 Ga0068871_1000910512 401
238 3300006880 Ga0075429_100000204 Ga0075429_10000020436 401
239 3300006881 Ga0068865_100025432 Ga0068865_1000254322 401
240 3300006931 Ga0097620_100012386 Ga0097620_1000123861 401
241 3300006931 Ga0097620_100119634 Ga0097620_1001196342 401
242 3300009098 Ga0105245_10086657 Ga0105245_100866573 401
243 3300009148 Ga0105243_10133312 Ga0105243_101333122 401
244 3300009176 Ga0105242_10084594 Ga0105242_100845942 401
245 3300009177 Ga0105248_10036112 Ga0105248_100361125 401
246 3300009545 Ga0105237_10034870 Ga0105237_100348701 401
247 3300009553 Ga0105249_10032996 Ga0105249_100329963 401
248 3300013306 Ga0163162_10058814 Ga0163162_100588144 401
249 3300013306 Ga0163162_10178021 Ga0163162_101780212 401
250 3300013308 Ga0157375_10012669 Ga0157375_100126692 401
251 3300013308 Ga0157375_10025277 Ga0157375_100252773 401
252 3300013308 Ga0157375_10042236 Ga0157375_100422362 401
253 3300014325 Ga0163163_10007398 Ga0163163_100073986 401
254 3300014325 Ga0163163_10216762 Ga0163163_102167622 401
255 3300014326 Ga0157380_10116368 Ga0157380_101163682 401
256 3300014968 Ga0157379_10033102 Ga0157379_100331022 401
257 3300014969 Ga0157376_10046425 Ga0157376_100464252 401
258 3300014969 Ga0157376_10109533 Ga0157376_101095332 401
259 3300017792 Ga0163161_10003223 Ga0163161_100032238 401
260 3300017792 Ga0163161_10028113 Ga0163161_100281134 401
261 3300021361 Ga0213872_10032634 Ga0213872_100326342 401
262 3300025245 Ga0207425_1000652 Ga0207425_100065217 401
263 3300025258 Ga0209129_1000027 Ga0209129_1000027263 401
264 3300025273 Ga0209673_1012585 Ga0209673_10125852 401
265 3300025295 Ga0209564_1000014 Ga0209564_1000014519 401
266 3300025297 Ga0209758_1000193 Ga0209758_100019344 401
267 3300025297 Ga0209758_1000208 Ga0209758_100020874 401
268 3300025298 Ga0209050_1000198 Ga0209050_100019862 401
269 3300025315 Ga0207697_10008003 Ga0207697_100080032 401
270 3300025893 Ga0207682_10003348 Ga0207682_100033482 401
271 3300025907 Ga0207645_10037095 Ga0207645_100370953 401
272 3300025908 Ga0207643_10023279 Ga0207643_100232792 401
273 3300025910 Ga0207684_10006695 Ga0207684_100066951 401
274 3300025914 Ga0207671_10042127 Ga0207671_100421271 401
275 3300025923 Ga0207681_10102948 Ga0207681_101029481 401
276 3300025923 Ga0207681_10142182 Ga0207681_101421822 401
277 3300025925 Ga0207650_10000618 Ga0207650_1000061814 401
278 3300025925 Ga0207650_10001257 Ga0207650_100012578 401
279 3300025925 Ga0207650_10015367 Ga0207650_100153673 401
280 3300025925 Ga0207650_10052005 Ga0207650_100520052 401
281 3300025925 Ga0207650_10160947 Ga0207650_101609472 401
282 3300025926 Ga0207659_10000081 Ga0207659_1000008143 401
283 3300025926 Ga0207659_10000677 Ga0207659_1000067717 401
284 3300025926 Ga0207659_10005890 Ga0207659_100058903 401
285 3300025927 Ga0207687_10040555 Ga0207687_100405552 401
286 3300025931 Ga0207644_10000608 Ga0207644_1000060815 401
287 3300025931 Ga0207644_10007142 Ga0207644_100071423 401
288 3300025931 Ga0207644_10007292 Ga0207644_100072925 401
