metagRoot

F448149

General Info

Members	Datasets	Scaffolds	Average Seq Length
458	246	458	501

Family's Representative Sequence

Representative Sequence	3300005530\|Ga0070679_100013307\|Ga0070679_1000133074
Length	577
Sequence	MPSAGGRAHAERAAPAGNASLGALRYRKRCRAHTSKNSDIDPKTAAAWSGPPGEFMRDSSFGTSFLHRGATGVAATALLLALAACGNGDRPATAALRDDPYDASKMDYKTPPAVLSAERHAGEFASGASLNKNGAIAPLDPSPVKEIRLDTTHKIIEIAPGVHFSAWTFGDQVPGPVIRARVGDRIKFTMTNRSDEPAPGIQLTAAPMMHSMDFHSAMVSPQDKYRSIAPGHTISFEFTLNYPGVFMYHCGTPMVLEHIASGMYGMMIVEPRGGYPTKVDREYAVVQSEFYTKPDPGKRKIDGRPLYVLDGDRVRAKAPTYTVFNGRYNKMVDTPLEAKPGERVRLFVMNVGPSNTSSFHVVGTIFDRVWIDGNPDNQFRGMQTVLLGSSSGAVVEFVIPEAGNYVMVDHHFANASQGAIGIIAAGGGAGDPEHHNIPATAAPTDPLAVQGKLAFESKCLACHSIAAGDKLGPDLYGVTKHRDDAWLTRWLKSPEQMLQSDPHAKAMLDKYKVPMPNQGLSDQEIKQYLAYFKWADANLQPQGTIQPQPSAPGTSLPPSQTKSATPMPGHAMEGAKR

Samples

	Sample ID	Description	Type	Environment
1	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
2	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
16	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
20	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
21	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
22	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
23	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
24	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
25	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
26	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
27	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
33	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
37	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
38	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
39	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
50	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
51	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
52	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
53	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
54	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
55	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
56	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
57	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
58	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
59	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
60	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
61	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
62	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
63	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
64	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
67	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
68	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
73	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
74	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
75	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
76	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
77	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
78	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
79	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
80	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
81	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
82	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
83	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
84	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
85	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
89	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
90	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
91	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
92	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
93	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
94	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
95	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
148	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
151	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
152	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
153	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
154	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
155	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
156	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
157	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
158	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
159	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
160	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
161	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
167	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
168	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
169	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
170	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
171	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
172	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
173	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
174	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
175	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
176	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
177	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
178	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
179	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
180	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
181	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
182	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
183	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
184	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
185	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
186	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
187	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
188	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
189	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
190	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
191	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
192	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
193	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
194	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
195	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
196	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
197	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
198	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
199	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
200	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
201	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
202	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
203	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
204	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
215	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
216	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
218	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
234	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
235	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
236	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
237	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
238	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
239	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
240	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
241	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
242	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
243	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
244	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
246	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.09
Nodule	0
Rhizoplane	3.49
Rhizosphere	95.2
Stem	0
Stem Tuber	0
Unclassified	0.22

