F448166

General Info

Members Datasets Scaffolds Average Seq Length
458 285 916 430

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100074671|Ga0075431_1000746713
Length 474
Sequence VVVASVARYSARISETQVRCGGMAFANGNRHMTRNLVLIAGGGIGGLATALTLHQIGVPCVVYEAVREMRPLGVGVNLQPNAVRELYDLGVTEADLDRVGLPAKEWALVGLNGNDVYSEPRGQLAGYEWPQYAVHRGQLHVLLYEKVVERIGANGVKLGARVTGYRKGSGGGVTALVEQGNGTTSEANGALLIGADGIHSAVRAQMHPEQPPIHWGGAIMWRGTTWAKPIRTGASFVGLGTHRHRVVFYPISHPDPRTGLSMINWIAEVTVDNAEGWQQSGWFRPVPIAEFAHHFEGWTWDWLDVPKLLAEADCAFENPMIDRDPIPTWVDGPVALLGDAAHAMYPTGSNGASQAVVDARMLGAAMLEHGVTPAALAAYDAKLCGPISQLVLRNRGAGPFGLLNLVDERCGGTFDNIDDVIPPEERAEFMAGYKKAAGLAIETLNKAPPTIPNDALVATARAGEPSSFWSRLFR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
276 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
277 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
278 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
279 2643221580 Devosia sp. Root635 Isolate Unclassified
280 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
281 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
282 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
283 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
284 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
285 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.22
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 1.31
Rhizoplane 5.68
Rhizosphere 78.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100074671 3300006847 Bacteria 3498
2 JGI25153J46596_10004099 3300003215 Bacteria 7923
3 rootH2_10069283 3300003320 Bacteria 5731
4 rootL2_10020048 3300003322 Bacteria 3275
5 rootH1_10000925 3300003323 Bacteria 6215
6 Ga0070658_10234487 3300005327 Bacteria 1554
7 Ga0070683_100048348 3300005329 Bacteria 3932
8 Ga0070690_100026576 3300005330 Bacteria 3572
9 Ga0070670_100041561 3300005331 Bacteria 3951
10 Ga0070670_100045961 3300005331 Bacteria 3754
11 Ga0070670_100094028 3300005331 Bacteria 2578
12 Ga0070680_100005301 3300005336 Bacteria 9753
13 Ga0070680_100011260 3300005336 Bacteria 6916
14 Ga0070680_100021548 3300005336 Bacteria 5122
15 Ga0070682_100015299 3300005337 Bacteria 4443
16 Ga0068868_100031406 3300005338 Bacteria 4079
17 Ga0070689_100035500 3300005340 Bacteria 3809
18 Ga0070691_10022763 3300005341 Bacteria 2908
19 Ga0070661_100089098 3300005344 Bacteria 2285
20 Ga0070669_100149944 3300005353 Bacteria 1804
21 Ga0070671_100060434 3300005355 Bacteria 3155
22 Ga0070671_100072480 3300005355 Bacteria 2876
23 Ga0070674_100109735 3300005356 Bacteria 2024
24 Ga0070673_100008030 3300005364 Bacteria 6991
25 Ga0070673_100166876 3300005364 Bacteria 1877
26 Ga0070688_100012463 3300005365 Bacteria 4765
27 Ga0070703_10003776 3300005406 Bacteria 4285
28 Ga0070709_10000486 3300005434 Bacteria 23433
29 Ga0070709_10034899 3300005434 Bacteria 3054
30 Ga0070709_10175718 3300005434 Bacteria 1500
31 Ga0070714_100025607 3300005435 Bacteria 4870
32 Ga0070713_100021336 3300005436 Bacteria 4979
33 Ga0070713_100039005 3300005436 Bacteria 3852
34 Ga0070710_10000457 3300005437 Bacteria 19119
35 Ga0070710_10001856 3300005437 Bacteria 9949
36 Ga0070711_100031783 3300005439 Bacteria 3507
37 Ga0070711_100199495 3300005439 Bacteria 1543
38 Ga0070705_100000606 3300005440 Bacteria 20794
39 Ga0070700_100003775 3300005441 Bacteria 7840
40 Ga0070700_100020436 3300005441 Bacteria 3835
41 Ga0070694_100004044 3300005444 Bacteria 8790
42 Ga0070708_100006102 3300005445 Bacteria 9587
43 Ga0070663_100013223 3300005455 Bacteria 5253
44 Ga0070663_100221273 3300005455 Bacteria 1486
45 Ga0070678_100041162 3300005456 Bacteria 3273
46 Ga0070678_100078954 3300005456 Bacteria 2488
47 Ga0070678_100184106 3300005456 Bacteria 1712
48 Ga0070662_100099537 3300005457 Bacteria 2198
49 Ga0070662_100143145 3300005457 Bacteria 1855
50 Ga0070681_10001497 3300005458 Bacteria 20662
51 Ga0070681_10005043 3300005458 Bacteria 12732
52 Ga0070681_10030674 3300005458 Bacteria 5395
53 Ga0070685_10002296 3300005466 Bacteria 9874
54 Ga0070685_10040273 3300005466 Bacteria 2658
55 Ga0070679_100008797 3300005530 Bacteria 9521
56 Ga0070679_100042886 3300005530 Bacteria 4506
57 Ga0070679_100144018 3300005530 Bacteria 2361
58 Ga0070679_100190509 3300005530 Bacteria 2020
59 Ga0070679_100238250 3300005530 Bacteria 1778
60 Ga0070697_100035884 3300005536 Bacteria 4002
61 Ga0070672_100060642 3300005543 Bacteria 2979
62 Ga0070686_100014328 3300005544 Bacteria 4568
63 Ga0070686_100143540 3300005544 Bacteria 1664
64 Ga0070695_100000943 3300005545 Bacteria 15766
65 Ga0070696_100000214 3300005546 Bacteria 34693
66 Ga0070665_100047554 3300005548 Bacteria 4305
67 Ga0068855_100000953 3300005563 Bacteria 36025
68 Ga0068855_100000983 3300005563 Bacteria 35522
69 Ga0070664_100001607 3300005564 Bacteria 18077
70 Ga0068857_100000709 3300005577 Bacteria 24816
71 Ga0068856_100110040 3300005614 Bacteria 2752