289 3300025931 Ga0207644_10026684 Ga0207644_100266842 401
290 3300025933 Ga0207706_10040396 Ga0207706_100403963 401
291 3300025933 Ga0207706_10141600 Ga0207706_101416002 401
292 3300025933 Ga0207706_10252623 Ga0207706_102526231 401
293 3300025934 Ga0207686_10042692 Ga0207686_100426923 401
294 3300025935 Ga0207709_10136768 Ga0207709_101367682 401
295 3300025936 Ga0207670_10002024 Ga0207670_100020247 401
296 3300025937 Ga0207669_10002305 Ga0207669_100023053 401
297 3300025937 Ga0207669_10068345 Ga0207669_100683452 401
298 3300025938 Ga0207704_10040177 Ga0207704_100401773 401
299 3300025938 Ga0207704_10057312 Ga0207704_100573122 401
300 3300025940 Ga0207691_10001539 Ga0207691_1000153914 401
301 3300025940 Ga0207691_10004718 Ga0207691_1000471814 401
302 3300025940 Ga0207691_10033002 Ga0207691_100330024 401
303 3300025940 Ga0207691_10052068 Ga0207691_100520682 401
304 3300025940 Ga0207691_10102281 Ga0207691_101022812 401
305 3300025940 Ga0207691_10271501 Ga0207691_102715011 401
306 3300025941 Ga0207711_10018083 Ga0207711_100180834 401
307 3300025941 Ga0207711_10262883 Ga0207711_102628832 401
308 3300025942 Ga0207689_10009348 Ga0207689_100093483 401
309 3300025960 Ga0207651_10000149 Ga0207651_1000014927 401
310 3300025960 Ga0207651_10002411 Ga0207651_100024116 401
311 3300025960 Ga0207651_10046319 Ga0207651_100463192 401
312 3300025960 Ga0207651_10102271 Ga0207651_101022712 401
313 3300025961 Ga0207712_10038171 Ga0207712_100381711 401
314 3300025981 Ga0207640_10037131 Ga0207640_100371312 401
315 3300025986 Ga0207658_10007279 Ga0207658_100072794 401
316 3300025986 Ga0207658_10093310 Ga0207658_100933102 401
317 3300025986 Ga0207658_10268878 Ga0207658_102688782 401
318 3300026023 Ga0207677_10001033 Ga0207677_100010338 401
319 3300026035 Ga0207703_10000699 Ga0207703_1000069919 401
320 3300026041 Ga0207639_10141067 Ga0207639_101410671 401
321 3300026067 Ga0207678_10227042 Ga0207678_102270422 401
322 3300026088 Ga0207641_10000568 Ga0207641_1000056826 401
323 3300026088 Ga0207641_10015026 Ga0207641_100150264 401
324 3300026089 Ga0207648_10012371 Ga0207648_100123715 401
325 3300026089 Ga0207648_10016616 Ga0207648_100166165 401
326 3300026089 Ga0207648_10046980 Ga0207648_100469802 401
327 3300026089 Ga0207648_10077747 Ga0207648_100777472 401
328 3300026089 Ga0207648_10123455 Ga0207648_101234552 401
329 3300026095 Ga0207676_10000579 Ga0207676_1000057919 401
330 3300026095 Ga0207676_10013589 Ga0207676_100135893 401
331 3300026095 Ga0207676_10015089 Ga0207676_100150892 401
332 3300026116 Ga0207674_10088791 Ga0207674_100887911 401
333 3300026118 Ga0207675_100026430 Ga0207675_1000264304 401
334 3300026121 Ga0207683_10004555 Ga0207683_100045555 401
335 3300026121 Ga0207683_10008444 Ga0207683_100084446 401
336 3300026121 Ga0207683_10071747 Ga0207683_100717471 401
337 3300026121 Ga0207683_10198804 Ga0207683_101988042 401
338 3300026142 Ga0207698_10039393 Ga0207698_100393932 401
339 3300026142 Ga0207698_10094802 Ga0207698_100948022 401