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070658_10026661	3300005327	Bacteria	4637
2	Ga0070658_10032995	3300005327	Bacteria	4164
3	Ga0070676_10009762	3300005328	Bacteria	5192
4	Ga0070676_10018119	3300005328	Bacteria	3898
5	Ga0070676_10059119	3300005328	Bacteria	2273
6	Ga0070683_100016711	3300005329	Bacteria	6474
7	Ga0070690_100005377	3300005330	Bacteria	7188
8	Ga0070670_100033287	3300005331	Bacteria	4439
9	Ga0068869_100002189	3300005334	Bacteria	11757
10	Ga0068869_100033914	3300005334	Bacteria	3607
11	Ga0068868_100044770	3300005338	Bacteria	3460
12	Ga0068868_100092961	3300005338	Bacteria	2431
13	Ga0068868_100209988	3300005338	Bacteria	1627
14	Ga0070660_100003730	3300005339	Bacteria	10526
15	Ga0070689_100010023	3300005340	Bacteria	6747
16	Ga0070689_100011898	3300005340	Bacteria	6247
17	Ga0070691_10044793	3300005341	Bacteria	2098
18	Ga0070661_100007714	3300005344	Bacteria	7433
19	Ga0070661_100120311	3300005344	Bacteria	1966
20	Ga0070692_10017520	3300005345	Bacteria	3426
21	Ga0070669_100021638	3300005353	Bacteria	4596
22	Ga0070675_100002975	3300005354	Bacteria	12797
23	Ga0070675_100056625	3300005354	Bacteria	3231
24	Ga0070671_100004006	3300005355	Bacteria	11605
25	Ga0070674_100002905	3300005356	Bacteria	9491
26	Ga0070674_100019899	3300005356	Bacteria	4275
27	Ga0070688_100016703	3300005365	Bacteria	4201
28	Ga0070659_100003292	3300005366	Bacteria	11501
29	Ga0070659_100027265	3300005366	Bacteria	4400
30	Ga0070667_100013453	3300005367	Bacteria	6764
31	Ga0070714_100033095	3300005435	Bacteria	4319
32	Ga0070701_10006428	3300005438	Bacteria	4944
33	Ga0070700_100001451	3300005441	Bacteria	11791
34	Ga0070694_100048183	3300005444	Bacteria	2866
35	Ga0070708_100004822	3300005445	Bacteria	10638
36	Ga0070663_100007512	3300005455	Bacteria	6637
37	Ga0070678_100005774	3300005456	Bacteria	7198
38	Ga0070662_100049364	3300005457	Bacteria	3034
39	Ga0070681_10007835	3300005458	Bacteria	10445
40	Ga0070681_10013040	3300005458	Bacteria	8253
41	Ga0068867_100009509	3300005459	Bacteria	6856
42	Ga0068867_100027476	3300005459	Bacteria	4090
43	Ga0070707_100021265	3300005468	Bacteria	6132
44	Ga0070707_100025863	3300005468	Bacteria	5572
45	Ga0070698_100022962	3300005471	Bacteria	6523
46	Ga0070679_100013307	3300005530	Bacteria	7876
47	Ga0070679_100045816	3300005530	Bacteria	4357
48	Ga0070697_100013922	3300005536	Bacteria	6315
49	Ga0068853_100007217	3300005539	Bacteria	8900
50	Ga0068853_100050358	3300005539	Bacteria	3583
51	Ga0068853_100059094	3300005539	Bacteria	3312
52	Ga0070672_100001986	3300005543	Bacteria	12823
53	Ga0070672_100017773	3300005543	Bacteria	5125
54	Ga0070672_100025234	3300005543	Bacteria	4406
55	Ga0070686_100001871	3300005544	Bacteria	11724
56	Ga0070695_100021588	3300005545	Bacteria	3943
57	Ga0070696_100017187	3300005546	Bacteria	4882
58	Ga0070693_100000729	3300005547	Bacteria	14479
59	Ga0070693_100011147	3300005547	Bacteria	4524
60	Ga0070693_100066144	3300005547	Unclassified	2115
61	Ga0068855_100004013	3300005563	Bacteria	17975
62	Ga0068855_100012925	3300005563	Bacteria	10073
63	Ga0068855_100023590	3300005563	Bacteria	7367
64	Ga0068855_100028064	3300005563	Bacteria	6732
65	Ga0070664_100005922	3300005564	Bacteria	9873
66	Ga0070664_100053351	3300005564	Bacteria	3427
67	Ga0068857_100010506	3300005577	Bacteria	8046
68	Ga0068857_100024179	3300005577	Bacteria	5348
69	Ga0068857_100027759	3300005577	Bacteria	4992
70	Ga0068854_100011443	3300005578	Bacteria	5779
71	Ga0068854_100020146	3300005578	Bacteria	4507
72	Ga0068856_100020444	3300005614	Bacteria	6430
73	Ga0068856_100026722	3300005614	Bacteria	5628
74	Ga0068856_100184502	3300005614	Bacteria	2100
75	Ga0068856_100199118	3300005614	Bacteria	2017
76	Ga0070702_100000854	3300005615	Bacteria	11764
77	Ga0070702_100015385	3300005615	Bacteria	3905
78	Ga0068852_100004636	3300005616	Bacteria	9742
79	Ga0068852_100016830	3300005616	Bacteria	5716
80	Ga0068852_100022362	3300005616	Bacteria	5070
81	Ga0068852_100170695	3300005616	Bacteria	2038
82	Ga0068852_100199725	3300005616	Bacteria	1892
83	Ga0068859_100019407	3300005617	Bacteria	6828
84	Ga0068859_100122085	3300005617	Bacteria	2672
85	Ga0068864_100051134	3300005618	Bacteria	3558
86	Ga0068864_100214090	3300005618	Bacteria	1775
87	Ga0068866_10001619	3300005718	Bacteria	9533
88	Ga0068866_10005830	3300005718	Bacteria	5113
89	Ga0068861_100007067	3300005719	Bacteria	7677
90	Ga0068861_100014421	3300005719	Bacteria	5548
91	Ga0068861_100150780	3300005719	Bacteria	1907
92	Ga0068851_10005460	3300005834	Bacteria	5766
93	Ga0068851_10009226	3300005834	Bacteria	4579
94	Ga0068870_10013809	3300005840	Bacteria	3804
95	Ga0068863_100041175	3300005841	Bacteria	4392
96	Ga0068863_100068382	3300005841	Bacteria	3360
97	Ga0068858_100009280	3300005842	Bacteria	9394
98	Ga0068860_100024170	3300005843	Bacteria	5875
99	Ga0068860_100040284	3300005843	Bacteria	4465
100	Ga0068860_100144043	3300005843	Bacteria	2292
101	Ga0068862_100001127	3300005844	Bacteria	25370
102	Ga0068862_100024775	3300005844	Bacteria	5034
103	Ga0068862_100044739	3300005844	Bacteria	3776
104	Ga0075362_10024137	3300006177	Bacteria	2578
105	Ga0075367_10005177	3300006178	Bacteria	6444
106	Ga0075370_10018927	3300006353	Bacteria	3740
107	Ga0068871_100003933	3300006358	Bacteria	10254
108	Ga0068871_100031169	3300006358	Bacteria	4203
109	Ga0068871_100065866	3300006358	Bacteria	2968
110	Ga0075428_100004732	3300006844	Bacteria	15072
111	Ga0075428_100087520	3300006844	Bacteria	3398
112	Ga0075430_100056534	3300006846	Bacteria	3299
113	Ga0075431_100041848	3300006847	Bacteria	4725
114	Ga0075433_10066145	3300006852	Bacteria	3171
115	Ga0075429_100020567	3300006880	Bacteria	5727
116	Ga0075429_100051024	3300006880	Bacteria	3600
117	Ga0068865_100013708	3300006881	Bacteria	5133
118	Ga0068865_100016342	3300006881	Bacteria	4748
119	Ga0075436_100000680	3300006914	Bacteria	22407
120	Ga0075436_100034828	3300006914	Bacteria	3473
121	Ga0097620_100019408	3300006931	Bacteria	6828
122	Ga0097620_100089614	3300006931	Bacteria	3126
123	Ga0097620_100122083	3300006931	Bacteria	2672
124	Ga0075435_100019873	3300007076	Bacteria	5138
125	Ga0105240_10003610	3300009093	Bacteria	23962
126	Ga0105240_10003662	3300009093	Bacteria	23770
127	Ga0105240_10004747	3300009093	Bacteria	20520
128	Ga0105240_10013938	3300009093	Bacteria	11004
129	Ga0105240_10058153	3300009093	Bacteria	4828
130	Ga0105240_10256700	3300009093	Bacteria	2018
131	Ga0111539_10000770	3300009094	Bacteria	41689
132	Ga0111539_10009287	3300009094	Bacteria	12418
133	Ga0111539_10019858	3300009094	Bacteria	8279
134	Ga0111539_10127305	3300009094	Bacteria	2983
135	Ga0111539_10183157	3300009094	Bacteria	2446
136	Ga0105245_10011499	3300009098	Bacteria	7709
137	Ga0105243_10001776	3300009148	Bacteria	18517
138	Ga0105243_10004141	3300009148	Bacteria	11526
139	Ga0105243_10099577	3300009148	Bacteria	2409
140	Ga0105241_10018654	3300009174	Bacteria	5107
141	Ga0105241_10020025	3300009174	Bacteria	4942
142	Ga0105242_10003224	3300009176	Bacteria	12720
143	Ga0105242_10005836	3300009176	Bacteria	9485
144	Ga0105248_10027727	3300009177	Bacteria	6307
145	Ga0105248_10054010	3300009177	Bacteria	4506
146	Ga0105248_10210030	3300009177	Bacteria	2193
147	Ga0105248_10278168	3300009177	Bacteria	1884
148	Ga0105237_10023390	3300009545	Bacteria	6331
149	Ga0105237_10026796	3300009545	Bacteria	5891
150	Ga0105237_10071669	3300009545	Bacteria	3459
151	Ga0105238_10002074	3300009551	Bacteria	20251
152	Ga0105238_10010097	3300009551	Bacteria	9464
153	Ga0105238_10022737	3300009551	Bacteria	6389
154	Ga0105238_10107926	3300009551	Bacteria	2765
155	Ga0105249_10016416	3300009553	Bacteria	6569
156	Ga0105249_10022900	3300009553	Bacteria	5600
157	Ga0105249_10058256	3300009553	Bacteria	3541
158	Ga0105249_10230159	3300009553	Bacteria	1828
159	Ga0105239_10029982	3300010375	Bacteria	5983
160	Ga0105239_10242169	3300010375	Bacteria	2024
161	Ga0157371_10067492	3300013102	Bacteria	2531
162	Ga0157370_10005279	3300013104	Bacteria	14514
163	Ga0157370_10007435	3300013104	Bacteria	11916
164	Ga0157370_10022887	3300013104	Bacteria	6213
165	Ga0157369_10006974	3300013105	Bacteria	13029
166	Ga0157369_10009701	3300013105	Bacteria	11009
167	Ga0157369_10063097	3300013105	Bacteria	3993
168	Ga0157374_10031967	3300013296	Bacteria	4788
169	Ga0157374_10072918	3300013296	Bacteria	3240
170	Ga0157378_10034434	3300013297	Bacteria	4479
171	Ga0157378_10187456	3300013297	Bacteria	1949
