F448170

General Info

Members Datasets Scaffolds Average Seq Length
458 193 916 238

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10005578|Ga0105244_100055786
Length 252
Sequence MHCVARQNRGPTRSKVPDVRGEKGQQLNQQTLSMRLERVAAHVPAGARLADIGSDHGYLPVALMRRGAIVAAVAGEVALTPFRSAERTVRENDLDQWITVRLADGLTAIEPGISICGMGGETIRDILDSGKARLSGQERLILQPNGGEQPLRQWLMENGYCILCEEVLRENRFDYEIIVAERTGPVMYTAEELYFGPLQMQARSSAFLIKWQRLLREKQRTLSSFAKARQAVPEEKVQDVARQARWIADLLS

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
7 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
8 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
9 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
10 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
21 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
22 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
30 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
42 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
43 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
44 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
47 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
50 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
51 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
52 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
53 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
54 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
55 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
56 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
57 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
58 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
59 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
62 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
65 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
148 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 2511231004 Pseudomonas sp. GM102 Isolate Nodule
152 2511231010 Pseudomonas sp. GM25 Isolate Nodule
153 2511231012 Pseudomonas sp. GM33 Isolate Nodule
154 2511231014 Pseudomonas sp. GM48 Isolate Nodule
155 2511231016 Pseudomonas sp. GM50 Isolate Nodule
156 2511231017 Pseudomonas sp. GM55 Isolate Nodule
157 2511231021 Pseudomonas sp. GM78 Isolate Nodule
158 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
159 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
160 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
161 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
162 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
163 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
164 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
165 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
166 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
167 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
168 2773857670 Pseudomonas sp. 478 Isolate Unclassified
169 2784132072 Pseudomonas sp. 460 Isolate Unclassified
170 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
171 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
172 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
173 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
174 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
175 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
176 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
177 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
178 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
179 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
180 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
181 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
182 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
183 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
184 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
185 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