72 Ga0068859_100019044 3300005617 Bacteria 6893
73 Ga0068864_100065340 3300005618 Bacteria 3156
74 Ga0068866_10036704 3300005718 Bacteria 2402
75 Ga0068861_100035066 3300005719 Bacteria 3715
76 Ga0068863_100065323 3300005841 Bacteria 3442
77 Ga0068863_100183646 3300005841 Bacteria 2008
78 Ga0068858_100061870 3300005842 Bacteria 3461
79 Ga0068858_100148152 3300005842 Bacteria 2205
80 Ga0068860_100080223 3300005843 Bacteria 3103
81 Ga0068862_100004563 3300005844 Bacteria 11673
82 Ga0081540_1000005 3300005983 Bacteria 227052
83 Ga0081540_1000032 3300005983 Bacteria 144522
84 Ga0070717_10001165 3300006028 Bacteria 17742
85 Ga0070717_10213628 3300006028 Bacteria 1694
86 Ga0075365_10053416 3300006038 Bacteria 2676
87 Ga0075363_100004868 3300006048 Bacteria 5933
88 Ga0075363_100013464 3300006048 Bacteria 3966
89 Ga0075363_100014851 3300006048 Bacteria 3817
90 Ga0075432_10004778 3300006058 Bacteria 4607
91 Ga0070715_10022533 3300006163 Bacteria 2457
92 Ga0070716_100002383 3300006173 Bacteria 8649
93 Ga0070716_100007377 3300006173 Bacteria 5408
94 Ga0070712_100065436 3300006175 Bacteria 2580
95 Ga0075362_10005163 3300006177 Bacteria 4758
96 Ga0075362_10012607 3300006177 Bacteria 3362
97 Ga0075367_10016266 3300006178 Bacteria 4062
98 Ga0075367_10084507 3300006178 Bacteria 1924
99 Ga0075369_10002916 3300006186 Bacteria 6170
100 Ga0075366_10053283 3300006195 Bacteria 2403
101 Ga0097621_100030572 3300006237 Bacteria 4265
102 Ga0068871_100143965 3300006358 Bacteria 2028
103 Ga0068871_100197985 3300006358 Bacteria 1733
104 Ga0075428_100008696 3300006844 Bacteria 11264
105 Ga0075428_100094052 3300006844 Bacteria 3268
106 Ga0075428_100318666 3300006844 Bacteria 1671
107 Ga0075433_10133105 3300006852 Bacteria 2209
108 Ga0075434_100001231 3300006871 Bacteria 21282
109 Ga0075434_100255990 3300006871 Bacteria 1769
110 Ga0075429_100022307 3300006880 Bacteria 5491
111 Ga0068865_100020162 3300006881 Bacteria 4323
112 Ga0097620_100019044 3300006931 Bacteria 6893
113 Ga0075435_100052042 3300007076 Bacteria 3300
114 Ga0105251_10039888 3300009011 Bacteria 2291
115 Ga0105240_10003690 3300009093 Bacteria 23679
116 Ga0105240_10358857 3300009093 Bacteria 1651
117 Ga0111539_10032810 3300009094 Bacteria 6305
118 Ga0105245_10007297 3300009098 Bacteria 9681
119 Ga0105245_10029476 3300009098 Bacteria 4849
120 Ga0105245_10207796 3300009098 Bacteria 1883
121 Ga0105247_10051839 3300009101 Bacteria 2528
122 Ga0114129_10120442 3300009147 Bacteria 3613
123 Ga0105241_10013486 3300009174 Bacteria 5990
124 Ga0105242_10041169 3300009176 Bacteria 3725
125 Ga0105248_10227857 3300009177 Bacteria 2098
126 Ga0105248_10354348 3300009177 Bacteria 1652
127 Ga0105237_10058363 3300009545 Bacteria 3862
128 Ga0105238_10001659 3300009551 Bacteria 22345
129 Ga0105238_10021580 3300009551 Bacteria 6559
130 Ga0105249_10136266 3300009553 Bacteria 2349
131 Ga0105239_10054866 3300010375 Bacteria 4372
132 Ga0105246_10110194 3300011119 Bacteria 2021
133 Ga0157370_10010614 3300013104 Bacteria 9695
134 Ga0157370_10122327 3300013104 Bacteria 2430
135 Ga0157369_10013338 3300013105 Bacteria 9294
136 Ga0157369_10050674 3300013105 Bacteria 4494
137 Ga0157374_10081741 3300013296 Bacteria 3066
138 Ga0157374_10285001 3300013296 Bacteria 1631
139 Ga0157378_10099230 3300013297 Bacteria 2657
140 Ga0163162_10224213 3300013306 Bacteria 2009
141 Ga0163162_10279611 3300013306 Bacteria 1801
142 Ga0157372_10334478 3300013307 Bacteria 1764
143 Ga0163163_10094312 3300014325 Bacteria 3011
144 Ga0163163_10117420 3300014325 Bacteria 2692
145 Ga0157380_10015521 3300014326 Bacteria 5599
146 Ga0157376_10130416 3300014969 Bacteria 2242
147 Ga0163161_10046248 3300017792 Bacteria 3140
148 Ga0206353_11682298 3300020082 Bacteria 3898
149 Ga0213876_10042223 3300021384 Bacteria 2410
150 Ga0213876_10052861 3300021384 Bacteria 2146
151 Ga0209677_104908 3300025253 Bacteria 3659
152 Ga0209233_1003401 3300025261 Bacteria 5611
153 Ga0209455_1006386 3300025272 Bacteria 3488
154 Ga0209758_1000548 3300025297 Bacteria 59657
155 Ga0207653_10001703 3300025885 Bacteria 7025
156 Ga0207682_10000908 3300025893 Bacteria 13720
157 Ga0207692_10002216 3300025898 Bacteria 7439
158 Ga0207710_10019037 3300025900 Bacteria 2927
159 Ga0207699_10006349 3300025906 Bacteria 5716
160 Ga0207707_10001876 3300025912 Bacteria 19206
161 Ga0207707_10002041 3300025912 Bacteria 18330
162 Ga0207707_10002420 3300025912 Bacteria 16794
163 Ga0207707_10017534 3300025912 Bacteria 6244
164 Ga0207707_10148911 3300025912 Bacteria 2046
165 Ga0207695_10008247 3300025913 Bacteria 13076
166 Ga0207660_10004920 3300025917 Bacteria 8702
167 Ga0207652_10005723 3300025921 Bacteria 10088
168 Ga0207652_10167352 3300025921 Bacteria 1971
169 Ga0207694_10017597 3300025924 Bacteria 5402
170 Ga0207650_10005374 3300025925 Bacteria 8737
171 Ga0207650_10124184 3300025925 Bacteria 2013