172	Ga0163162_10007085	3300013306	Bacteria	10880
173	Ga0163162_10112298	3300013306	Bacteria	2823
174	Ga0163162_10126849	3300013306	Bacteria	2659
175	Ga0157372_10004478	3300013307	Bacteria	14904
176	Ga0157372_10004745	3300013307	Bacteria	14429
177	Ga0157372_10041785	3300013307	Bacteria	5069
178	Ga0157372_10071432	3300013307	Bacteria	3909
179	Ga0157375_10038973	3300013308	Bacteria	4568
180	Ga0157375_10056820	3300013308	Bacteria	3866
181	Ga0163163_10019425	3300014325	Bacteria	6382
182	Ga0157380_10002488	3300014326	Bacteria	12421
183	Ga0157377_10003372	3300014745	Bacteria	7226
184	Ga0157379_10007643	3300014968	Bacteria	9355
185	Ga0157376_10049203	3300014969	Bacteria	3490
186	Ga0157376_10144784	3300014969	Bacteria	2136
187	Ga0163161_10048551	3300017792	Bacteria	3065
188	Ga0207656_10004543	3300025321	Bacteria	4856
189	Ga0207642_10002553	3300025899	Bacteria	5666
190	Ga0207642_10004480	3300025899	Bacteria	4510
191	Ga0207680_10021741	3300025903	Bacteria	3476
192	Ga0207645_10009790	3300025907	Bacteria	6612
193	Ga0207645_10019470	3300025907	Bacteria	4449
194	Ga0207705_10014125	3300025909	Bacteria	5752
195	Ga0207705_10021839	3300025909	Bacteria	4566
196	Ga0207684_10006566	3300025910	Bacteria	10589
197	Ga0207684_10036888	3300025910	Bacteria	4149
198	Ga0207654_10069490	3300025911	Bacteria	2087
199	Ga0207654_10105967	3300025911	Bacteria	1740
200	Ga0207707_10012730	3300025912	Bacteria	7314
201	Ga0207695_10021453	3300025913	Bacteria	7367
202	Ga0207695_10088742	3300025913	Bacteria	3111
203	Ga0207693_10054056	3300025915	Bacteria	3150
204	Ga0207657_10010565	3300025919	Bacteria	9205
205	Ga0207657_10012724	3300025919	Bacteria	8287
206	Ga0207649_10002752	3300025920	Bacteria	9738
207	Ga0207649_10050995	3300025920	Bacteria	2561
208	Ga0207652_10029945	3300025921	Bacteria	4556
209	Ga0207652_10032536	3300025921	Bacteria	4386
210	Ga0207652_10052124	3300025921	Bacteria	3510
211	Ga0207646_10050425	3300025922	Bacteria	3725
212	Ga0207681_10005013	3300025923	Bacteria	8136
213	Ga0207681_10049152	3300025923	Bacteria	2849
214	Ga0207681_10049458	3300025923	Bacteria	2841
215	Ga0207694_10025983	3300025924	Bacteria	4452
216	Ga0207694_10032978	3300025924	Bacteria	3967
217	Ga0207694_10087975	3300025924	Bacteria	2448
218	Ga0207650_10000586	3300025925	Bacteria	29222
219	Ga0207659_10001806	3300025926	Bacteria	12661
220	Ga0207659_10024071	3300025926	Bacteria	4074
221	Ga0207687_10002479	3300025927	Bacteria	12536
222	Ga0207687_10028734	3300025927	Bacteria	3736
223	Ga0207687_10074393	3300025927	Bacteria	2435
224	Ga0207687_10089318	3300025927	Bacteria	2244
225	Ga0207664_10003648	3300025929	Bacteria	10312
226	Ga0207664_10058260	3300025929	Bacteria	3072
227	Ga0207644_10000698	3300025931	Bacteria	21250
228	Ga0207644_10090726	3300025931	Bacteria	2277
229	Ga0207644_10113988	3300025931	Bacteria	2048
230	Ga0207644_10162090	3300025931	Bacteria	1739
231	Ga0207706_10008084	3300025933	Bacteria	9708
232	Ga0207706_10008886	3300025933	Bacteria	9249
233	Ga0207706_10011152	3300025933	Bacteria	8192
234	Ga0207686_10003697	3300025934	Bacteria	8201
235	Ga0207686_10008523	3300025934	Bacteria	5537
236	Ga0207686_10035376	3300025934	Bacteria	2998
237	Ga0207709_10010915	3300025935	Bacteria	5006
238	Ga0207709_10012360	3300025935	Bacteria	4704
239	Ga0207670_10005320	3300025936	Bacteria	7053
240	Ga0207670_10011368	3300025936	Bacteria	5164
241	Ga0207670_10069360	3300025936	Bacteria	2432
242	Ga0207669_10010385	3300025937	Bacteria	4481
243	Ga0207704_10008417	3300025938	Bacteria	4932
244	Ga0207704_10011786	3300025938	Bacteria	4319
245	Ga0207691_10002196	3300025940	Bacteria	19083
246	Ga0207691_10003022	3300025940	Bacteria	16417
247	Ga0207691_10038411	3300025940	Bacteria	4430
248	Ga0207711_10007816	3300025941	Bacteria	8938
249	Ga0207689_10002213	3300025942	Bacteria	18225
250	Ga0207689_10007686	3300025942	Bacteria	9442
251	Ga0207689_10031260	3300025942	Bacteria	4434
252	Ga0207661_10019100	3300025944	Bacteria	5103
253	Ga0207661_10039860	3300025944	Bacteria	3689
254	Ga0207679_10002933	3300025945	Bacteria	10557
255	Ga0207679_10016665	3300025945	Bacteria	4881
256	Ga0207679_10031360	3300025945	Bacteria	3720
257	Ga0207679_10079783	3300025945	Bacteria	2497
258	Ga0207667_10005648	3300025949	Bacteria	15261
259	Ga0207667_10007401	3300025949	Bacteria	13205
260	Ga0207667_10049777	3300025949	Bacteria	4423
261	Ga0207667_10083515	3300025949	Bacteria	3307
262	Ga0207667_10103310	3300025949	Bacteria	2939
263	Ga0207667_10212234	3300025949	Bacteria	1984
264	Ga0207712_10015580	3300025961	Bacteria	4909
265	Ga0207712_10017197	3300025961	Bacteria	4693
266	Ga0207712_10127149	3300025961	Bacteria	1936
267	Ga0207640_10005681	3300025981	Bacteria	6796
268	Ga0207640_10018865	3300025981	Bacteria	4062
269	Ga0207658_10019179	3300025986	Bacteria	4729
270	Ga0207658_10031459	3300025986	Bacteria	3768
271	Ga0207677_10004387	3300026023	Bacteria	7561
272	Ga0207677_10031456	3300026023	Bacteria	3399
273	Ga0207677_10069109	3300026023	Bacteria	2483
274	Ga0207703_10003191	3300026035	Bacteria	13798
275	Ga0207703_10003559	3300026035	Bacteria	13020
276	Ga0207703_10024846	3300026035	Bacteria	4714
277	Ga0207639_10015810	3300026041	Bacteria	5328
278	Ga0207639_10016068	3300026041	Bacteria	5288
279	Ga0207639_10017572	3300026041	Bacteria	5072
280	Ga0207639_10021202	3300026041	Bacteria	4664
281	Ga0207678_10071323	3300026067	Bacteria	2978
282	Ga0207708_10000230	3300026075	Bacteria	44125
283	Ga0207702_10002992	3300026078	Bacteria	15731
284	Ga0207702_10010533	3300026078	Bacteria	7730
285	Ga0207702_10048368	3300026078	Bacteria	3586
286	Ga0207702_10103023	3300026078	Bacteria	2524
287	Ga0207702_10154086	3300026078	Bacteria	2093
288	Ga0207641_10002940	3300026088	Bacteria	15408
289	Ga0207641_10057335	3300026088	Bacteria	3312
290	Ga0207648_10000484	3300026089	Bacteria	44276
291	Ga0207648_10013657	3300026089	Bacteria	7540
292	Ga0207648_10023467	3300026089	Bacteria	5525
293	Ga0207648_10045151	3300026089	Bacteria	3865
294	Ga0207648_10117643	3300026089	Bacteria	2335
295	Ga0207676_10007520	3300026095	Bacteria	7731
296	Ga0207676_10134297	3300026095	Bacteria	2108
297	Ga0207674_10000155	3300026116	Bacteria	80715
298	Ga0207674_10005976	3300026116	Bacteria	14409
299	Ga0207674_10029284	3300026116	Bacteria	5798
300	Ga0207675_100001972	3300026118	Bacteria	20452
301	Ga0207675_100003497	3300026118	Bacteria	15329
302	Ga0207675_100103094	3300026118	Bacteria	2688
303	Ga0207683_10002567	3300026121	Bacteria	15839
304	Ga0207683_10003946	3300026121	Bacteria	12871
305	Ga0207698_10013527	3300026142	Bacteria	5388
306	Ga0207698_10033855	3300026142	Bacteria	3717
307	Ga0207698_10043274	3300026142	Bacteria	3372
308	Ga0207698_10163186	3300026142	Bacteria	1952
309	Ga0209983_1000587	3300027665	Bacteria	7849
310	Ga0209971_1000992	3300027682	Bacteria	7298
311	Ga0209974_10000098	3300027876	Bacteria	24576
312	Ga0207428_10000628	3300027907	Bacteria	41501
313	Ga0207428_10007339	3300027907	Bacteria	10062
314	Ga0207428_10085363	3300027907	Bacteria	2458
315	Ga0268265_10001675	3300028380	Bacteria	18077
316	Ga0268265_10035571	3300028380	Bacteria	3641
317	Ga0268264_10133586	3300028381	Bacteria	2204
318	Ga0307516_10045186	3300031730	Bacteria	4352
319	Ga0307405_10017536	3300031731	Bacteria	3931
320	Ga0307406_10058000	3300031901	Bacteria	2486
321	Ga0307412_10037211	3300031911	Bacteria	3125
322	Ga0307409_100000214	3300031995	Bacteria	23086
323	Ga0307416_100013391	3300032002	Bacteria	5573
324	Ga0307416_100027468	3300032002	Bacteria	4215
325	Ga0307411_10083085	3300032005	Bacteria	2211
326	Ga0307415_100024720	3300032126	Bacteria	3757
327	Ga0373945_0033454	3300035116	Bacteria	1827
328	Ga0373954_0028218	3300035118	Bacteria	2579
329	Ga0373946_0015714	3300035171	Bacteria	2875
330	Ga0373924_0001536	3300035410	Bacteria	7536
331	Ga0373933_0047269	3300035724	Bacteria	2558
332	Ga0373947_0026580	3300035725	Bacteria	3385
333	Ga0373937_0026258	3300036401	Bacteria	5263
334	Ga0373925_0047032	3300037068	Bacteria	3210
335	Ga0453683_0072145	3300044673	Bacteria	2161
336	Ga0453684_0000341	3300044712	Bacteria	194228
337	Ga0453684_0005042	3300044712	Bacteria	26775
338	Ga0451576_0012362	3300045051	Bacteria	9592
339	Ga0451576_0013515	3300045051	Bacteria	9132
340	Ga0451576_0038855	3300045051	Bacteria	5037
341	Ga0495592_0002948	3300046454	Bacteria	12113
342	Ga0495592_0108585	3300046454	Bacteria	1966
343	Ga0495641_0024529	3300046461	Bacteria	2975
344	Ga0495580_0000289	3300046472	Bacteria	40852