186 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
187 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
188 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
189 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
190 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
191 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
192 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
193 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.61
Metatranscriptomes 0
Isolates 9.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 2.84
Rhizoplane 1.75
Rhizosphere 84.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10005578 3300009036 Bacteria 8326
2 MRS2a_Contig_721 2124908027 Bacteria 19610
3 MRS1b_contig_2161490 2162886011 Bacteria 1054
4 Ga0065714_10000150 3300005288 Bacteria 8851
5 Ga0065714_10003714 3300005288 Bacteria 11382
6 Ga0065714_10114457 3300005288 Bacteria 1428
7 Ga0065712_10001759 3300005290 Bacteria 5601
8 Ga0065712_10068163 3300005290 Bacteria 13627
9 Ga0075432_10001985 3300006058 Bacteria 6800
10 Ga0075432_10058625 3300006058 Bacteria 1367
11 Ga0075362_10087371 3300006177 Bacteria 1444
12 Ga0075436_100059121 3300006914 Bacteria 2648
13 Ga0079104_1000085 3300006946 Bacteria 136289
14 Ga0079104_1000245 3300006946 Bacteria 72407
15 Ga0099826_10046937 3300006948 Bacteria 2938
16 Ga0105251_10001281 3300009011 Bacteria 21723
17 Ga0105251_10003271 3300009011 Bacteria 11881
18 Ga0105251_10005580 3300009011 Bacteria 8185
19 Ga0105251_10007455 3300009011 Bacteria 6739
20 Ga0105251_10033752 3300009011 Bacteria 2537
21 Ga0105251_10052809 3300009011 Bacteria 1934
22 Ga0105251_10084135 3300009011 Bacteria 1468
23 Ga0105244_10000211 3300009036 Bacteria 60009
24 Ga0105244_10002114 3300009036 Bacteria 15267
25 Ga0105243_10000060 3300009148 Bacteria 128124
26 Ga0105246_10000723 3300011119 Bacteria 18714
27 Ga0105246_10003519 3300011119 Bacteria 9484
28 Ga0157373_10005907 3300013100 Bacteria 9160
29 Ga0157373_10243691 3300013100 Bacteria 1271
30 Ga0157370_10006414 3300013104 Bacteria 12976
31 Ga0157370_10052444 3300013104 Bacteria 3894
32 Ga0157369_10169598 3300013105 Bacteria 2300
33 Ga0182008_10026348 3300014497 Bacteria 2949
34 Ga0182008_10109843 3300014497 Bacteria 1366
35 Ga0182006_1001849 3300015261 Bacteria 12144
36 Ga0182006_1005129 3300015261 Bacteria 6294
37 Ga0182007_10001264 3300015262 Bacteria 13731
38 Ga0182005_1000844 3300015265 Bacteria 13714
39 Ga0163161_10003907 3300017792 Bacteria 10452
40 Ga0163161_10008081 3300017792 Bacteria 7275
41 Ga0163161_10214436 3300017792 Bacteria 1488
42 Ga0209676_1003838 3300025292 Bacteria 8823
43 Ga0209050_1000782 3300025298 Bacteria 45306
44 Ga0209051_1013616 3300025303 Bacteria 3856
45 Ga0207696_1001477 3300025711 Bacteria 12721
46 Ga0207655_1000076 3300025728 Bacteria 226359
47 Ga0207655_1001113 3300025728 Bacteria 26259
48 Ga0207713_1001910 3300025735 Bacteria 15777
49 Ga0207713_1004432 3300025735 Bacteria 9102
50 Ga0207713_1005809 3300025735 Bacteria 7636
51 Ga0207713_1009432 3300025735 Bacteria 5500
52 Ga0207713_1015604 3300025735 Bacteria 3890
53 Ga0207713_1015622 3300025735 Bacteria 3888
54 Ga0207713_1020221 3300025735 Bacteria 3232
55 Ga0207713_1030951 3300025735 Bacteria 2375
56 Ga0207709_10000004 3300025935 Bacteria 825156
57 Ga0209281_1000009 3300027111 Bacteria 771717
58 Ga0209281_1000046 3300027111 Bacteria 327042
59 Ga0209282_1093736 3300027666 Bacteria 1565
60 Ga0207428_10010472 3300027907 Bacteria 8278
61 Ga0207428_10016121 3300027907 Bacteria 6437
62 Ga0207428_10041518 3300027907 Bacteria 3724
63 Ga0207428_10120407 3300027907 Bacteria 2013
64 Ga0314311_1236442 3300030733 Bacteria 2935
65 Ga0307408_100000066 3300031548 Bacteria 121679
66 Ga0307408_100002922 3300031548 Bacteria 11844
67 Ga0307408_100045669 3300031548 Bacteria 3129
68 Ga0307405_10015857 3300031731 Bacteria 4092
69 Ga0307405_10157499 3300031731 Bacteria 1604