340 3300027866 Ga0209813_10006689 Ga0209813_100066892 401
341 3300030522 Ga0307512_10011610 Ga0307512_100116102 401
342 3300031507 Ga0307509_10205035 Ga0307509_102050351 401
343 3300031548 Ga0307408_100034057 Ga0307408_1000340572 401
344 3300031649 Ga0307514_10071694 Ga0307514_100716942 401
345 3300031730 Ga0307516_10004252 Ga0307516_1000425217 401
346 3300031730 Ga0307516_10195093 Ga0307516_101950932 401
347 3300031731 Ga0307405_10008952 Ga0307405_100089522 401
348 3300031824 Ga0307413_10010111 Ga0307413_100101114 401
349 3300031852 Ga0307410_10013056 Ga0307410_100130561 401
350 3300031852 Ga0307410_10029462 Ga0307410_100294623 401
351 3300031901 Ga0307406_10037678 Ga0307406_100376782 401
352 3300031903 Ga0307407_10001640 Ga0307407_100016403 401
353 3300031911 Ga0307412_10027381 Ga0307412_100273811 401
354 3300032002 Ga0307416_100019940 Ga0307416_1000199404 401
355 3300032005 Ga0307411_10044584 Ga0307411_100445842 401
356 3300033180 Ga0307510_10006149 Ga0307510_1000614913 401
357 3300033180 Ga0307510_10030374 Ga0307510_100303742 401
358 3300035171 Ga0373946_0043955 Ga0373946_0043955_15_1265 401
359 3300035410 Ga0373924_0017724 Ga0373924_0017724_116_1351 401
360 3300035691 Ga0373931_0107344 Ga0373931_0107344_81_1304 401
361 3300036401 Ga0373937_0117163 Ga0373937_0117163_116_1351 401
362 3300039447 Ga0436361_0033961 Ga0436361_0033961_2240_3445 401
363 3300039447 Ga0436361_0253740 Ga0436361_0253740_137_1342 401
364 3300046454 Ga0495592_0000563 Ga0495592_0000563_12933_14153 401
365 3300046492 Ga0495585_0007400 Ga0495585_0007400_4418_5623 401
366 3300046512 Ga0495610_0075164 Ga0495610_0075164_303_1550 401
367 3300046515 Ga0495620_0063020 Ga0495620_0063020_59_1315 401
368 3300046517 Ga0495630_0043660 Ga0495630_0043660_2018_3238 401
369 3300046519 Ga0495632_0004566 Ga0495632_0004566_5139_6374 401
370 3300046660 Ga0495625_0038139 Ga0495625_0038139_1954_3189 401
371 3300046694 Ga0495649_0004511 Ga0495649_0004511_1383_2618 401
372 3300047673 Ga0495593_0051554 Ga0495593_0051554_466_1686 401
373 3300048903 Ga0496100_0260356 Ga0496100_0260356_36_1259 401
374 3300048909 Ga0496106_0012394 Ga0496106_0012394_3938_5185 401
375 3300048911 Ga0496108_0087912 Ga0496108_0087912_1117_2349 401
376 3300049460 Ga0495682_0039386 Ga0495682_0039386_361_1596 401
377 3300050490 nmdc:mga03n38_78306_c1 nmdc:mga03n38_78306_c1_43_1278 401
378 3300050493 nmdc:mga0k408_2101_c1 nmdc:mga0k408_2101_c1_3019_4287 401
379 3300050493 nmdc:mga0k408_601_c1 nmdc:mga0k408_601_c1_10216_11451 401
380 3300050493 nmdc:mga0k408_617_c1 nmdc:mga0k408_617_c1_13306_14541 401
381 3300050494 nmdc:mga06z11_11256_c1 nmdc:mga06z11_11256_c1_2472_3707 401
382 3300050495 nmdc:mga04h51_6317_c1 nmdc:mga04h51_6317_c1_1800_3035 401
383 3300050496 nmdc:mga07m45_133_c1 nmdc:mga07m45_133_c1_23793_25028 401
384 3300050496 nmdc:mga07m45_247_c1 nmdc:mga07m45_247_c1_2669_3904 401
385 3300050496 nmdc:mga07m45_33411_c1 nmdc:mga07m45_33411_c1_811_2070 401
386 3300050508 nmdc:mga09592_7090_c1 nmdc:mga09592_7090_c1_3754_5004 401