345	Ga0495628_0004147	3300046516	Bacteria	12889
346	Ga0495628_0056783	3300046516	Bacteria	3081
347	Ga0495630_0000847	3300046517	Bacteria	21581
348	Ga0495630_0211575	3300046517	Bacteria	1480
349	Ga0495632_0007998	3300046519	Bacteria	6563
350	Ga0495652_0001502	3300046529	Bacteria	25681
351	Ga0495652_0090176	3300046529	Bacteria	2509
352	Ga0495586_0017028	3300046535	Bacteria	3865
353	Ga0495586_0022712	3300046535	Bacteria	3347
354	Ga0495587_0040556	3300046536	Bacteria	2782
355	Ga0495621_0004689	3300046539	Bacteria	3869
356	Ga0495645_0005109	3300046543	Bacteria	8993
357	Ga0495625_0044730	3300046660	Bacteria	3203
358	Ga0495599_0000456	3300046678	Bacteria	23256
359	Ga0495623_0084280	3300046679	Bacteria	1962
360	Ga0495669_0029002	3300046684	Bacteria	2425
361	Ga0495613_0093337	3300046689	Bacteria	2179
362	Ga0495649_0000224	3300046694	Bacteria	49718
363	Ga0495600_0008817	3300046809	Bacteria	6209
364	Ga0495680_0037909	3300047322	Bacteria	3857
365	Ga0495675_0121253	3300047444	Bacteria	1628
366	Ga0495684_0055383	3300047471	Bacteria	3024
367	Ga0495626_0029542	3300048091	Bacteria	2653
368	Ga0496100_0109177	3300048903	Bacteria	1919
369	Ga0496101_0054387	3300048904	Bacteria	2890
370	Ga0496102_0000352	3300048905	Bacteria	55722
371	Ga0496103_0008671	3300048906	Bacteria	6037
372	Ga0496104_0072064	3300048907	Bacteria	3285
373	Ga0496106_0009531	3300048909	Bacteria	7173
374	Ga0496108_0037784	3300048911	Bacteria	4023
375	Ga0496108_0090540	3300048911	Bacteria	2600
376	Ga0496109_0051951	3300048912	Bacteria	3734
377	Ga0496109_0119696	3300048912	Bacteria	2452
378	Ga0496110_0066464	3300048913	Bacteria	3189
379	Ga0496110_0094553	3300048913	Bacteria	2676
380	Ga0496111_0046680	3300048914	Bacteria	3119
381	Ga0496112_0003230	3300048915	Bacteria	13424
382	Ga0496113_0120698	3300048916	Bacteria	2049
383	Ga0496115_0030384	3300048918	Bacteria	4250
384	Ga0501031_0032372	3300049568	Bacteria	3408
385	Ga0501032_0006529	3300049569	Bacteria	8565
386	Ga0501033_0000246	3300049570	Bacteria	52184
387	Ga0501034_0008990	3300049571	Bacteria	10491
388	Ga0501034_0009868	3300049571	Bacteria	9981
389	Ga0501034_0076931	3300049571	Bacteria	3343
390	Ga0501034_0201054	3300049571	Bacteria	1951
391	Ga0501037_0001011	3300049573	Bacteria	20809
392	Ga0501038_0102016	3300049574	Bacteria	2388
393	Ga0501039_0006612	3300049575	Bacteria	8804
394	Ga0501039_0014492	3300049575	Bacteria	6036
395	Ga0501039_0158892	3300049575	Bacteria	1776
396	Ga0501040_0008856	3300049576	Bacteria	6540
397	Ga0501041_0031788	3300049577	Bacteria	3191
398	Ga0501041_0049710	3300049577	Bacteria	2554
399	Ga0501043_0032768	3300049579	Bacteria	4086
400	Ga0501046_0009199	3300049580	Bacteria	8554
401	Ga0501046_0019981	3300049580	Bacteria	5545
402	Ga0501046_0027696	3300049580	Bacteria	4621
403	Ga0501047_0035916	3300049581	Bacteria	4787
404	Ga0501067_0015760	3300049583	Bacteria	4181
405	Ga0501069_0001299	3300049585	Bacteria	12257
406	Ga0501070_0004854	3300049586	Bacteria	11489
407	Ga0501070_0017661	3300049586	Bacteria	5989
408	Ga0501071_0002170	3300049587	Bacteria	11793
409	Ga0501072_0042824	3300049588	Bacteria	3557
410	Ga0501072_0081407	3300049588	Bacteria	2567
411	Ga0501073_0000605	3300049589	Bacteria	25269
412	Ga0501073_0038178	3300049589	Bacteria	3408
413	Ga0501074_0000865	3300049590	Bacteria	19302
414	Ga0501074_0033949	3300049590	Bacteria	3698
415	Ga0501075_0025495	3300049591	Bacteria	4344
416	Ga0501076_0001869	3300049592	Bacteria	14343
417	Ga0501076_0215605	3300049592	Bacteria	1569
418	Ga0501077_0017407	3300049593	Bacteria	4535
419	Ga0501079_0013560	3300049741	Bacteria	6217
420	Ga0501079_0024149	3300049741	Bacteria	4665
421	Ga0501079_0074013	3300049741	Bacteria	2633
422	Ga0501080_0006354	3300049742	Bacteria	10600
423	Ga0501080_0012086	3300049742	Bacteria	7908
424	Ga0501080_0074836	3300049742	Bacteria	3150
425	Ga0501080_0078363	3300049742	Bacteria	3073
426	Ga0501081_0017733	3300049743	Bacteria	4718
427	Ga0501081_0023279	3300049743	Bacteria	4151
428	Ga0501083_0013290	3300049744	Bacteria	5756
429	Ga0501083_0015066	3300049744	Bacteria	5411
430	Ga0501035_0013196	3300049822	Bacteria	7625
431	Ga0501035_0015250	3300049822	Bacteria	7092
432	Ga0501035_0121476	3300049822	Bacteria	2283
433	Ga0501044_0029271	3300049823	Bacteria	5809
434	Ga0501044_0069175	3300049823	Bacteria	3594
435	Ga0501044_0082174	3300049823	Bacteria	3260
436	Ga0501044_0161957	3300049823	Bacteria	2213
437	Ga0501045_0004317	3300049824	Bacteria	9805
438	nmdc:mga0k408_3962_c1	3300050493	Bacteria	7851
439	nmdc:mga07m45_17757_c1	3300050496	Bacteria	3828
440	nmdc:mga05p37_1452_c1	3300050507	Bacteria	27560
441	nmdc:mga09592_301_c1	3300050508	Bacteria	35907
442	nmdc:mga06r32_26997_c1	3300050510	Bacteria	5359
443	nmdc:mga08y16_1492_c1	3300050511	Bacteria	23545
444	nmdc:mga08y16_6386_c1	3300050511	Bacteria	12364
445	nmdc:mga08y16_7256_c1	3300050511	Bacteria	11635
446	nmdc:mga0n895_137209_c1	3300050512	Bacteria	2473
447	nmdc:mga0rr50_20803_c1	3300050513	Bacteria	4465
448	nmdc:mga08x19_7171_c1	3300050514	Bacteria	6623
449	nmdc:mga0a205_184504_c1	3300050515	Bacteria	1980
450	nmdc:mga0a205_35750_c1	3300050515	Bacteria	4771
451	Ga0495595_0015466	3300053084	Bacteria	3255
452	Ga0501084_0011141	3300054114	Bacteria	7448
453	Ga0501084_0021374	3300054114	Bacteria	5393
454	Ga0501082_0006195	3300060353	Bacteria	10380
455	Ga0501082_0017142	3300060353	Bacteria	6239
456	Ga0501082_0079704	3300060353	Bacteria	2825
457	Ga0530510_0001128	3300061734	Bacteria	17750
458	Ga0530510_0035190	3300061734	Bacteria	3608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006178	Ga0075367_10005177	Ga0075367_100051772	438
2	3300049571	Ga0501034_0201054	Ga0501034_0201054_409_1881	451
3	3300049592	Ga0501076_0215605	Ga0501076_0215605_45_1517	451
4	3300006846	Ga0075430_100056534	Ga0075430_1000565343	454
5	3300005338	Ga0068868_100209988	Ga0068868_1002099881	457
6	3300005367	Ga0070667_100013453	Ga0070667_1000134536	457
7	3300005543	Ga0070672_100001986	Ga0070672_10000198613	457
8	3300005840	Ga0068870_10013809	Ga0068870_100138093	457
9	3300025986	Ga0207658_10019179	Ga0207658_100191793	457
10	3300044712	Ga0453684_0000341	Ga0453684_0000341_61188_62594	459
11	3300044673	Ga0453683_0072145	Ga0453683_0072145_286_1710	468
12	3300044712	Ga0453684_0005042	Ga0453684_0005042_20729_22153	468
13	3300045051	Ga0451576_0013515	Ga0451576_0013515_286_1710	468
14	3300049573	Ga0501037_0001011	Ga0501037_0001011_3201_4619	468
15	3300049575	Ga0501039_0158892	Ga0501039_0158892_140_1558	468
16	3300049580	Ga0501046_0009199	Ga0501046_0009199_2008_3426	468
17	3300049586	Ga0501070_0017661	Ga0501070_0017661_740_2158	468
18	3300049591	Ga0501075_0025495	Ga0501075_0025495_2895_4313	468
19	3300045051	Ga0451576_0038855	Ga0451576_0038855_181_1605	469
20	3300048091	Ga0495626_0029542	Ga0495626_0029542_1042_2508	469
21	3300005617	Ga0068859_100122085	Ga0068859_1001220853	470
22	3300005842	Ga0068858_100009280	Ga0068858_1000092803	470
23	3300006931	Ga0097620_100122083	Ga0097620_1001220832	470
24	3300009098	Ga0105245_10011499	Ga0105245_100114992	470
25	3300009148	Ga0105243_10001776	Ga0105243_1000177617	470
26	3300009176	Ga0105242_10003224	Ga0105242_100032243	470
27	3300009177	Ga0105248_10210030	Ga0105248_102100302	470
28	3300013297	Ga0157378_10034434	Ga0157378_100344343	470
29	3300014969	Ga0157376_10144784	Ga0157376_101447842	470
30	3300026035	Ga0207703_10003559	Ga0207703_100035594	470
31	3300005458	Ga0070681_10013040	Ga0070681_100130402	471
32	3300005530	Ga0070679_100045816	Ga0070679_1000458164	471
33	3300025912	Ga0207707_10012730	Ga0207707_100127302	471
34	3300025921	Ga0207652_10032536	Ga0207652_100325365	471
35	3300005338	Ga0068868_100044770	Ga0068868_1000447703	473
36	3300006847	Ga0075431_100041848	Ga0075431_1000418484	473
37	3300006880	Ga0075429_100020567	Ga0075429_1000205673	473
38	3300006914	Ga0075436_100034828	Ga0075436_1000348285	473
39	3300026089	Ga0207648_10045151	Ga0207648_100451513	473
40	3300048913	Ga0496110_0066464	Ga0496110_0066464_219_1661	473
41	3300005353	Ga0070669_100021638	Ga0070669_1000216384	474
42	3300005356	Ga0070674_100019899	Ga0070674_1000198991	474
43	3300005457	Ga0070662_100049364	Ga0070662_1000493642	474
44	3300005459	Ga0068867_100027476	Ga0068867_1000274762	474
45	3300005543	Ga0070672_100017773	Ga0070672_1000177732	474
46	3300005543	Ga0070672_100025234	Ga0070672_1000252343	474
47	3300005719	Ga0068861_100014421	Ga0068861_1000144214	474