172 Ga0207650_10169235 3300025925 Bacteria 1736
173 Ga0207687_10008780 3300025927 Bacteria 6604
174 Ga0207664_10086086 3300025929 Bacteria 2566
175 Ga0207664_10164822 3300025929 Bacteria 1893
176 Ga0207644_10009223 3300025931 Bacteria 6473
177 Ga0207706_10189794 3300025933 Bacteria 1804
178 Ga0207706_10194641 3300025933 Bacteria 1779
179 Ga0207709_10101645 3300025935 Bacteria 1902
180 Ga0207669_10011519 3300025937 Bacteria 4308
181 Ga0207669_10013006 3300025937 Bacteria 4116
182 Ga0207669_10107950 3300025937 Bacteria 1858
183 Ga0207704_10109308 3300025938 Bacteria 1864
184 Ga0207665_10001763 3300025939 Bacteria 14531
185 Ga0207665_10002915 3300025939 Bacteria 11461
186 Ga0207691_10033616 3300025940 Bacteria 4775
187 Ga0207711_10235956 3300025941 Bacteria 1676
188 Ga0207667_10000380 3300025949 Bacteria 60133
189 Ga0207667_10011228 3300025949 Bacteria 10423
190 Ga0207667_10011425 3300025949 Bacteria 10322
191 Ga0207651_10172988 3300025960 Bacteria 1705
192 Ga0207678_10024773 3300026067 Bacteria 5239
193 Ga0207678_10059481 3300026067 Bacteria 3287
194 Ga0207678_10110469 3300026067 Bacteria 2345
195 Ga0207708_10036625 3300026075 Bacteria 3736
196 Ga0207708_10038742 3300026075 Bacteria 3631
197 Ga0207702_10312263 3300026078 Bacteria 1495
198 Ga0207641_10087964 3300026088 Bacteria 2711
199 Ga0207641_10089795 3300026088 Bacteria 2686
200 Ga0207648_10041306 3300026089 Bacteria 4051
201 Ga0207674_10015125 3300026116 Bacteria 8491
202 Ga0207683_10008577 3300026121 Bacteria 8748
203 Ga0207683_10024904 3300026121 Bacteria 5157
204 Ga0207683_10175496 3300026121 Bacteria 1942
205 Ga0207428_10054519 3300027907 Bacteria 3184
206 Ga0268266_10209730 3300028379 Bacteria 1786
207 Ga0268265_10004386 3300028380 Bacteria 9802
208 Ga0265334_10008032 3300028573 Bacteria 4505
209 Ga0265323_10008789 3300028653 Bacteria 4152
210 Ga0265336_10002554 3300028666 Bacteria 7448
211 Ga0265338_10000621 3300028800 Bacteria 61786
212 Ga0265338_10018048 3300028800 Bacteria 7572
213 Ga0265338_10018102 3300028800 Bacteria 7559
214 Ga0265338_10029291 3300028800 Bacteria 5460
215 Ga0265338_10029977 3300028800 Bacteria 5377
216 Ga0265324_10004501 3300029957 Bacteria 6263
217 Ga0265330_10016336 3300031235 Bacteria 3426
218 Ga0265328_10025000 3300031239 Bacteria 2252
219 Ga0265325_10000030 3300031241 Bacteria 103532
220 Ga0265325_10013204 3300031241 Bacteria 4707
221 Ga0265325_10026223 3300031241 Bacteria 3159
222 Ga0265329_10003782 3300031242 Bacteria 6500
223 Ga0265340_10001968 3300031247 Bacteria 11738
224 Ga0265340_10028660 3300031247 Bacteria 2800
225 Ga0265339_10000327 3300031249 Bacteria 38136
226 Ga0265339_10016536 3300031249 Bacteria 4395
227 Ga0265339_10017647 3300031249 Bacteria 4221
228 Ga0265331_10036044 3300031250 Bacteria 2432
229 Ga0265327_10003026 3300031251 Bacteria 16647
230 Ga0265327_10011664 3300031251 Bacteria 6025
231 Ga0265316_10078924 3300031344 Bacteria 2526
232 Ga0265316_10165258 3300031344 Bacteria 1653
233 Ga0265313_10000081 3300031595 Bacteria 93047
234 Ga0265313_10001659 3300031595 Bacteria 20615
235 Ga0265313_10003131 3300031595 Bacteria 13656
236 Ga0265313_10082115 3300031595 Bacteria 1461
237 Ga0265314_10016828 3300031711 Bacteria 5761
238 Ga0265314_10057452 3300031711 Bacteria 2671
239 Ga0265314_10075009 3300031711 Bacteria 2251
240 Ga0265314_10141293 3300031711 Bacteria 1488
241 Ga0265342_10005264 3300031712 Bacteria 9917
242 Ga0265342_10007463 3300031712 Bacteria 8001
243 Ga0265342_10007890 3300031712 Bacteria 7724
244 Ga0307407_10082372 3300031903 Bacteria 1950
245 Ga0307409_100073325 3300031995 Bacteria 2730
246 Ga0307414_10048530 3300032004 Bacteria 2929
247 Ga0316583_10005823 3300032133 Bacteria 4434
248 Ga0373950_0006168 3300034818 Bacteria 1819
249 Ga0373934_0036075 3300035086 Bacteria 1947
250 Ga0373940_0002094 3300035088 Bacteria 3798
251 Ga0373936_0009859 3300035113 Bacteria 3605
252 Ga0373953_0076398 3300035117 Bacteria 1388
253 Ga0373954_0061806 3300035118 Bacteria 1768
254 Ga0373956_0023852 3300035119 Bacteria 2630
255 Ga0373960_0020456 3300035121 Bacteria 1750
256 Ga0373943_0003008 3300035170 Bacteria 7653
257 Ga0373955_0005227 3300035172 Bacteria 5818
258 Ga0373962_0002164 3300035242 Bacteria 4688
259 Ga0373962_0006365 3300035242 Bacteria 2860
260 Ga0373931_0000145 3300035691 Bacteria 30974
261 Ga0373931_0039456 3300035691 Bacteria 2474
262 Ga0373947_0025350 3300035725 Bacteria 3458
263 Ga0373937_0003137 3300036401 Bacteria 13829
264 Ga0373937_0204924 3300036401 Bacteria 1855
265 Ga0373925_0092449 3300037068 Bacteria 2314
266 Ga0395899_0016133 3300037312 Bacteria 5696
267 Ga0395899_0072549 3300037312 Bacteria 2519
268 Ga0395900_0006651 3300037418 Bacteria 12018
269 Ga0395898_0007323 3300037466 Bacteria 11716
270 Ga0395901_0008566 3300038443 Bacteria 10336
271 Ga0395901_0026430 3300038443 Bacteria 5960