70 Ga0307413_10024628 3300031824 Bacteria 3284
71 Ga0307413_10174198 3300031824 Bacteria 1526
72 Ga0307413_10453629 3300031824 Bacteria 1018
73 Ga0307406_10039114 3300031901 Bacteria 2940
74 Ga0307407_10111426 3300031903 Bacteria 1718
75 Ga0307412_10009216 3300031911 Bacteria 5657
76 Ga0307416_100119421 3300032002 Bacteria 2345
77 Ga0307414_10042171 3300032004 Bacteria 3098
78 Ga0307414_10193301 3300032004 Bacteria 1648
79 Ga0307411_10007411 3300032005 Bacteria 5588
80 Ga0237819_00249 3300038705 Bacteria 19634
81 Ga0439438_000126 3300041405 Bacteria 34403
82 Ga0439447_000290 3300041407 Bacteria 17857
83 Ga0439447_001296 3300041407 Bacteria 9099
84 Ga0439447_002894 3300041407 Bacteria 6149
85 Ga0439447_020727 3300041407 Bacteria 1738
86 Ga0439447_023417 3300041407 Bacteria 1609
87 Ga0439447_030604 3300041407 Bacteria 1355
88 Ga0439466_0008585 3300041411 Bacteria 3849
89 Ga0439431_0000049 3300041997 Bacteria 17790
90 Ga0439445_0005906 3300042004 Bacteria 2803
91 Ga0439432_000163 3300042006 Bacteria 23007
92 Ga0439451_009932 3300042009 Bacteria 1920
93 Ga0439451_035611 3300042009 Bacteria 1000
94 Ga0439452_000046 3300042010 Bacteria 130842
95 Ga0439452_000777 3300042010 Bacteria 15131
96 Ga0439452_001287 3300042010 Bacteria 10632
97 Ga0439452_010919 3300042010 Bacteria 2625
98 Ga0439452_038010 3300042010 Bacteria 1144
99 Ga0439463_006255 3300042016 Bacteria 2951
100 Ga0450920_002733 3300042122 Bacteria 3026
101 Ga0450902_009592 3300042137 Bacteria 1525
102 Ga0450902_017556 3300042137 Bacteria 1170
103 Ga0450903_003905 3300042138 Bacteria 2562
104 Ga0450903_011052 3300042138 Bacteria 1456
105 Ga0450907_000390 3300042146 Bacteria 13314
106 Ga0450910_001978 3300042147 Bacteria 2658
107 Ga0450909_000934 3300042185 Bacteria 3995
108 Ga0439460_0006939 3300042461 Bacteria 2821
109 Ga0450901_004567 3300042533 Bacteria 1433
110 Ga0495617_003672 3300046452 Bacteria 5719
111 Ga0495617_004252 3300046452 Bacteria 5229
112 Ga0495627_000133 3300046453 Bacteria 89977
113 Ga0495627_011575 3300046453 Bacteria 3161
114 Ga0495592_0001154 3300046454 Bacteria 18329
115 Ga0495603_0008651 3300046455 Bacteria 6152
116 Ga0495603_0013219 3300046455 Bacteria 4989
117 Ga0495603_0042875 3300046455 Bacteria 2703
118 Ga0495603_0199271 3300046455 Bacteria 1157
119 Ga0495590_0000339 3300046457 Bacteria 24297
120 Ga0495590_0008292 3300046457 Bacteria 3969
121 Ga0495590_0008569 3300046457 Bacteria 3902
122 Ga0495591_000330 3300046458 Bacteria 42741
123 Ga0495591_000437 3300046458 Bacteria 33994
124 Ga0495591_002856 3300046458 Bacteria 9285
125 Ga0495591_009392 3300046458 Bacteria 3894
126 Ga0495591_011500 3300046458 Bacteria 3350
127 Ga0495629_0017687 3300046459 Bacteria 5109
128 Ga0495638_0000088 3300046460 Bacteria 152517
129 Ga0495638_0000352 3300046460 Bacteria 57480
130 Ga0495638_0001330 3300046460 Bacteria 22719
131 Ga0495638_0016047 3300046460 Bacteria 5020
132 Ga0495638_0018375 3300046460 Bacteria 4643
133 Ga0495638_0021397 3300046460 Bacteria 4264
134 Ga0495638_0024748 3300046460 Bacteria 3908
135 Ga0495638_0275852 3300046460 Bacteria 915
136 Ga0495653_0000502 3300046463 Bacteria 30211
137 Ga0495650_0000902 3300046471 Bacteria 34966
138 Ga0495650_0002334 3300046471 Bacteria 15692
139 Ga0495650_0008500 3300046471 Bacteria 5975
140 Ga0495582_0130171 3300046473 Bacteria 1421
141 Ga0495605_0000145 3300046474 Bacteria 91308
142 Ga0495605_0000250 3300046474 Bacteria 63615
143 Ga0495605_0002687 3300046474 Bacteria 10893
144 Ga0495605_0008433 3300046474 Bacteria 5825
145 Ga0495605_0010183 3300046474 Bacteria 5264
146 Ga0495605_0019496 3300046474 Bacteria 3622
147 Ga0495639_0000090 3300046475 Bacteria 44069
148 Ga0495639_0022070 3300046475 Bacteria 2790
149 Ga0495639_0213855 3300046475 Bacteria 946
150 Ga0495584_0001072 3300046491 Bacteria 16988
151 Ga0495584_0006215 3300046491 Bacteria 6266
152 Ga0495584_0009825 3300046491 Bacteria 4920