48	3300005719	Ga0068861_100150780	Ga0068861_1001507802	474
49	3300005843	Ga0068860_100024170	Ga0068860_1000241704	474
50	3300005844	Ga0068862_100044739	Ga0068862_1000447393	474
51	3300006844	Ga0075428_100087520	Ga0075428_1000875202	474
52	3300006880	Ga0075429_100051024	Ga0075429_1000510241	474
53	3300009174	Ga0105241_10020025	Ga0105241_100200255	474
54	3300009553	Ga0105249_10022900	Ga0105249_100229002	474
55	3300013297	Ga0157378_10187456	Ga0157378_101874561	474
56	3300013306	Ga0163162_10007085	Ga0163162_100070857	474
57	3300013306	Ga0163162_10112298	Ga0163162_101122984	474
58	3300025923	Ga0207681_10049152	Ga0207681_100491522	474
59	3300025933	Ga0207706_10008084	Ga0207706_100080847	474
60	3300025940	Ga0207691_10003022	Ga0207691_1000302210	474
61	3300025940	Ga0207691_10038411	Ga0207691_100384112	474
62	3300025961	Ga0207712_10015580	Ga0207712_100155804	474
63	3300026089	Ga0207648_10013657	Ga0207648_100136573	474
64	3300026089	Ga0207648_10117643	Ga0207648_101176433	474
65	3300026118	Ga0207675_100103094	Ga0207675_1001030942	474
66	3300027665	Ga0209983_1000587	Ga0209983_10005874	474
67	3300027682	Ga0209971_1000992	Ga0209971_10009922	474
68	3300027876	Ga0209974_10000098	Ga0209974_1000009818	474
69	3300046517	Ga0495630_0211575	Ga0495630_0211575_15_1451	474
70	3300046529	Ga0495652_0090176	Ga0495652_0090176_379_1815	474
71	3300046684	Ga0495669_0029002	Ga0495669_0029002_254_1693	474
72	3300049577	Ga0501041_0031788	Ga0501041_0031788_1505_2959	474
73	3300049588	Ga0501072_0081407	Ga0501072_0081407_531_1985	474
74	3300050510	nmdc:mga06r32_26997_c1	nmdc:mga06r32_26997_c1_474_1925	474
75	3300006852	Ga0075433_10066145	Ga0075433_100661452	475
76	3300006914	Ga0075436_100000680	Ga0075436_10000068011	475
77	3300007076	Ga0075435_100019873	Ga0075435_1000198735	475
78	3300046679	Ga0495623_0084280	Ga0495623_0084280_427_1869	475
79	3300050513	nmdc:mga0rr50_20803_c1	nmdc:mga0rr50_20803_c1_1937_3370	475
80	3300050514	nmdc:mga08x19_7171_c1	nmdc:mga08x19_7171_c1_1817_3253	475
81	3300050515	nmdc:mga0a205_35750_c1	nmdc:mga0a205_35750_c1_1123_2556	475
82	3300005328	Ga0070676_10059119	Ga0070676_100591192	476
83	3300005844	Ga0068862_100001127	Ga0068862_10000112730	476
84	3300006844	Ga0075428_100004732	Ga0075428_1000047326	476
85	3300006881	Ga0068865_100013708	Ga0068865_1000137086	476
86	3300009094	Ga0111539_10000770	Ga0111539_1000077041	476
87	3300009094	Ga0111539_10019858	Ga0111539_100198586	476
88	3300009094	Ga0111539_10127305	Ga0111539_101273052	476
89	3300009148	Ga0105243_10004141	Ga0105243_100041418	476
90	3300014326	Ga0157380_10002488	Ga0157380_100024888	476
91	3300025923	Ga0207681_10005013	Ga0207681_100050132	476
92	3300025935	Ga0207709_10010915	Ga0207709_100109153	476
93	3300025936	Ga0207670_10069360	Ga0207670_100693602	476
94	3300025938	Ga0207704_10008417	Ga0207704_100084172	476
95	3300027907	Ga0207428_10007339	Ga0207428_100073394	476
96	3300027907	Ga0207428_10085363	Ga0207428_100853632	476
97	3300028380	Ga0268265_10001675	Ga0268265_1000167514	476
98	3300035724	Ga0373933_0047269	Ga0373933_0047269_883_2325	476
99	3300046454	Ga0495592_0002948	Ga0495592_0002948_4607_6049	476
100	3300046454	Ga0495592_0108585	Ga0495592_0108585_349_1791	476
101	3300046461	Ga0495641_0024529	Ga0495641_0024529_1161_2603	476
102	3300046516	Ga0495628_0004147	Ga0495628_0004147_8976_10418	476
103	3300046517	Ga0495630_0000847	Ga0495630_0000847_16782_18224	476
104	3300046529	Ga0495652_0001502	Ga0495652_0001502_18253_19695	476
105	3300046535	Ga0495586_0022712	Ga0495586_0022712_323_1765	476
106	3300046536	Ga0495587_0040556	Ga0495587_0040556_692_2134	476
107	3300046543	Ga0495645_0005109	Ga0495645_0005109_1562_3004	476
108	3300046678	Ga0495599_0000456	Ga0495599_0000456_21557_22999	476
109	3300046809	Ga0495600_0008817	Ga0495600_0008817_3297_4739	476
110	3300047322	Ga0495680_0037909	Ga0495680_0037909_768_2210	476
111	3300047444	Ga0495675_0121253	Ga0495675_0121253_49_1491	476
112	3300047471	Ga0495684_0055383	Ga0495684_0055383_922_2364	476
113	3300050511	nmdc:mga08y16_7256_c1	nmdc:mga08y16_7256_c1_8362_9945	476
114	3300053084	Ga0495595_0015466	Ga0495595_0015466_343_1785	476
115	3300025927	Ga0207687_10028734	Ga0207687_100287343	477
116	3300045051	Ga0451576_0012362	Ga0451576_0012362_1717_3168	477
117	3300046472	Ga0495580_0000289	Ga0495580_0000289_17910_19355	477
118	3300061734	Ga0530510_0001128	Ga0530510_0001128_2180_3622	477
119	3300005334	Ga0068869_100002189	Ga0068869_1000021892	478
120	3300005338	Ga0068868_100092961	Ga0068868_1000929611	478
121	3300005340	Ga0070689_100010023	Ga0070689_1000100232	478
122	3300005341	Ga0070691_10044793	Ga0070691_100447931	478
123	3300005345	Ga0070692_10017520	Ga0070692_100175202	478
124	3300005438	Ga0070701_10006428	Ga0070701_100064282	478
125	3300005441	Ga0070700_100001451	Ga0070700_1000014516	478
126	3300005444	Ga0070694_100048183	Ga0070694_1000481832	478
127	3300005459	Ga0068867_100009509	Ga0068867_1000095094	478
128	3300005544	Ga0070686_100001871	Ga0070686_10000187110	478
129	3300005545	Ga0070695_100021588	Ga0070695_1000215882	478
130	3300005546	Ga0070696_100017187	Ga0070696_1000171874	478
131	3300005615	Ga0070702_100000854	Ga0070702_10000085411	478
132	3300005617	Ga0068859_100019407	Ga0068859_1000194072	478
133	3300005718	Ga0068866_10005830	Ga0068866_100058302	478
134	3300005843	Ga0068860_100144043	Ga0068860_1001440431	478
135	3300005844	Ga0068862_100024775	Ga0068862_1000247752	478
136	3300006358	Ga0068871_100003933	Ga0068871_1000039334	478
137	3300006931	Ga0097620_100019408	Ga0097620_1000194082	478
138	3300006931	Ga0097620_100089614	Ga0097620_1000896144	478
139	3300009094	Ga0111539_10009287	Ga0111539_100092878	478
140	3300025899	Ga0207642_10002553	Ga0207642_100025532	478
141	3300025927	Ga0207687_10002479	Ga0207687_100024792	478
142	3300025934	Ga0207686_10008523	Ga0207686_100085233	478
143	3300025935	Ga0207709_10012360	Ga0207709_100123604	478
144	3300025936	Ga0207670_10005320	Ga0207670_100053206	478
145	3300025942	Ga0207689_10002213	Ga0207689_1000221317	478
146	3300025961	Ga0207712_10017197	Ga0207712_100171974	478
147	3300026035	Ga0207703_10024846	Ga0207703_100248462	478
148	3300026075	Ga0207708_10000230	Ga0207708_100002306	478
149	3300026089	Ga0207648_10000484	Ga0207648_1000048434	478
150	3300026118	Ga0207675_100001972	Ga0207675_1000019722	478
151	3300027907	Ga0207428_10000628	Ga0207428_1000062838	478
152	3300028381	Ga0268264_10133586	Ga0268264_101335862	478
153	3300048905	Ga0496102_0000352	Ga0496102_0000352_6783_8255	478
154	3300048906	Ga0496103_0008671	Ga0496103_0008671_3086_4558	478
155	3300049577	Ga0501041_0049710	Ga0501041_0049710_42_1496	478
156	3300049588	Ga0501072_0042824	Ga0501072_0042824_332_1786	478
157	3300049592	Ga0501076_0001869	Ga0501076_0001869_12184_13638	478
158	3300049593	Ga0501077_0017407	Ga0501077_0017407_2901_4355	478
159	3300049741	Ga0501079_0013560	Ga0501079_0013560_4645_6099	478
160	3300049743	Ga0501081_0017733	Ga0501081_0017733_2981_4435	478
161	3300050511	nmdc:mga08y16_6386_c1	nmdc:mga08y16_6386_c1_5738_7213	478
162	3300054114	Ga0501084_0021374	Ga0501084_0021374_2730_4184	478
163	3300060353	Ga0501082_0017142	Ga0501082_0017142_1745_3199	478
164	3300061734	Ga0530510_0035190	Ga0530510_0035190_2100_3554	478
165	3300009094	Ga0111539_10183157	Ga0111539_101831572	479
166	3300009177	Ga0105248_10054010	Ga0105248_100540104	479
167	3300049741	Ga0501079_0074013	Ga0501079_0074013_419_1879	479
168	3300050507	nmdc:mga05p37_1452_c1	nmdc:mga05p37_1452_c1_22444_23928	479
169	3300050508	nmdc:mga09592_301_c1	nmdc:mga09592_301_c1_18659_20143	479
170	3300050511	nmdc:mga08y16_1492_c1	nmdc:mga08y16_1492_c1_20987_22447	479
171	3300050515	nmdc:mga0a205_184504_c1	nmdc:mga0a205_184504_c1_230_1690	479
172	3300005445	Ga0070708_100004822	Ga0070708_1000048228	480
173	3300005468	Ga0070707_100025863	Ga0070707_1000258635	480
174	3300005471	Ga0070698_100022962	Ga0070698_1000229626	480
175	3300005536	Ga0070697_100013922	Ga0070697_1000139223	480
176	3300005547	Ga0070693_100066144	Ga0070693_1000661441	480
177	3300025910	Ga0207684_10006566	Ga0207684_100065669	480
178	3300025927	Ga0207687_10074393	Ga0207687_100743933	480
179	3300046535	Ga0495586_0017028	Ga0495586_0017028_1618_3093	480
180	3300005841	Ga0068863_100068382	Ga0068863_1000683822	481
181	3300009177	Ga0105248_10278168	Ga0105248_102781682	481
182	3300009553	Ga0105249_10016416	Ga0105249_100164163	481
183	3300046519	Ga0495632_0007998	Ga0495632_0007998_999_2510	481