272 Ga0395901_0037519 3300038443 Bacteria 5012
273 Ga0400483_144629 3300039062 Bacteria 2836
274 Ga0400483_145733 3300039062 Bacteria 2221
275 Ga0400483_146244 3300039062 Bacteria 1425
276 Ga0400483_160809 3300039062 Bacteria 4305
277 Ga0400483_213048 3300039062 Bacteria 2767
278 Ga0400483_217598 3300039062 Bacteria 5718
279 Ga0436365_0795728 3300039437 Bacteria 1900
280 Ga0436365_1014986 3300039437 Bacteria 4771
281 Ga0436365_1367340 3300039437 Bacteria 3028
282 Ga0436360_0315234 3300039438 Bacteria 2108
283 Ga0439441_014169 3300042001 Bacteria 1394
284 Ga0439460_0004472 3300042461 Bacteria 3408
285 Ga0466957_0134339 3300044842 Bacteria 1588
286 Ga0466958_0014308 3300045836 Bacteria 4531
287 Ga0495592_0018309 3300046454 Bacteria 5324
288 Ga0495603_0063167 3300046455 Bacteria 2185
289 Ga0495629_0008606 3300046459 Bacteria 7514
290 Ga0495629_0161171 3300046459 Bacteria 1558
291 Ga0495651_0119906 3300046462 Bacteria 1934
292 Ga0495664_0029863 3300046477 Bacteria 3191
293 Ga0495608_0007300 3300046511 Bacteria 7813
294 Ga0495628_0003652 3300046516 Bacteria 13740
295 Ga0495628_0010061 3300046516 Bacteria 8048
296 Ga0495652_0078673 3300046529 Bacteria 2729
297 Ga0495652_0166117 3300046529 Bacteria 1708
298 Ga0495645_0020457 3300046543 Bacteria 4774
299 Ga0495645_0020953 3300046543 Bacteria 4724
300 Ga0495635_0032280 3300046663 Bacteria 3633
301 Ga0495657_0039758 3300046675 Bacteria 3230
302 Ga0495599_0005131 3300046678 Bacteria 7802
303 Ga0495599_0070956 3300046678 Bacteria 2174
304 Ga0495599_0135595 3300046678 Bacteria 1528
305 Ga0495658_0025738 3300046683 Bacteria 3148
306 Ga0495658_0042505 3300046683 Bacteria 2538
307 Ga0495613_0000796 3300046689 Bacteria 24562
308 Ga0495600_0015475 3300046809 Bacteria 4822
309 Ga0495600_0051982 3300046809 Bacteria 2675
310 Ga0495604_0037025 3300047317 Bacteria 3844
311 Ga0495680_0042433 3300047322 Bacteria 3609
312 Ga0495680_0049982 3300047322 Bacteria 3272
313 Ga0495680_0069368 3300047322 Bacteria 2690
314 Ga0495675_0048382 3300047444 Bacteria 2705
315 Ga0495685_048996 3300047447 Bacteria 1436
316 Ga0495684_0000024 3300047471 Bacteria 129369
317 Ga0495593_0079680 3300047673 Bacteria 1695
318 Ga0495602_0031502 3300048088 Bacteria 5013
319 Ga0496100_0057844 3300048903 Bacteria 2541
320 Ga0496101_0047932 3300048904 Bacteria 3068
321 Ga0496101_0061577 3300048904 Bacteria 2726
322 Ga0496102_0004014 3300048905 Bacteria 12466
323 Ga0496103_0004056 3300048906 Bacteria 8904
324 Ga0496104_0000065 3300048907 Bacteria 108770
325 Ga0496104_0001611 3300048907 Bacteria 19454
326 Ga0496104_0026866 3300048907 Bacteria 5321
327 Ga0496105_0002930 3300048908 Bacteria 12527
328 Ga0496105_0007032 3300048908 Bacteria 8670
329 Ga0496105_0095522 3300048908 Bacteria 2455
330 Ga0496106_0005812 3300048909 Bacteria 9119
331 Ga0496106_0013789 3300048909 Bacteria 5970
332 Ga0496106_0032592 3300048909 Bacteria 3886
333 Ga0496106_0206023 3300048909 Bacteria 1566
334 Ga0496107_0007842 3300048910 Bacteria 7372
335 Ga0496107_0031691 3300048910 Bacteria 3775
336 Ga0496107_0061409 3300048910 Bacteria 2721
337 Ga0496107_0078496 3300048910 Bacteria 2405
338 Ga0496107_0079543 3300048910 Bacteria 2390
339 Ga0496110_0017176 3300048913 Bacteria 6051
340 Ga0496110_0059907 3300048913 Bacteria 3356
341 Ga0496111_0036648 3300048914 Bacteria 3508
342 Ga0496112_0021942 3300048915 Bacteria 6076
343 Ga0496113_0159003 3300048916 Bacteria 1785
344 Ga0496114_0041818 3300048917 Bacteria 3798
345 Ga0496121_0033133 3300048924 Bacteria 4682
346 Ga0496121_0084962 3300048924 Bacteria 2493
347 Ga0496122_0057126 3300048925 Bacteria 2902
348 Ga0496124_0190379 3300048927 Bacteria 1571
349 Ga0496125_0000154 3300048928 Bacteria 152240
350 Ga0496125_0001251 3300048928 Bacteria 37908
351 Ga0496126_0057681 3300048929 Bacteria 3503
352 Ga0496126_0058795 3300048929 Bacteria 3464
353 Ga0496126_0067974 3300048929 Bacteria 3183
354 Ga0496126_0160182 3300048929 Bacteria 1923
355 Ga0501031_0034423 3300049568 Bacteria 3306
356 Ga0501031_0038946 3300049568 Bacteria 3101
357 Ga0501032_0020134 3300049569 Bacteria 4651
358 Ga0501033_0000509 3300049570 Bacteria 36587
359 Ga0501033_0011917 3300049570 Bacteria 6643
360 Ga0501034_0064995 3300049571 Bacteria 3661
361 Ga0501034_0129707 3300049571 Bacteria 2505
362 Ga0501034_0170290 3300049571 Bacteria 2145
363 Ga0501034_0170463 3300049571 Bacteria 2144
364 Ga0501037_0000198 3300049573 Bacteria 54028
365 Ga0501038_0063639 3300049574 Bacteria 3148
366 Ga0501039_0167531 3300049575 Bacteria 1727
367 Ga0501043_0000100 3300049579 Bacteria 79167
368 Ga0501043_0118311 3300049579 Bacteria 2078
369 Ga0501047_0057233 3300049581 Bacteria 3770
370 Ga0501047_0156069 3300049581 Bacteria 2156
371 Ga0501067_0062959 3300049583 Bacteria 2054
372 Ga0501069_0000020 3300049585 Bacteria 122595
373 Ga0501070_0000241 3300049586 Bacteria 51370