387 3300053086 Ga0500578_0000006 Ga0500578_0000006_185558_186766 401
388 3300053086 Ga0500578_0013231 Ga0500578_0013231_144_1391 401
389 3300053086 Ga0500578_0112880 Ga0500578_0112880_346_1554 401
390 3300053090 Ga0500646_0000644 Ga0500646_0000644_7811_9094 401
391 3300053098 Ga0500650_0068642 Ga0500650_0068642_73_1356 401
392 3300053118 Ga0500594_0003767 Ga0500594_0003767_1706_2953 401
393 3300053129 Ga0500628_004783 Ga0500628_004783_86_1294 401
394 3300053130 Ga0500642_0001752 Ga0500642_0001752_3931_5214 401
395 3300053131 Ga0500652_001055 Ga0500652_001055_6672_7955 401
396 3300053136 Ga0500559_0000092 Ga0500559_0000092_66813_68060 401
397 3300053139 Ga0500568_0003764 Ga0500568_0003764_7002_8258 401
398 3300053156 Ga0500622_0000311 Ga0500622_0000311_13433_14641 401
399 3300053156 Ga0500622_0000585 Ga0500622_0000585_844_2091 401
400 3300053730 Ga0500645_007537 Ga0500645_007537_1424_2671 401
401 3300003320 rootH2_10039676 rootH2_100396762 402
402 3300003322 rootL2_10046474 rootL2_100464742 402
403 3300003323 rootH1_10019588 rootH1_100195882 402
404 3300003752 Ga0055539_1000160 Ga0055539_100016046 402
405 3300003756 Ga0055533_1000162 Ga0055533_100016246 402
406 3300005367 Ga0070667_100001024 Ga0070667_10000102423 402
407 3300005719 Ga0068861_100113833 Ga0068861_1001138332 402
408 3300006195 Ga0075366_10009886 Ga0075366_100098866 402
409 3300009093 Ga0105240_10009833 Ga0105240_100098339 402
410 3300009093 Ga0105240_10114573 Ga0105240_101145732 402
411 3300025226 Ga0209674_100003 Ga0209674_1000039 402
412 3300025230 Ga0209563_100192 Ga0209563_1001929 402
413 3300025231 Ga0207427_101622 Ga0207427_1016225 402
414 3300025253 Ga0209677_100107 Ga0209677_1001079 402
415 3300025913 Ga0207695_10022029 Ga0207695_100220295 402
416 3300025913 Ga0207695_10080481 Ga0207695_100804812 402
417 3300025942 Ga0207689_10071646 Ga0207689_100716463 402
418 3300025986 Ga0207658_10000692 Ga0207658_1000069223 402
419 3300026118 Ga0207675_100033725 Ga0207675_1000337255 402
420 3300028379 Ga0268266_10043231 Ga0268266_100432312 402
421 3300028794 Ga0307515_10092827 Ga0307515_100928272 402
422 3300030521 Ga0307511_10040472 Ga0307511_100404722 402
423 3300035086 Ga0373934_0019456 Ga0373934_0019456_216_1427 402
424 3300036401 Ga0373937_0071619 Ga0373937_0071619_271_1506 402
425 3300037466 Ga0395898_0010903 Ga0395898_0010903_7537_8748 402
426 3300038443 Ga0395901_0001277 Ga0395901_0001277_20905_22116 402
427 3300045976 Ga0466967_0087582 Ga0466967_0087582_1033_2241 402
428 3300046506 Ga0495583_0000313 Ga0495583_0000313_44849_46057 402
429 3300046507 Ga0495606_0001607 Ga0495606_0001607_4538_5746 402
430 3300046543 Ga0495645_0196141 Ga0495645_0196141_30_1265 402
431 3300046694 Ga0495649_0000665 Ga0495649_0000665_2742_3950 402
432 3300046794 Ga0495589_0011372 Ga0495589_0011372_645_1853 402
433 3300053080 Ga0500635_0000072 Ga0500635_0000072_43629_44837 402
434 3300053080 Ga0500635_0024039 Ga0500635_0024039_169_1377 402