184	3300046694	Ga0495649_0000224	Ga0495649_0000224_12302_13813	481
185	3300005328	Ga0070676_10018119	Ga0070676_100181193	482
186	3300005334	Ga0068869_100033914	Ga0068869_1000339143	482
187	3300005354	Ga0070675_100056625	Ga0070675_1000566252	482
188	3300005366	Ga0070659_100027265	Ga0070659_1000272653	482
189	3300005455	Ga0070663_100007512	Ga0070663_1000075124	482
190	3300005539	Ga0068853_100007217	Ga0068853_1000072173	482
191	3300005563	Ga0068855_100023590	Ga0068855_1000235905	482
192	3300005578	Ga0068854_100020146	Ga0068854_1000201463	482
193	3300005614	Ga0068856_100184502	Ga0068856_1001845022	482
194	3300005616	Ga0068852_100022362	Ga0068852_1000223622	482
195	3300005618	Ga0068864_100051134	Ga0068864_1000511343	482
196	3300005843	Ga0068860_100040284	Ga0068860_1000402843	482
197	3300006358	Ga0068871_100031169	Ga0068871_1000311693	482
198	3300009177	Ga0105248_10027727	Ga0105248_100277273	482
199	3300009553	Ga0105249_10058256	Ga0105249_100582561	482
200	3300013306	Ga0163162_10126849	Ga0163162_101268492	482
201	3300013307	Ga0157372_10041785	Ga0157372_100417852	482
202	3300014745	Ga0157377_10003372	Ga0157377_100033724	482
203	3300014968	Ga0157379_10007643	Ga0157379_100076434	482
204	3300014969	Ga0157376_10049203	Ga0157376_100492032	482
205	3300025907	Ga0207645_10019470	Ga0207645_100194705	482
206	3300025920	Ga0207649_10050995	Ga0207649_100509952	482
207	3300025926	Ga0207659_10024071	Ga0207659_100240713	482
208	3300025933	Ga0207706_10011152	Ga0207706_100111528	482
209	3300025941	Ga0207711_10007816	Ga0207711_100078168	482
210	3300025942	Ga0207689_10007686	Ga0207689_100076863	482
211	3300025945	Ga0207679_10079783	Ga0207679_100797833	482
212	3300025961	Ga0207712_10127149	Ga0207712_101271491	482
213	3300026023	Ga0207677_10004387	Ga0207677_100043872	482
214	3300026088	Ga0207641_10057335	Ga0207641_100573352	482
215	3300026095	Ga0207676_10134297	Ga0207676_101342972	482
216	3300026118	Ga0207675_100003497	Ga0207675_1000034975	482
217	3300026142	Ga0207698_10033855	Ga0207698_100338552	482
218	3300048907	Ga0496104_0072064	Ga0496104_0072064_1587_3194	482
219	3300048909	Ga0496106_0009531	Ga0496106_0009531_4467_6074	482
220	3300048911	Ga0496108_0090540	Ga0496108_0090540_464_2071	482
221	3300048912	Ga0496109_0051951	Ga0496109_0051951_222_1829	482
222	3300048914	Ga0496111_0046680	Ga0496111_0046680_527_2134	482
223	3300048918	Ga0496115_0030384	Ga0496115_0030384_2338_3945	482
224	3300049568	Ga0501031_0032372	Ga0501031_0032372_574_2166	482
225	3300049571	Ga0501034_0076931	Ga0501034_0076931_1371_2963	482
226	3300049575	Ga0501039_0014492	Ga0501039_0014492_4012_5604	482
227	3300049576	Ga0501040_0008856	Ga0501040_0008856_4109_5701	482
228	3300049580	Ga0501046_0027696	Ga0501046_0027696_1066_2658	482
229	3300049581	Ga0501047_0035916	Ga0501047_0035916_877_2469	482
230	3300049583	Ga0501067_0015760	Ga0501067_0015760_1029_2621	482
231	3300049585	Ga0501069_0001299	Ga0501069_0001299_9052_10644	482
232	3300049587	Ga0501071_0002170	Ga0501071_0002170_2941_4533	482
233	3300049589	Ga0501073_0038178	Ga0501073_0038178_1243_2835	482
234	3300049741	Ga0501079_0024149	Ga0501079_0024149_491_2083	482
235	3300049742	Ga0501080_0012086	Ga0501080_0012086_3981_5573	482
236	3300049743	Ga0501081_0023279	Ga0501081_0023279_357_1949	482
237	3300049744	Ga0501083_0015066	Ga0501083_0015066_1030_2622	482
238	3300049822	Ga0501035_0015250	Ga0501035_0015250_4462_6054	482
239	3300049824	Ga0501045_0004317	Ga0501045_0004317_5766_7358	482
240	3300054114	Ga0501084_0011141	Ga0501084_0011141_1679_3271	482
241	3300060353	Ga0501082_0006195	Ga0501082_0006195_2053_3645	482
242	3300025911	Ga0207654_10069490	Ga0207654_100694902	483
243	3300005719	Ga0068861_100007067	Ga0068861_1000070678	484
244	3300013296	Ga0157374_10072918	Ga0157374_100729182	484
245	3300017792	Ga0163161_10048551	Ga0163161_100485512	484
246	3300025903	Ga0207680_10021741	Ga0207680_100217414	484
247	3300048904	Ga0496101_0054387	Ga0496101_0054387_407_2008	484
248	3300025931	Ga0207644_10113988	Ga0207644_101139882	485
249	3300025944	Ga0207661_10019100	Ga0207661_100191002	485
250	3300049569	Ga0501032_0006529	Ga0501032_0006529_4190_5806	485
251	3300049570	Ga0501033_0000246	Ga0501033_0000246_34984_36600	485
252	3300049571	Ga0501034_0009868	Ga0501034_0009868_4136_5752	485
253	3300049575	Ga0501039_0006612	Ga0501039_0006612_5180_6796	485
254	3300049580	Ga0501046_0019981	Ga0501046_0019981_3955_5472	485
255	3300049742	Ga0501080_0006354	Ga0501080_0006354_4092_5708	485
256	3300049822	Ga0501035_0013196	Ga0501035_0013196_3127_4743	485
257	3300005329	Ga0070683_100016711	Ga0070683_1000167115	486
258	3300005344	Ga0070661_100007714	Ga0070661_1000077144	486
259	3300005366	Ga0070659_100003292	Ga0070659_1000032929	486
260	3300005614	Ga0068856_100026722	Ga0068856_1000267224	486
261	3300005616	Ga0068852_100016830	Ga0068852_1000168303	486
262	3300005834	Ga0068851_10005460	Ga0068851_100054605	486
263	3300009551	Ga0105238_10022737	Ga0105238_100227375	486
264	3300013105	Ga0157369_10009701	Ga0157369_100097019	486
265	3300013307	Ga0157372_10004478	Ga0157372_100044782	486
266	3300025321	Ga0207656_10004543	Ga0207656_100045434	486
267	3300025909	Ga0207705_10014125	Ga0207705_100141253	486
268	3300025920	Ga0207649_10002752	Ga0207649_100027528	486
269	3300025924	Ga0207694_10032978	Ga0207694_100329783	486
270	3300025944	Ga0207661_10039860	Ga0207661_100398603	486
271	3300025945	Ga0207679_10002933	Ga0207679_100029338	486
272	3300026078	Ga0207702_10002992	Ga0207702_100029928	486
273	3300026116	Ga0207674_10005976	Ga0207674_100059768	486
274	3300028380	Ga0268265_10035571	Ga0268265_100355713	487
275	3300049586	Ga0501070_0004854	Ga0501070_0004854_9172_10758	487
276	3300049589	Ga0501073_0000605	Ga0501073_0000605_17510_19096	487
277	3300049590	Ga0501074_0000865	Ga0501074_0000865_665_2251	487
278	3300049744	Ga0501083_0013290	Ga0501083_0013290_3163_4749	487
279	3300060353	Ga0501082_0079704	Ga0501082_0079704_366_1952	487
280	3300048913	Ga0496110_0094553	Ga0496110_0094553_929_2551	489
281	3300049571	Ga0501034_0008990	Ga0501034_0008990_1945_3579	489
282	3300049574	Ga0501038_0102016	Ga0501038_0102016_578_2212	489
283	3300049742	Ga0501080_0078363	Ga0501080_0078363_1188_2822	489
284	3300005340	Ga0070689_100011898	Ga0070689_1000118983	490
285	3300005547	Ga0070693_100011147	Ga0070693_1000111473	490
286	3300006358	Ga0068871_100065866	Ga0068871_1000658663	490
287	3300025936	Ga0207670_10011368	Ga0207670_100113683	490
288	3300032005	Ga0307411_10083085	Ga0307411_100830851	490
289	3300005328	Ga0070676_10009762	Ga0070676_100097625	491
290	3300005616	Ga0068852_100199725	Ga0068852_1001997251	491
291	3300009093	Ga0105240_10004747	Ga0105240_100047472	491
292	3300009551	Ga0105238_10107926	Ga0105238_101079263	491
293	3300025907	Ga0207645_10009790	Ga0207645_100097905	491
294	3300025924	Ga0207694_10087975	Ga0207694_100879752	491
295	3300025949	Ga0207667_10103310	Ga0207667_101033102	491
296	3300026089	Ga0207648_10023467	Ga0207648_100234676	491
297	3300026142	Ga0207698_10163186	Ga0207698_101631861	491
298	3300046660	Ga0495625_0044730	Ga0495625_0044730_658_2169	491
299	3300049823	Ga0501044_0029271	Ga0501044_0029271_252_1886	491
300	3300009093	Ga0105240_10013938	Ga0105240_100139383	492
301	3300009545	Ga0105237_10026796	Ga0105237_100267962	492
302	3300013104	Ga0157370_10005279	Ga0157370_100052799	492
303	3300048903	Ga0496100_0109177	Ga0496100_0109177_27_1586	492
304	3300049579	Ga0501043_0032768	Ga0501043_0032768_893_2479	492
305	3300050493	nmdc:mga0k408_3962_c1	nmdc:mga0k408_3962_c1_3588_5111	492
306	3300050496	nmdc:mga07m45_17757_c1	nmdc:mga07m45_17757_c1_1939_3462	492
307	3300005327	Ga0070658_10032995	Ga0070658_100329954	493
308	3300025919	Ga0207657_10010565	Ga0207657_100105651	493
309	3300049823	Ga0501044_0161957	Ga0501044_0161957_530_2128	493
310	3300049742	Ga0501080_0074836	Ga0501080_0074836_961_2556	494
311	3300050512	nmdc:mga0n895_137209_c1	nmdc:mga0n895_137209_c1_302_1912	495
312	3300005356	Ga0070674_100002905	Ga0070674_1000029056	496
313	3300049590	Ga0501074_0033949	Ga0501074_0033949_1545_3161	496
314	3300005539	Ga0068853_100059094	Ga0068853_1000590942	498
315	3300005577	Ga0068857_100010506	Ga0068857_1000105062	498
316	3300006177	Ga0075362_10024137	Ga0075362_100241371	498
317	3300006353	Ga0075370_10018927	Ga0075370_100189273	498
318	3300025913	Ga0207695_10088742	Ga0207695_100887422	498
319	3300026041	Ga0207639_10016068	Ga0207639_100160684	498