374 Ga0501070_0001415 3300049586 Bacteria 21479
375 Ga0501070_0097813 3300049586 Bacteria 2427
376 Ga0501072_0002839 3300049588 Bacteria 12998
377 Ga0501072_0059255 3300049588 Bacteria 3019
378 Ga0501073_0017156 3300049589 Bacteria 5244
379 Ga0501073_0059160 3300049589 Bacteria 2677
380 Ga0501073_0118854 3300049589 Bacteria 1832
381 Ga0501073_0121825 3300049589 Bacteria 1807
382 Ga0501074_0000015 3300049590 Bacteria 79939
383 Ga0501074_0008932 3300049590 Bacteria 7268
384 Ga0501074_0113164 3300049590 Bacteria 1942
385 Ga0501074_0121591 3300049590 Bacteria 1867
386 Ga0501077_0040941 3300049593 Bacteria 2950
387 Ga0501079_0130150 3300049741 Bacteria 1958
388 Ga0501080_0000067 3300049742 Bacteria 68958
389 Ga0501080_0000219 3300049742 Bacteria 42649
390 Ga0501080_0105309 3300049742 Bacteria 2615
391 Ga0501080_0137366 3300049742 Bacteria 2261
392 Ga0501083_0000317 3300049744 Bacteria 30564
393 Ga0501083_0010053 3300049744 Bacteria 6674
394 Ga0501083_0093542 3300049744 Bacteria 1985
395 Ga0501035_0000070 3300049822 Bacteria 127442
396 Ga0501035_0000805 3300049822 Bacteria 33419
397 Ga0501035_0078990 3300049822 Bacteria 2906
398 Ga0501035_0273431 3300049822 Bacteria 1429
399 Ga0501035_0284764 3300049822 Bacteria 1396
400 Ga0501044_0000037 3300049823 Bacteria 161924
401 Ga0501044_0009562 3300049823 Bacteria 10554
402 Ga0501044_0054633 3300049823 Bacteria 4104
403 Ga0501044_0137703 3300049823 Bacteria 2431
404 Ga0501044_0311277 3300049823 Bacteria 1501
405 Ga0501045_0122623 3300049824 Bacteria 1930
406 nmdc:mga03683_35920_c1 3300050489 Bacteria 2013
407 nmdc:mga00v17_46095_c1 3300050491 Bacteria 2637
408 nmdc:mga0yw44_40086_c1 3300050492 Bacteria 2780
409 nmdc:mga0k408_18085_c1 3300050493 Bacteria 3930
410 nmdc:mga0k408_4855_c1 3300050493 Bacteria 7131
411 nmdc:mga07m45_22491_c3 3300050496 Bacteria 1902
412 nmdc:mga09592_53262_c1 3300050508 Bacteria 3417
413 nmdc:mga0qj67_2014_c1 3300050509 Bacteria 14484
414 nmdc:mga06r32_108384_c1 3300050510 Bacteria 2730
415 nmdc:mga06r32_16099_c1 3300050510 Bacteria 6810
416 nmdc:mga08y16_15583_c1 3300050511 Bacteria 7993
417 nmdc:mga0n895_168272_c1 3300050512 Bacteria 2224
418 nmdc:mga08x19_98671_c1 3300050514 Bacteria 1935
419 Ga0495601_0000111 3300053077 Bacteria 44773
420 Ga0495601_0001088 3300053077 Bacteria 14895
421 Ga0495601_0018849 3300053077 Bacteria 4203
422 Ga0495612_0001254 3300053078 Bacteria 10457
423 Ga0495595_0006120 3300053084 Bacteria 4889
424 Ga0495595_0050409 3300053084 Bacteria 1928
425 Ga0495619_0000296 3300053085 Bacteria 35155
426 Ga0495619_0010641 3300053085 Bacteria 5789
427 Ga0495619_0024681 3300053085 Bacteria 3857
428 Ga0500644_0000796 3300053088 Bacteria 10741
429 Ga0500651_0031183 3300053093 Bacteria 3357
430 Ga0500641_0003434 3300053096 Bacteria 5602
431 Ga0500641_0007923 3300053096 Bacteria 3789
432 Ga0500641_0008185 3300053096 Bacteria 3727
433 Ga0500572_000149 3300053111 Bacteria 24147
434 Ga0500595_000003 3300053119 Bacteria 419332
435 Ga0500595_016413 3300053119 Bacteria 2758
436 Ga0500652_000002 3300053131 Bacteria 273315
437 Ga0500559_0000001 3300053136 Bacteria 325464
438 Ga0500559_0006099 3300053136 Bacteria 5458
439 Ga0500616_0000002 3300053153 Bacteria 1611257
440 Ga0500616_0000072 3300053153 Bacteria 231471
441 Ga0500636_0016470 3300053177 Bacteria 4360
442 Ga0500636_0045645 3300053177 Bacteria 2584
443 Ga0500636_0053919 3300053177 Bacteria 2359
444 Ga0500645_000817 3300053730 Bacteria 18603
445 Ga0501084_0095904 3300054114 Bacteria 2491
446 Ga0501082_0145811 3300060353 Bacteria 2055
447 2511170521 2510917026 Bacteria 7046020
448 2513592338 2513237087 Bacteria 5817514
449 2513680141 2513237098 Bacteria 9902361
450 2643754993 2643221547 Bacteria 4740017
451 2643911179 2643221580 Bacteria 3816678
452 2643912195 2643221580 Bacteria 3816678
453 2840883332 2840878972 Bacteria 5483153
454 2888352402 2888350351 Bacteria 7372807
455 2919683222 2919679072 Bacteria 4629602
456 2922132671 2922130491 Bacteria 7173936
457 2977978677 2977971508 Bacteria 7472917
458 2979749415 2979742915 Bacteria 7301278
459 Ga0075431_100074671
460 JGI25153J46596_10004099
461 rootH2_10069283
462 rootL2_10020048
463 rootH1_10000925
464 Ga0070658_10234487
465 Ga0070683_100048348
466 Ga0070690_100026576
467 Ga0070670_100041561
468 Ga0070670_100045961
469 Ga0070670_100094028
470 Ga0070680_100005301
471 Ga0070680_100011260
472 Ga0070680_100021548
473 Ga0070682_100015299
474 Ga0068868_100031406
475 Ga0070689_100035500
476 Ga0070691_10022763
477 Ga0070661_100089098
478 Ga0070669_100149944
479 Ga0070671_100060434
480 Ga0070671_100072480
481 Ga0070674_100109735
482 Ga0070673_100008030
483 Ga0070673_100166876
484 Ga0070688_100012463
485 Ga0070703_10003776
486 Ga0070709_10000486
487 Ga0070709_10034899
488 Ga0070709_10175718
489 Ga0070714_100025607
490 Ga0070713_100021336
491 Ga0070713_100039005
492 Ga0070710_10000457