153 Ga0495584_0099332 3300046491 Bacteria 1470
154 Ga0495585_0002108 3300046492 Bacteria 14545
155 Ga0495585_0011813 3300046492 Bacteria 5158
156 Ga0495585_0013838 3300046492 Bacteria 4714
157 Ga0495585_0014456 3300046492 Bacteria 4598
158 Ga0495585_0018660 3300046492 Bacteria 4000
159 Ga0495585_0023538 3300046492 Bacteria 3534
160 Ga0495594_0000424 3300046499 Bacteria 21263
161 Ga0495594_0001807 3300046499 Bacteria 11115
162 Ga0495596_0000225 3300046500 Bacteria 38452
163 Ga0495607_0000609 3300046501 Bacteria 34781
164 Ga0495607_0006264 3300046501 Bacteria 8389
165 Ga0495607_0014982 3300046501 Bacteria 5039
166 Ga0495607_0160870 3300046501 Bacteria 1141
167 Ga0495583_0000538 3300046506 Bacteria 53381
168 Ga0495583_0001543 3300046506 Bacteria 22817
169 Ga0495583_0004566 3300046506 Bacteria 9841
170 Ga0495583_0010352 3300046506 Bacteria 5446
171 Ga0495583_0054070 3300046506 Bacteria 1819
172 Ga0495606_0064560 3300046507 Bacteria 2329
173 Ga0495606_0120961 3300046507 Bacteria 1567
174 Ga0495606_0160990 3300046507 Bacteria 1309
175 Ga0495606_0169725 3300046507 Bacteria 1266
176 Ga0495610_0007379 3300046512 Bacteria 7335
177 Ga0495610_0020144 3300046512 Bacteria 3710
178 Ga0495610_0040936 3300046512 Bacteria 2330
179 Ga0495616_0000041 3300046513 Bacteria 122413
180 Ga0495616_0000156 3300046513 Bacteria 59558
181 Ga0495616_0000245 3300046513 Bacteria 44179
182 Ga0495616_0020479 3300046513 Bacteria 3596
183 Ga0495616_0044126 3300046513 Bacteria 2262
184 Ga0495620_0000175 3300046515 Bacteria 50155
185 Ga0495620_0018660 3300046515 Bacteria 3431
186 Ga0495631_0020981 3300046518 Bacteria 3045
187 Ga0495632_0000295 3300046519 Bacteria 48203
188 Ga0495632_0004482 3300046519 Bacteria 9469
189 Ga0495632_0005172 3300046519 Bacteria 8704
190 Ga0495632_0005868 3300046519 Bacteria 8022
191 Ga0495632_0007158 3300046519 Bacteria 7055
192 Ga0495637_0001072 3300046520 Bacteria 17042
193 Ga0495637_0002032 3300046520 Bacteria 11403
194 Ga0495637_0007134 3300046520 Bacteria 5562
195 Ga0495637_0018053 3300046520 Bacteria 3276
196 Ga0495637_0019973 3300046520 Bacteria 3088
197 Ga0495643_0010326 3300046522 Bacteria 5749
198 Ga0495643_0043107 3300046522 Bacteria 2456
199 Ga0495644_0000005 3300046523 Bacteria 135313
200 Ga0495644_0000160 3300046523 Bacteria 31939
201 Ga0495644_0000504 3300046523 Bacteria 16685
202 Ga0495644_0011871 3300046523 Bacteria 3350
203 Ga0495648_0000237 3300046524 Bacteria 63132
204 Ga0495648_0000642 3300046524 Bacteria 37256
205 Ga0495648_0002220 3300046524 Bacteria 18185
206 Ga0495648_0005792 3300046524 Bacteria 10188
207 Ga0495648_0010226 3300046524 Bacteria 7166
208 Ga0495648_0092963 3300046524 Bacteria 1683
209 Ga0495648_0109143 3300046524 Bacteria 1509
210 Ga0495648_0198439 3300046524 Bacteria 1006
211 Ga0495666_0001628 3300046526 Bacteria 11051
212 Ga0495666_0013072 3300046526 Bacteria 4137
213 Ga0495642_0000006 3300046528 Bacteria 172412
214 Ga0495642_0000198 3300046528 Bacteria 35398
215 Ga0495654_0000050 3300046530 Bacteria 146814
216 Ga0495654_0000272 3300046530 Bacteria 47029
217 Ga0495654_0001044 3300046530 Bacteria 20280
218 Ga0495654_0011678 3300046530 Bacteria 4744
219 Ga0495654_0014402 3300046530 Bacteria 4208
220 Ga0495654_0018753 3300046530 Bacteria 3622
221 Ga0495654_0039396 3300046530 Bacteria 2359
222 Ga0495654_0044894 3300046530 Bacteria 2182
223 Ga0495587_0026572 3300046536 Bacteria 3529
224 Ga0495587_0116084 3300046536 Bacteria 1535
225 Ga0495609_0009479 3300046538 Bacteria 4709
226 Ga0495609_0009841 3300046538 Bacteria 4609
227 Ga0495609_0013125 3300046538 Bacteria 3917
228 Ga0495609_0022772 3300046538 Bacteria 2886
229 Ga0495609_0047119 3300046538 Bacteria 1929
230 Ga0495597_0018209 3300046542 Bacteria 3298
231 Ga0495597_0019213 3300046542 Bacteria 3200
232 Ga0495597_0144858 3300046542 Bacteria 978
233 Ga0495645_0085512 3300046543 Bacteria 2257