320	3300026067	Ga0207678_10071323	Ga0207678_100713233	498
321	3300026116	Ga0207674_10029284	Ga0207674_100292844	498
322	3300031730	Ga0307516_10045186	Ga0307516_100451862	498
323	3300009551	Ga0105238_10002074	Ga0105238_100020744	499
324	3300005339	Ga0070660_100003730	Ga0070660_1000037306	500
325	3300005458	Ga0070681_10007835	Ga0070681_100078353	500
326	3300005563	Ga0068855_100012925	Ga0068855_1000129253	500
327	3300005564	Ga0070664_100005922	Ga0070664_1000059226	500
328	3300005577	Ga0068857_100027759	Ga0068857_1000277593	500
329	3300005614	Ga0068856_100020444	Ga0068856_1000204444	500
330	3300005614	Ga0068856_100199118	Ga0068856_1001991182	500
331	3300005616	Ga0068852_100004636	Ga0068852_1000046362	500
332	3300005834	Ga0068851_10009226	Ga0068851_100092261	500
333	3300009093	Ga0105240_10003662	Ga0105240_1000366219	500
334	3300009093	Ga0105240_10058153	Ga0105240_100581533	500
335	3300009174	Ga0105241_10018654	Ga0105241_100186543	500
336	3300009545	Ga0105237_10023390	Ga0105237_100233905	500
337	3300009545	Ga0105237_10071669	Ga0105237_100716692	500
338	3300010375	Ga0105239_10029982	Ga0105239_100299825	500
339	3300013104	Ga0157370_10007435	Ga0157370_100074354	500
340	3300013105	Ga0157369_10006974	Ga0157369_100069749	500
341	3300013105	Ga0157369_10063097	Ga0157369_100630973	500
342	3300013307	Ga0157372_10004745	Ga0157372_100047453	500
343	3300025919	Ga0207657_10012724	Ga0207657_100127245	500
344	3300025924	Ga0207694_10025983	Ga0207694_100259832	500
345	3300025929	Ga0207664_10003648	Ga0207664_100036485	500
346	3300025949	Ga0207667_10083515	Ga0207667_100835152	500
347	3300026041	Ga0207639_10021202	Ga0207639_100212022	500
348	3300026078	Ga0207702_10010533	Ga0207702_100105333	500
349	3300026078	Ga0207702_10103023	Ga0207702_101030232	500
350	3300026116	Ga0207674_10000155	Ga0207674_1000015559	500
351	3300049823	Ga0501044_0069175	Ga0501044_0069175_340_1926	500
352	3300037068	Ga0373925_0047032	Ga0373925_0047032_368_1918	501
353	3300005563	Ga0068855_100004013	Ga0068855_10000401312	502
354	3300009093	Ga0105240_10256700	Ga0105240_102567002	502
355	3300013308	Ga0157375_10038973	Ga0157375_100389733	502
356	3300025949	Ga0207667_10212234	Ga0207667_102122342	502
357	3300025949	Ga0207667_10005648	Ga0207667_1000564810	503
358	3300049822	Ga0501035_0121476	Ga0501035_0121476_181_1791	503
359	3300049823	Ga0501044_0082174	Ga0501044_0082174_316_1926	503
360	3300005435	Ga0070714_100033095	Ga0070714_1000330955	504
361	3300010375	Ga0105239_10242169	Ga0105239_102421692	504
362	3300025929	Ga0207664_10058260	Ga0207664_100582602	504
363	3300005354	Ga0070675_100002975	Ga0070675_1000029754	505
364	3300005355	Ga0070671_100004006	Ga0070671_1000040061	505
365	3300005563	Ga0068855_100028064	Ga0068855_1000280645	505
366	3300009093	Ga0105240_10003610	Ga0105240_1000361014	505
367	3300025913	Ga0207695_10021453	Ga0207695_100214536	505
368	3300025921	Ga0207652_10029945	Ga0207652_100299455	505
369	3300025923	Ga0207681_10049458	Ga0207681_100494583	505
370	3300025925	Ga0207650_10000586	Ga0207650_1000058612	505
371	3300025926	Ga0207659_10001806	Ga0207659_1000180612	505
372	3300025931	Ga0207644_10000698	Ga0207644_1000069815	505
373	3300025931	Ga0207644_10162090	Ga0207644_101620901	505
374	3300025940	Ga0207691_10002196	Ga0207691_1000219612	505
375	3300025949	Ga0207667_10007401	Ga0207667_100074011	505
376	3300026023	Ga0207677_10069109	Ga0207677_100691091	505
377	3300026121	Ga0207683_10003946	Ga0207683_100039465	505
378	3300005530	Ga0070679_100013307	Ga0070679_1000133074	506
379	3300009551	Ga0105238_10010097	Ga0105238_100100975	506
380	3300013307	Ga0157372_10071432	Ga0157372_100714324	506
381	3300036401	Ga0373937_0026258	Ga0373937_0026258_1952_3550	506
382	3300046516	Ga0495628_0056783	Ga0495628_0056783_641_2239	506
383	3300046689	Ga0495613_0093337	Ga0495613_0093337_107_1705	506
384	3300005468	Ga0070707_100021265	Ga0070707_1000212655	507
385	3300013102	Ga0157371_10067492	Ga0157371_100674922	507
386	3300013104	Ga0157370_10022887	Ga0157370_100228873	507
387	3300025910	Ga0207684_10036888	Ga0207684_100368884	507
388	3300025922	Ga0207646_10050425	Ga0207646_100504253	507
389	3300025981	Ga0207640_10018865	Ga0207640_100188652	507
390	3300026041	Ga0207639_10015810	Ga0207639_100158102	507
391	3300026142	Ga0207698_10013527	Ga0207698_100135272	507
392	3300048911	Ga0496108_0037784	Ga0496108_0037784_1820_3451	507
393	3300048915	Ga0496112_0003230	Ga0496112_0003230_5863_7494	507
394	3300048916	Ga0496113_0120698	Ga0496113_0120698_140_1771	507
395	3300013308	Ga0157375_10056820	Ga0157375_100568202	508
396	3300025934	Ga0207686_10035376	Ga0207686_100353763	508
397	3300025937	Ga0207669_10010385	Ga0207669_100103853	508
398	3300035410	Ga0373924_0001536	Ga0373924_0001536_2763_4340	508
399	3300005539	Ga0068853_100050358	Ga0068853_1000503583	510
400	3300005577	Ga0068857_100024179	Ga0068857_1000241793	510
401	3300025915	Ga0207693_10054056	Ga0207693_100540562	510
402	3300025921	Ga0207652_10052124	Ga0207652_100521242	510
403	3300025945	Ga0207679_10016665	Ga0207679_100166653	510
404	3300025949	Ga0207667_10049777	Ga0207667_100497774	510
405	3300026041	Ga0207639_10017572	Ga0207639_100175724	510
406	3300026078	Ga0207702_10048368	Ga0207702_100483684	510
407	3300025931	Ga0207644_10090726	Ga0207644_100907262	511
408	3300031731	Ga0307405_10017536	Ga0307405_100175364	511
409	3300031901	Ga0307406_10058000	Ga0307406_100580003	511
410	3300031911	Ga0307412_10037211	Ga0307412_100372114	511
411	3300031995	Ga0307409_100000214	Ga0307409_10000021412	511
412	3300032002	Ga0307416_100027468	Ga0307416_1000274684	511
413	3300032126	Ga0307415_100024720	Ga0307415_1000247203	511
414	3300005330	Ga0070690_100005377	Ga0070690_1000053774	512
415	3300005331	Ga0070670_100033287	Ga0070670_1000332875	512
416	3300005365	Ga0070688_100016703	Ga0070688_1000167034	512
417	3300005456	Ga0070678_100005774	Ga0070678_1000057745	512
418	3300005547	Ga0070693_100000729	Ga0070693_10000072912	512
419	3300005578	Ga0068854_100011443	Ga0068854_1000114434	512
420	3300005615	Ga0070702_100015385	Ga0070702_1000153855	512
421	3300005616	Ga0068852_100170695	Ga0068852_1001706951	512
422	3300005618	Ga0068864_100214090	Ga0068864_1002140902	512
423	3300005718	Ga0068866_10001619	Ga0068866_100016197	512
424	3300005841	Ga0068863_100041175	Ga0068863_1000411754	512
425	3300006881	Ga0068865_100016342	Ga0068865_1000163425	512
426	3300009148	Ga0105243_10099577	Ga0105243_100995772	512
427	3300009176	Ga0105242_10005836	Ga0105242_100058367	512
428	3300009553	Ga0105249_10230159	Ga0105249_102301591	512
429	3300013296	Ga0157374_10031967	Ga0157374_100319673	512
430	3300014325	Ga0163163_10019425	Ga0163163_100194257	512
431	3300025899	Ga0207642_10004480	Ga0207642_100044805	512
432	3300025911	Ga0207654_10105967	Ga0207654_101059671	512
433	3300025927	Ga0207687_10089318	Ga0207687_100893182	512
434	3300025933	Ga0207706_10008886	Ga0207706_100088862	512
435	3300025934	Ga0207686_10003697	Ga0207686_100036979	512
436	3300025938	Ga0207704_10011786	Ga0207704_100117864	512
437	3300025942	Ga0207689_10031260	Ga0207689_100312605	512
438	3300025981	Ga0207640_10005681	Ga0207640_100056815	512
439	3300025986	Ga0207658_10031459	Ga0207658_100314594	512
440	3300026023	Ga0207677_10031456	Ga0207677_100314562	512
441	3300026035	Ga0207703_10003191	Ga0207703_1000319112	512
442	3300026078	Ga0207702_10154086	Ga0207702_101540862	512
443	3300026088	Ga0207641_10002940	Ga0207641_1000294014	512
444	3300026095	Ga0207676_10007520	Ga0207676_100075204	512
445	3300026121	Ga0207683_10002567	Ga0207683_100025678	512
446	3300026142	Ga0207698_10043274	Ga0207698_100432742	512
447	3300032002	Ga0307416_100013391	Ga0307416_1000133916	512
448	3300035116	Ga0373945_0033454	Ga0373945_0033454_221_1810	512
449	3300035118	Ga0373954_0028218	Ga0373954_0028218_52_1641	512
450	3300035171	Ga0373946_0015714	Ga0373946_0015714_114_1703	512
451	3300035725	Ga0373947_0026580	Ga0373947_0026580_494_2083	512
452	3300046539	Ga0495621_0004689	Ga0495621_0004689_2128_3717	512
453	3300048912	Ga0496109_0119696	Ga0496109_0119696_634_2223	512
454	3300005564	Ga0070664_100053351	Ga0070664_1000533511	514
455	3300025945	Ga0207679_10031360	Ga0207679_100313603	514
456	3300005344	Ga0070661_100120311	Ga0070661_1001203111	515
457	3300005327	Ga0070658_10026661	Ga0070658_100266614	516
458	3300025909	Ga0207705_10021839	Ga0207705_100218393	516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