493 Ga0070710_10001856
494 Ga0070711_100031783
495 Ga0070711_100199495
496 Ga0070705_100000606
497 Ga0070700_100003775
498 Ga0070700_100020436
499 Ga0070694_100004044
500 Ga0070708_100006102
501 Ga0070663_100013223
502 Ga0070663_100221273
503 Ga0070678_100041162
504 Ga0070678_100078954
505 Ga0070678_100184106
506 Ga0070662_100099537
507 Ga0070662_100143145
508 Ga0070681_10001497
509 Ga0070681_10005043
510 Ga0070681_10030674
511 Ga0070685_10002296
512 Ga0070685_10040273
513 Ga0070679_100008797
514 Ga0070679_100042886
515 Ga0070679_100144018
516 Ga0070679_100190509
517 Ga0070679_100238250
518 Ga0070697_100035884
519 Ga0070672_100060642
520 Ga0070686_100014328
521 Ga0070686_100143540
522 Ga0070695_100000943
523 Ga0070696_100000214
524 Ga0070665_100047554
525 Ga0068855_100000953
526 Ga0068855_100000983
527 Ga0070664_100001607
528 Ga0068857_100000709
529 Ga0068856_100110040
530 Ga0068859_100019044
531 Ga0068864_100065340
532 Ga0068866_10036704
533 Ga0068861_100035066
534 Ga0068863_100065323
535 Ga0068863_100183646
536 Ga0068858_100061870
537 Ga0068858_100148152
538 Ga0068860_100080223
539 Ga0068862_100004563
540 Ga0081540_1000005
541 Ga0081540_1000032
542 Ga0070717_10001165
543 Ga0070717_10213628
544 Ga0075365_10053416
545 Ga0075363_100004868
546 Ga0075363_100013464
547 Ga0075363_100014851
548 Ga0075432_10004778
549 Ga0070715_10022533
550 Ga0070716_100002383
551 Ga0070716_100007377
552 Ga0070712_100065436
553 Ga0075362_10005163
554 Ga0075362_10012607
555 Ga0075367_10016266
556 Ga0075367_10084507
557 Ga0075369_10002916
558 Ga0075366_10053283
559 Ga0097621_100030572
560 Ga0068871_100143965
561 Ga0068871_100197985
562 Ga0075428_100008696
563 Ga0075428_100094052
564 Ga0075428_100318666
565 Ga0075433_10133105
566 Ga0075434_100001231
567 Ga0075434_100255990
568 Ga0075429_100022307
569 Ga0068865_100020162
570 Ga0097620_100019044
571 Ga0075435_100052042
572 Ga0105251_10039888
573 Ga0105240_10003690
574 Ga0105240_10358857
575 Ga0111539_10032810
576 Ga0105245_10007297
577 Ga0105245_10029476
578 Ga0105245_10207796
579 Ga0105247_10051839
580 Ga0114129_10120442
581 Ga0105241_10013486
582 Ga0105242_10041169
583 Ga0105248_10227857
584 Ga0105248_10354348
585 Ga0105237_10058363
586 Ga0105238_10001659
587 Ga0105238_10021580
588 Ga0105249_10136266
589 Ga0105239_10054866
590 Ga0105246_10110194
591 Ga0157370_10010614
592 Ga0157370_10122327
593 Ga0157369_10013338
594 Ga0157369_10050674
595 Ga0157374_10081741
596 Ga0157374_10285001
597 Ga0157378_10099230
598 Ga0163162_10224213
599 Ga0163162_10279611
600 Ga0157372_10334478
601 Ga0163163_10094312
602 Ga0163163_10117420
603 Ga0157380_10015521
604 Ga0157376_10130416
605 Ga0163161_10046248
606 Ga0206353_11682298
607 Ga0213876_10042223
608 Ga0213876_10052861
609 Ga0209677_104908
610 Ga0209233_1003401
611 Ga0209455_1006386
612 Ga0209758_1000548
613 Ga0207653_10001703
614 Ga0207682_10000908
615 Ga0207692_10002216
616 Ga0207710_10019037
617 Ga0207699_10006349
618 Ga0207707_10001876
619 Ga0207707_10002041
620 Ga0207707_10002420
621 Ga0207707_10017534
622 Ga0207707_10148911
623 Ga0207695_10008247
624 Ga0207660_10004920
625 Ga0207652_10005723
626 Ga0207652_10167352
627 Ga0207694_10017597
628 Ga0207650_10005374
629 Ga0207650_10124184
630 Ga0207650_10169235
631 Ga0207687_10008780
632 Ga0207664_10086086
633 Ga0207664_10164822
634 Ga0207644_10009223
635 Ga0207706_10189794
636 Ga0207706_10194641
637 Ga0207709_10101645
638 Ga0207669_10011519
639 Ga0207669_10013006
640 Ga0207669_10107950
641 Ga0207704_10109308
642 Ga0207665_10001763
643 Ga0207665_10002915
644 Ga0207691_10033616
645 Ga0207711_10235956
646 Ga0207667_10000380
647 Ga0207667_10011228
648 Ga0207667_10011425
649 Ga0207651_10172988
650 Ga0207678_10024773
651 Ga0207678_10059481
652 Ga0207678_10110469
653 Ga0207708_10036625
654 Ga0207708_10038742
655 Ga0207702_10312263
656 Ga0207641_10087964
657 Ga0207641_10089795
658 Ga0207648_10041306
659 Ga0207674_10015125
660 Ga0207683_10008577
661 Ga0207683_10024904
662 Ga0207683_10175496
663 Ga0207428_10054519
664 Ga0268266_10209730
665 Ga0268265_10004386
666 Ga0265334_10008032
667 Ga0265323_10008789
668 Ga0265336_10002554
669 Ga0265338_10000621
670 Ga0265338_10018048
671 Ga0265338_10018102
672 Ga0265338_10029291
673 Ga0265338_10029977
674 Ga0265324_10004501
675 Ga0265330_10016336
676 Ga0265328_10025000
677 Ga0265325_10000030
678 Ga0265325_10013204
679 Ga0265325_10026223
680 Ga0265329_10003782
681 Ga0265340_10001968
682 Ga0265340_10028660
683 Ga0265339_10000327
684 Ga0265339_10016536
685 Ga0265339_10017647
686 Ga0265331_10036044
687 Ga0265327_10003026
688 Ga0265327_10011664
689 Ga0265316_10078924
690 Ga0265316_10165258
691 Ga0265313_10000081
692 Ga0265313_10001659
693 Ga0265313_10003131
694 Ga0265313_10082115
695 Ga0265314_10016828
696 Ga0265314_10057452
697 Ga0265314_10075009
698 Ga0265314_10141293
699 Ga0265342_10005264