234 Ga0495645_0220384 3300046543 Bacteria 1276
235 Ga0495622_0001557 3300046557 Bacteria 11385
236 Ga0495622_0002032 3300046557 Bacteria 9889
237 Ga0495622_0026381 3300046557 Bacteria 2713
238 Ga0495656_0010213 3300046615 Bacteria 3406
239 Ga0495656_0060623 3300046615 Bacteria 1649
240 Ga0495668_0000253 3300046616 Bacteria 76112
241 Ga0495668_0049223 3300046616 Bacteria 2337
242 Ga0495668_0187580 3300046616 Bacteria 1132
243 Ga0495634_0002612 3300046642 Bacteria 14827
244 Ga0495634_0048277 3300046642 Bacteria 2866
245 Ga0495625_0000103 3300046660 Bacteria 136109
246 Ga0495625_0011576 3300046660 Bacteria 7181
247 Ga0495625_0012072 3300046660 Bacteria 7010
248 Ga0495625_0012312 3300046660 Bacteria 6936
249 Ga0495625_0013454 3300046660 Bacteria 6576
250 Ga0495625_0034807 3300046660 Bacteria 3715
251 Ga0495625_0060597 3300046660 Bacteria 2680
252 Ga0495625_0179663 3300046660 Bacteria 1408
253 Ga0495625_0247023 3300046660 Bacteria 1159
254 Ga0495659_0000295 3300046664 Bacteria 19818
255 Ga0495659_0007527 3300046664 Bacteria 3454
256 Ga0495661_0006911 3300046665 Bacteria 7935
257 Ga0495661_0017243 3300046665 Bacteria 4769
258 Ga0495661_0156533 3300046665 Bacteria 1226
259 Ga0495588_0010735 3300046674 Bacteria 4273
260 Ga0495588_0012182 3300046674 Bacteria 4055
261 Ga0495646_0000385 3300046680 Bacteria 23120
262 Ga0495646_0074962 3300046680 Bacteria 1984
263 Ga0495669_0016387 3300046684 Bacteria 3173
264 Ga0495669_0018920 3300046684 Bacteria 2967
265 Ga0495669_0089584 3300046684 Bacteria 1419
266 Ga0495613_0004033 3300046689 Bacteria 10983
267 Ga0495624_0000530 3300046690 Bacteria 29860
268 Ga0495670_0000491 3300046691 Bacteria 18744
269 Ga0495670_0008571 3300046691 Bacteria 5034
270 Ga0495670_0009442 3300046691 Bacteria 4795
271 Ga0495671_0000950 3300046692 Bacteria 20380
272 Ga0495671_0000961 3300046692 Bacteria 20223
273 Ga0495671_0001769 3300046692 Bacteria 13984
274 Ga0495671_0007198 3300046692 Bacteria 6363
275 Ga0495671_0009194 3300046692 Bacteria 5525
276 Ga0495671_0011441 3300046692 Bacteria 4881
277 Ga0495671_0023582 3300046692 Bacteria 3213
278 Ga0495671_0036168 3300046692 Bacteria 2502
279 Ga0495671_0036952 3300046692 Bacteria 2472
280 Ga0495671_0071970 3300046692 Bacteria 1697
281 Ga0495649_0000060 3300046694 Bacteria 97624
282 Ga0495649_0000566 3300046694 Bacteria 31267
283 Ga0495649_0001326 3300046694 Bacteria 18813
284 Ga0495649_0009074 3300046694 Bacteria 5935
285 Ga0495649_0009742 3300046694 Bacteria 5691
286 Ga0495649_0030338 3300046694 Bacteria 2986
287 Ga0495589_0000629 3300046794 Bacteria 23217
288 Ga0495589_0021050 3300046794 Bacteria 3333
289 Ga0495589_0022753 3300046794 Bacteria 3196
290 Ga0495589_0024127 3300046794 Bacteria 3091
291 Ga0495589_0062729 3300046794 Bacteria 1823
292 Ga0495589_0082279 3300046794 Bacteria 1565
293 Ga0495600_0011275 3300046809 Bacteria 5565
294 Ga0495600_0285638 3300046809 Bacteria 1043
295 Ga0495660_0000136 3300046810 Bacteria 79750
296 Ga0495660_0002857 3300046810 Bacteria 10859
297 Ga0495660_0004959 3300046810 Bacteria 8013
298 Ga0495660_0006220 3300046810 Bacteria 7083
299 Ga0495660_0007132 3300046810 Bacteria 6582
300 Ga0495660_0008786 3300046810 Bacteria 5899
301 Ga0495660_0046868 3300046810 Bacteria 2369
302 Ga0495660_0047481 3300046810 Bacteria 2351
303 Ga0495660_0057014 3300046810 Bacteria 2108
304 Ga0495581_0007539 3300047315 Bacteria 6292
305 Ga0495581_0030082 3300047315 Bacteria 3148
306 Ga0495604_0006449 3300047317 Bacteria 9305
307 Ga0495604_0045749 3300047317 Bacteria 3414
308 Ga0495636_0064020 3300047318 Bacteria 1559
309 Ga0495672_0000158 3300047320 Bacteria 98531
310 Ga0495672_0000190 3300047320 Bacteria 88698
311 Ga0495672_0004616 3300047320 Bacteria 11182
312 Ga0495672_0004811 3300047320 Bacteria 10888
313 Ga0495672_0005190 3300047320 Bacteria 10381
314 Ga0495672_0012797 3300047320 Bacteria 5829
315 Ga0495672_0013593 3300047320 Bacteria 5607