448

536

0.91 PF07731

Cu-oxidase_2

Multicopper oxidase

162

273

0.87 PF07732

Cu-oxidase_3

Multicopper oxidase

150

274

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3cp5-assembly1.cif.gz_A	cytochrome c from rhodothermus marinus	0.9647	389	480
6cuk-assembly1.cif.gz_A	engineered cytochrome c from rhodothermus marinus, rma tde	0.9429	389	481
6cun-assembly1.cif.gz_A	engineered cytochrome c from rhodothermus marinus (rma tde) bound to carbene intermediate (1-ethoxy-1-oxopropan-2-ylidene)	0.9265	389	481
6hbe-assembly1.cif.gz_B	cu-containing nitrite reductase (nirk) from thermus scotoductus sa-01	0.9223	85	364
1kbw-assembly2.cif.gz_F	crystal structure of the soluble domain of ania from neisseria gonorrhoeae	0.9021	64	368

ID	Description	Score	Start	End	Superfamily
6cunA00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.9265	389	481	1.10.760.10
3gdcB02	Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins -	0.9177	216	364	2.60.40.420
3gdcB02	Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins -	0.9042	216	364	2.60.40.420
5ue6F02	Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins -	0.8834	216	367	2.60.40.420
2l4dA00	Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain	0.8792	393	480	1.10.760.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2D6XML9-F1-model_v4	Cytochrome c domain-containing protein	0.9873	393	480	GO:0009055 GO:0016020 GO:0020037 GO:0046872
AF-A0A6N8HS06-F1-model_v4	Nitrite reductase (NO-forming) (EC 1.7.2.1)	0.9785	270	366	GO:0005507 GO:0050421
AF-A0A1V9FQY6-F1-model_v4	Copper-containing nitrite reductase (EC 1.7.2.1) (Cu-NIR)	0.9668	45	364	GO:0005507 GO:0042128 GO:0042597 GO:0050421
AF-A0A349M059-F1-model_v4	Copper-containing nitrite reductase (EC 1.7.2.1)	0.9648	70	366	GO:0005507 GO:0016020 GO:0050421
AF-A0A7V9MTH3-F1-model_v4	Nitrite reductase	0.9612	284	360

Feature Viewer

pLDDT	pTM	Quality
81.99	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F448149

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00034

Cytochrom_C

Cytochrome c

448

536

0.91

PF07731

Cu-oxidase_2

Multicopper oxidase

162

273

0.87

PF07732

Cu-oxidase_3

Multicopper oxidase

150

274

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map