700 Ga0265342_10007463
701 Ga0265342_10007890
702 Ga0307407_10082372
703 Ga0307409_100073325
704 Ga0307414_10048530
705 Ga0316583_10005823
706 Ga0373950_0006168
707 Ga0373934_0036075
708 Ga0373940_0002094
709 Ga0373936_0009859
710 Ga0373953_0076398
711 Ga0373954_0061806
712 Ga0373956_0023852
713 Ga0373960_0020456
714 Ga0373943_0003008
715 Ga0373955_0005227
716 Ga0373962_0002164
717 Ga0373962_0006365
718 Ga0373931_0000145
719 Ga0373931_0039456
720 Ga0373947_0025350
721 Ga0373937_0003137
722 Ga0373937_0204924
723 Ga0373925_0092449
724 Ga0395899_0016133
725 Ga0395899_0072549
726 Ga0395900_0006651
727 Ga0395898_0007323
728 Ga0395901_0008566
729 Ga0395901_0026430
730 Ga0395901_0037519
731 Ga0400483_144629
732 Ga0400483_145733
733 Ga0400483_146244
734 Ga0400483_160809
735 Ga0400483_213048
736 Ga0400483_217598
737 Ga0436365_0795728
738 Ga0436365_1014986
739 Ga0436365_1367340
740 Ga0436360_0315234
741 Ga0439441_014169
742 Ga0439460_0004472
743 Ga0466957_0134339
744 Ga0466958_0014308
745 Ga0495592_0018309
746 Ga0495603_0063167
747 Ga0495629_0008606
748 Ga0495629_0161171
749 Ga0495651_0119906
750 Ga0495664_0029863
751 Ga0495608_0007300
752 Ga0495628_0003652
753 Ga0495628_0010061
754 Ga0495652_0078673
755 Ga0495652_0166117
756 Ga0495645_0020457
757 Ga0495645_0020953
758 Ga0495635_0032280
759 Ga0495657_0039758
760 Ga0495599_0005131
761 Ga0495599_0070956
762 Ga0495599_0135595
763 Ga0495658_0025738
764 Ga0495658_0042505
765 Ga0495613_0000796
766 Ga0495600_0015475
767 Ga0495600_0051982
768 Ga0495604_0037025
769 Ga0495680_0042433
770 Ga0495680_0049982
771 Ga0495680_0069368
772 Ga0495675_0048382
773 Ga0495685_048996
774 Ga0495684_0000024
775 Ga0495593_0079680
776 Ga0495602_0031502
777 Ga0496100_0057844
778 Ga0496101_0047932
779 Ga0496101_0061577
780 Ga0496102_0004014
781 Ga0496103_0004056
782 Ga0496104_0000065
783 Ga0496104_0001611
784 Ga0496104_0026866
785 Ga0496105_0002930
786 Ga0496105_0007032
787 Ga0496105_0095522
788 Ga0496106_0005812
789 Ga0496106_0013789
790 Ga0496106_0032592
791 Ga0496106_0206023
792 Ga0496107_0007842
793 Ga0496107_0031691
794 Ga0496107_0061409
795 Ga0496107_0078496
796 Ga0496107_0079543
797 Ga0496110_0017176
798 Ga0496110_0059907
799 Ga0496111_0036648
800 Ga0496112_0021942
801 Ga0496113_0159003
802 Ga0496114_0041818
803 Ga0496121_0033133
804 Ga0496121_0084962
805 Ga0496122_0057126
806 Ga0496124_0190379
807 Ga0496125_0000154
808 Ga0496125_0001251
809 Ga0496126_0057681
810 Ga0496126_0058795
811 Ga0496126_0067974
812 Ga0496126_0160182
813 Ga0501031_0034423
814 Ga0501031_0038946
815 Ga0501032_0020134
816 Ga0501033_0000509
817 Ga0501033_0011917
818 Ga0501034_0064995
819 Ga0501034_0129707
820 Ga0501034_0170290
821 Ga0501034_0170463
822 Ga0501037_0000198
823 Ga0501038_0063639
824 Ga0501039_0167531
825 Ga0501043_0000100
826 Ga0501043_0118311
827 Ga0501047_0057233
828 Ga0501047_0156069
829 Ga0501067_0062959
830 Ga0501069_0000020
831 Ga0501070_0000241
832 Ga0501070_0001415
833 Ga0501070_0097813
834 Ga0501072_0002839
835 Ga0501072_0059255
836 Ga0501073_0017156
837 Ga0501073_0059160
838 Ga0501073_0118854
839 Ga0501073_0121825
840 Ga0501074_0000015
841 Ga0501074_0008932
842 Ga0501074_0113164
843 Ga0501074_0121591
844 Ga0501077_0040941
845 Ga0501079_0130150
846 Ga0501080_0000067
847 Ga0501080_0000219
848 Ga0501080_0105309
849 Ga0501080_0137366
850 Ga0501083_0000317
851 Ga0501083_0010053
852 Ga0501083_0093542
853 Ga0501035_0000070
854 Ga0501035_0000805
855 Ga0501035_0078990
856 Ga0501035_0273431
857 Ga0501035_0284764
858 Ga0501044_0000037
859 Ga0501044_0009562
860 Ga0501044_0054633
861 Ga0501044_0137703
862 Ga0501044_0311277
863 Ga0501045_0122623
864 nmdc:mga03683_35920_c1
865 nmdc:mga00v17_46095_c1
866 nmdc:mga0yw44_40086_c1
867 nmdc:mga0k408_18085_c1
868 nmdc:mga0k408_4855_c1
869 nmdc:mga07m45_22491_c3
870 nmdc:mga09592_53262_c1
871 nmdc:mga0qj67_2014_c1
872 nmdc:mga06r32_108384_c1
873 nmdc:mga06r32_16099_c1
874 nmdc:mga08y16_15583_c1
875 nmdc:mga0n895_168272_c1
876 nmdc:mga08x19_98671_c1
877 Ga0495601_0000111
878 Ga0495601_0001088
879 Ga0495601_0018849
880 Ga0495612_0001254
881 Ga0495595_0006120
882 Ga0495595_0050409
883 Ga0495619_0000296
884 Ga0495619_0010641
885 Ga0495619_0024681
886 Ga0500644_0000796
887 Ga0500651_0031183
888 Ga0500641_0003434
889 Ga0500641_0007923
890 Ga0500641_0008185
891 Ga0500572_000149
892 Ga0500595_000003
893 Ga0500595_016413
894 Ga0500652_000002
895 Ga0500559_0000001
896 Ga0500559_0006099
897 Ga0500616_0000002
898 Ga0500616_0000072
899 Ga0500636_0016470
900 Ga0500636_0045645
901 Ga0500636_0053919
902 Ga0500645_000817
903 Ga0501084_0095904
904 Ga0501082_0145811
905 2511170521
906 2513592338
907 2513680141
908 2643754993
909 2643911179
910 2643912195
911 2840883332
912 2888352402
913 2919683222
914 2922132671
915 2977978677
916 2979749415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01494