316 Ga0495672_0024229 3300047320 Bacteria 3913
317 Ga0495672_0085824 3300047320 Bacteria 1743
318 Ga0495672_0118431 3300047320 Bacteria 1411
319 Ga0495676_0000984 3300047321 Bacteria 23913
320 Ga0495680_0001081 3300047322 Bacteria 30215
321 Ga0495680_0004517 3300047322 Bacteria 13297
322 Ga0495683_0001223 3300047323 Bacteria 17497
323 Ga0495683_0002675 3300047323 Bacteria 10627
324 Ga0495683_0002985 3300047323 Bacteria 9985
325 Ga0495683_0008648 3300047323 Bacteria 5437
326 Ga0495683_0018557 3300047323 Bacteria 3594
327 Ga0495683_0061739 3300047323 Bacteria 1855
328 Ga0495683_0064296 3300047323 Bacteria 1811
329 Ga0495683_0086059 3300047323 Bacteria 1527
330 Ga0495687_000222 3300047443 Bacteria 80818
331 Ga0495675_0312173 3300047444 Bacteria 931
332 Ga0495677_0022784 3300047445 Bacteria 2272
333 Ga0495679_000440 3300047446 Bacteria 30708
334 Ga0495673_0000112 3300047469 Bacteria 164434
335 Ga0495673_0000288 3300047469 Bacteria 67701
336 Ga0495673_0000447 3300047469 Bacteria 45237
337 Ga0495673_0002300 3300047469 Bacteria 13669
338 Ga0495673_0009003 3300047469 Bacteria 5556
339 Ga0495673_0023821 3300047469 Bacteria 2969
340 Ga0495673_0026107 3300047469 Bacteria 2797
341 Ga0495673_0092093 3300047469 Bacteria 1237
342 Ga0495681_0000141 3300047470 Bacteria 60621
343 Ga0495681_0000668 3300047470 Bacteria 26039
344 Ga0495681_0005440 3300047470 Bacteria 8529
345 Ga0495681_0006859 3300047470 Bacteria 7394
346 Ga0495681_0009693 3300047470 Bacteria 5904
347 Ga0495681_0037736 3300047470 Bacteria 2376
348 Ga0495681_0040118 3300047470 Bacteria 2281
349 Ga0495684_0002261 3300047471 Bacteria 15431
350 Ga0495686_0030343 3300047472 Bacteria 3511
351 Ga0495686_0057010 3300047472 Bacteria 2439
352 Ga0495593_0000713 3300047673 Bacteria 19221
353 Ga0495593_0062992 3300047673 Bacteria 1937
354 Ga0495602_0002811 3300048088 Bacteria 17803
355 Ga0495626_0000032 3300048091 Bacteria 184235
356 Ga0495626_0000072 3300048091 Bacteria 134289
357 Ga0495626_0000074 3300048091 Bacteria 132552
358 Ga0495626_0001795 3300048091 Bacteria 16213
359 Ga0495626_0002407 3300048091 Bacteria 13038
360 Ga0495626_0022077 3300048091 Bacteria 3146
361 Ga0495626_0022846 3300048091 Bacteria 3086
362 Ga0496102_0001644 3300048905 Bacteria 19692
363 Ga0496103_0000781 3300048906 Bacteria 23421
364 Ga0496110_0008890 3300048913 Bacteria 8098
365 Ga0496111_0471922 3300048914 Bacteria 925
366 Ga0496112_0199284 3300048915 Bacteria 1962
367 Ga0496116_0000858 3300048919 Bacteria 38019
368 Ga0496116_0001153 3300048919 Bacteria 31191
369 Ga0496117_0004465 3300048920 Bacteria 15406
370 Ga0496117_0004826 3300048920 Bacteria 14575
371 Ga0496117_0046956 3300048920 Bacteria 3102
372 Ga0496117_0178807 3300048920 Bacteria 1222
373 Ga0496117_0262096 3300048920 Bacteria 936
374 Ga0496118_0008855 3300048921 Bacteria 10297
375 Ga0496118_0015141 3300048921 Bacteria 7162
376 Ga0496118_0179096 3300048921 Bacteria 1283
377 Ga0496118_0187560 3300048921 Bacteria 1241
378 Ga0496121_0002524 3300048924 Bacteria 27763
379 Ga0496121_0033101 3300048924 Bacteria 4684
380 Ga0496121_0372552 3300048924 Bacteria 944
381 Ga0496121_0379493 3300048924 Bacteria 932
382 Ga0496122_0011216 3300048925 Bacteria 9113
383 Ga0496122_0015428 3300048925 Bacteria 7305
384 Ga0496123_0004671 3300048926 Bacteria 14198
385 Ga0496123_0022424 3300048926 Bacteria 4867
386 Ga0496123_0067514 3300048926 Bacteria 2258
387 Ga0496124_0000547 3300048927 Bacteria 63558
388 Ga0496124_0019950 3300048927 Bacteria 6216
389 Ga0496124_0038414 3300048927 Bacteria 4158
390 Ga0496124_0121882 3300048927 Bacteria 2082
391 Ga0496124_0146828 3300048927 Bacteria 1855
392 Ga0496124_0239344 3300048927 Bacteria 1351
393 Ga0496125_0000465 3300048928 Bacteria 72631
394 Ga0496125_0016036 3300048928 Bacteria 7214
395 Ga0495678_001048 3300049459 Bacteria 23397
396 Ga0495678_002781 3300049459 Bacteria 11428
397 Ga0495678_003236 3300049459 Bacteria 10212