435 3300053136 Ga0500559_0027221 Ga0500559_0027221_389_1597 402
436 3300028666 Ga0265336_10000003 Ga0265336_10000003301 403
437 3300046475 Ga0495639_0025631 Ga0495639_0025631_745_1956 403
438 3300003761 Ga0055535_1000403 Ga0055535_10004034 404
439 3300003763 Ga0055529_1000195 Ga0055529_10001954 404
440 3300025242 Ga0209258_100291 Ga0209258_1002915 404
441 3300025256 Ga0209759_1010280 Ga0209759_10102803 404
442 3300025272 Ga0209455_1000208 Ga0209455_100020869 404
443 3300025303 Ga0209051_1007471 Ga0209051_10074711 404
444 3300048912 Ga0496109_0097654 Ga0496109_0097654_684_1904 404
445 3300002738 JGI25154J39366_1000106 JGI25154J39366_100010644 406
446 3300002741 JGI25157J39369_1000154 JGI25157J39369_100015426 406
447 3300005614 Ga0068856_100022922 Ga0068856_1000229223 406
448 3300025246 Ga0209646_1000127 Ga0209646_1000127108 406
449 3300025250 Ga0209026_1000004 Ga0209026_1000004850 406
450 3300025253 Ga0209677_100085 Ga0209677_10008579 406
451 3300025256 Ga0209759_1000129 Ga0209759_100012926 406
452 3300026116 Ga0207674_10002965 Ga0207674_1000296517 406
453 3300038443 Ga0395901_0135480 Ga0395901_0135480_806_2026 406
454 3300044684 Ga0466966_0000198 Ga0466966_0000198_21237_22457 406
455 3300044693 Ga0466961_0100184 Ga0466961_0100184_22_1242 406
456 3300044719 Ga0466971_0018442 Ga0466971_0018442_1620_2840 406
457 3300044735 Ga0466968_0064083 Ga0466968_0064083_10_1230 406
458 3300046471 Ga0495650_0021704 Ga0495650_0021704_636_1880 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

62

146

0.96

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

186

413

0.85

PF12146

Hydrolase_4

Serine aminopeptidase, S33

186

413

0.83

PF03096

Ndr

Ndr family

173

427

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

188

419

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9465 149 402
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9312 136 404
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9244 136 404
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.9117 141 401
7dq9-assembly3.cif.gz_C crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.9097 141 401
ID Description Score Start End Superfamily
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9511 149 402 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9322 136 404 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9253 136 404 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9109 149 402 3.40.50.1820
af_Q5AMS7_12_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9051 159 404 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C8AF80-F1-model_v4 Alpha/beta fold hydrolase 0.9883 234 403 GO:0016787
AF-A0A4Q3Y227-F1-model_v4 Alpha/beta fold hydrolase 0.971 155 402 GO:0016020
GO:0016787
AF-A0A1G6W3E4-F1-model_v4 3-oxoadipate enol-lactonase 0.9701 152 405
AF-A0A3M2ERI7-F1-model_v4 deleted 0.969 140 402
AF-A0A4R7PNY0-F1-model_v4 deleted 0.9689 152 402

Feature Viewer

pLDDT pTM Quality
92.26 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map