FAD_binding_3

FAD binding domain

34

268

0.83

PF01494

FAD_binding_3

FAD binding domain

323

394

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rgj-assembly1.cif.gz_A crystal structure of flavin-containing monooxygenase phzs 0.9416 18 356
7o1k-assembly1.cif.gz_B structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9343 15 46
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9295 15 48
3dl2-assembly1.cif.gz_B hexagonal structure of the ldh domain of human ubiquitin-conjugating enzyme e2-like isoform a 0.9276 16 46
7o1k-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9252 15 46
ID Description Score Start End Superfamily
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 17 49 3.40.50.720
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9424 17 46 3.40.50.720
af_P9WN19_146_269_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.938 18 49 3.50.50.60
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9293 16 47 3.40.50.720
1mfzC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9289 18 46 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A258XSC8-F1-model_v4 Flavin-dependent oxidoreductase 0.9817 16 418 GO:0004497
GO:0071949
AF-H0BS86-F1-model_v4 FAD-binding domain-containing protein 0.9745 19 419 GO:0004497
GO:0071949
AF-A0A3T0MXG8-F1-model_v4 Flavin-dependent oxidoreductase 0.9713 17 418 GO:0004497
GO:0071949
AF-A0A368DVE0-F1-model_v4 Flavin-dependent oxidoreductase 0.9686 17 411 GO:0004497
GO:0071949
AF-A0A257JIN5-F1-model_v4 Flavin-dependent oxidoreductase 0.967 15 206 GO:0004497
GO:0071949

Map