398 Ga0495678_004902 3300049459 Bacteria 7562
399 Ga0495678_011020 3300049459 Bacteria 4349
400 Ga0495678_012979 3300049459 Bacteria 3927
401 Ga0495678_017392 3300049459 Bacteria 3260
402 Ga0495678_019482 3300049459 Bacteria 3026
403 Ga0495678_026413 3300049459 Bacteria 2479
404 Ga0495682_0000483 3300049460 Bacteria 27500
405 Ga0495682_0003159 3300049460 Bacteria 7427
406 Ga0495682_0008879 3300049460 Bacteria 3946
407 Ga0495682_0042914 3300049460 Bacteria 1656
408 Ga0495682_0057046 3300049460 Bacteria 1414
409 Ga0495682_0067872 3300049460 Bacteria 1284
410 Ga0495682_0108364 3300049460 Bacteria 995
411 Ga0501222_000135 3300049662 Bacteria 15576
412 Ga0501269_005083 3300049766 Bacteria 1583
413 nmdc:mga03683_24622_c1 3300050489 Bacteria 2357
414 nmdc:mga00v17_114453_c1 3300050491 Bacteria 1713
415 nmdc:mga00v17_46307_c1 3300050491 Bacteria 2631
416 2511257491 2511231004 Bacteria 6669789
417 2511290373 2511231010 Bacteria 6373152
418 2511303556 2511231012 Bacteria 6738011
419 2511316501 2511231014 Bacteria 6462302
420 2511325538 2511231016 Bacteria 6704427
421 2511332912 2511231017 Bacteria 6503007
422 2511358148 2511231021 Bacteria 7302637
423 2555669375 2554235341 Bacteria 6867980
424 2599970850 2599185307 Bacteria 6194719
425 2601799402 2600255318 Bacteria 6383414
426 2606130473 2603880199 Bacteria 6377649
427 2624492924 2623620446 Bacteria 6500345
428 2643845830 2643221565 Bacteria 6216018
429 2652544753 2651869719 Bacteria 6047974
430 2715760083 2713897149 Bacteria 6506249
431 2739197442 2738543004 Bacteria 6381073
432 2739262346 2738543015 Bacteria 6750701
433 2774119049 2773857670 Bacteria 6407454
434 2784312688 2784132072 Bacteria 6596533
435 2794598033 2791355520 Bacteria 5948615
436 2808857163 2808606361 Bacteria 6136259
437 2808925044 2808606376 Bacteria 6248667
438 2808937235 2808606378 Bacteria 6177535
439 2808947146 2808606380 Bacteria 6248705
440 2808965551 2808606383 Bacteria 6138645
441 2809000493 2808606389 Bacteria 6138126
442 2826585343 2826581358 Bacteria 5963467
443 2842820446 2842815866 Bacteria 5947510
444 2842849050 2842849001 Bacteria 5924277
445 2842857814 2842854478 Bacteria 6143501
446 2878032298 2878029506 Bacteria 6418441
447 2904550747 2904550169 Bacteria 6221258
448 2912967007 2912963787 Bacteria 5646108
449 2919703562 2919697872 Bacteria 6553725
450 2988728650 2988728565 Bacteria 6124362
451 3007256173 3007252601 Bacteria 4559114
452 3007514739 3007511990 Bacteria 6481491
453 3007619245 3007614139 Bacteria 6053559
454 3007872193 3007872151 Bacteria 5268868
455 8019782207 8019775933 Bacteria 6858656
456 8056129056 8056125926 Bacteria 6228218
457 8056140122 8056137416 Bacteria 6147080
458 8056146365 8056143049 Bacteria 6307666
459 Ga0105244_10005578
460 MRS2a_Contig_721
461 MRS1b_contig_2161490
462 Ga0065714_10000150
463 Ga0065714_10003714
464 Ga0065714_10114457
465 Ga0065712_10001759
466 Ga0065712_10068163
467 Ga0075432_10001985
468 Ga0075432_10058625
469 Ga0075362_10087371
470 Ga0075436_100059121
471 Ga0079104_1000085
472 Ga0079104_1000245
473 Ga0099826_10046937
474 Ga0105251_10001281
475 Ga0105251_10003271
476 Ga0105251_10005580
477 Ga0105251_10007455
478 Ga0105251_10033752
479 Ga0105251_10052809
480 Ga0105251_10084135
481 Ga0105244_10000211
482 Ga0105244_10002114
483 Ga0105243_10000060
484 Ga0105246_10000723
485 Ga0105246_10003519
486 Ga0157373_10005907
487 Ga0157373_10243691
488 Ga0157370_10006414
489 Ga0157370_10052444
490 Ga0157369_10169598
491 Ga0182008_10026348
492 Ga0182008_10109843
493 Ga0182006_1001849
494 Ga0182006_1005129
495 Ga0182007_10001264
496 Ga0182005_1000844
497 Ga0163161_10003907
498 Ga0163161_10008081
499 Ga0163161_10214436
500 Ga0209676_1003838
501 Ga0209050_1000782
502 Ga0209051_1013616
503 Ga0207696_1001477
504 Ga0207655_1000076
505 Ga0207655_1001113
506 Ga0207713_1001910
507 Ga0207713_1004432
508 Ga0207713_1005809
509 Ga0207713_1009432
510 Ga0207713_1015604
511 Ga0207713_1015622
512 Ga0207713_1020221
513 Ga0207713_1030951
514 Ga0207709_10000004
515 Ga0209281_1000009
516 Ga0209281_1000046
517 Ga0209282_1093736
518 Ga0207428_10010472
519 Ga0207428_10016121
520 Ga0207428_10041518
521 Ga0207428_10120407
522 Ga0314311_1236442
523 Ga0307408_100000066
524 Ga0307408_100002922
525 Ga0307408_100045669
526 Ga0307405_10015857
527 Ga0307405_10157499
528 Ga0307413_10024628
529 Ga0307413_10174198
530 Ga0307413_10453629
531 Ga0307406_10039114
532 Ga0307407_10111426
533 Ga0307412_10009216
534 Ga0307416_100119421
535 Ga0307414_10042171
536 Ga0307414_10193301
537 Ga0307411_10007411
538 Ga0237819_00249
539 Ga0439438_000126
540 Ga0439447_000290
541 Ga0439447_001296
542 Ga0439447_002894
543 Ga0439447_020727
544 Ga0439447_023417
545 Ga0439447_030604
546 Ga0439466_0008585
547 Ga0439431_0000049
548 Ga0439445_0005906
549 Ga0439432_000163
550 Ga0439451_009932
551 Ga0439451_035611
552 Ga0439452_000046
553 Ga0439452_000777
554 Ga0439452_001287
555 Ga0439452_010919
556 Ga0439452_038010
557 Ga0439463_006255
558 Ga0450920_002733
559 Ga0450902_009592
560 Ga0450902_017556
561 Ga0450903_003905
562 Ga0450903_011052
563 Ga0450907_000390
564 Ga0450910_001978
565 Ga0450909_000934
566 Ga0439460_0006939
567 Ga0450901_004567
568 Ga0495617_003672
569 Ga0495617_004252
570 Ga0495627_000133
571 Ga0495627_011575
572 Ga0495592_0001154
573 Ga0495603_0008651
574 Ga0495603_0013219
575 Ga0495603_0042875
576 Ga0495603_0199271
577 Ga0495590_0000339
578 Ga0495590_0008292
579 Ga0495590_0008569
580 Ga0495591_000330
581 Ga0495591_000437
582 Ga0495591_002856
583 Ga0495591_009392
584 Ga0495591_011500
585 Ga0495629_0017687
586 Ga0495638_0000088
587 Ga0495638_0000352
588 Ga0495638_0001330
589 Ga0495638_0016047
590 Ga0495638_0018375
591 Ga0495638_0021397
592 Ga0495638_0024748
593 Ga0495638_0275852
594 Ga0495653_0000502
595 Ga0495650_0000902
596 Ga0495650_0002334
597 Ga0495650_0008500
598 Ga0495582_0130171
599 Ga0495605_0000145
600 Ga0495605_0000250
601 Ga0495605_0002687
602 Ga0495605_0008433
603 Ga0495605_0010183
604 Ga0495605_0019496
605 Ga0495639_0000090
606 Ga0495639_0022070
607 Ga0495639_0213855
608 Ga0495584_0001072
609 Ga0495584_0006215
610 Ga0495584_0009825
611 Ga0495584_0099332
612 Ga0495585_0002108
613 Ga0495585_0011813
614 Ga0495585_0013838
615 Ga0495585_0014456
616 Ga0495585_0018660
617 Ga0495585_0023538
618 Ga0495594_0000424
619 Ga0495594_0001807
620 Ga0495596_0000225
621 Ga0495607_0000609
622 Ga0495607_0006264
623 Ga0495607_0014982
624 Ga0495607_0160870
625 Ga0495583_0000538
626 Ga0495583_0001543
627 Ga0495583_0004566
628 Ga0495583_0010352
629 Ga0495583_0054070
630 Ga0495606_0064560
631 Ga0495606_0120961
632 Ga0495606_0160990
633 Ga0495606_0169725
634 Ga0495610_0007379
635 Ga0495610_0020144
636 Ga0495610_0040936
637 Ga0495616_0000041
638 Ga0495616_0000156
639 Ga0495616_0000245
640 Ga0495616_0020479
641 Ga0495616_0044126
642 Ga0495620_0000175
643 Ga0495620_0018660
644 Ga0495631_0020981
645 Ga0495632_0000295
646 Ga0495632_0004482
647 Ga0495632_0005172
648 Ga0495632_0005868
649 Ga0495632_0007158
650 Ga0495637_0001072
651 Ga0495637_0002032
652 Ga0495637_0007134
653 Ga0495637_0018053
654 Ga0495637_0019973
655 Ga0495643_0010326
656 Ga0495643_0043107
657 Ga0495644_0000005
658 Ga0495644_0000160
659 Ga0495644_0000504
660 Ga0495644_0011871
661 Ga0495648_0000237
662 Ga0495648_0000642
663 Ga0495648_0002220
664 Ga0495648_0005792
665 Ga0495648_0010226
666 Ga0495648_0092963
667 Ga0495648_0109143
668 Ga0495648_0198439
669 Ga0495666_0001628
670 Ga0495666_0013072
671 Ga0495642_0000006
672 Ga0495642_0000198
673 Ga0495654_0000050
674 Ga0495654_0000272
675 Ga0495654_0001044
676 Ga0495654_0011678
677 Ga0495654_0014402
678 Ga0495654_0018753
679 Ga0495654_0039396
680 Ga0495654_0044894
681 Ga0495587_0026572
682 Ga0495587_0116084
683 Ga0495609_0009479
684 Ga0495609_0009841
685 Ga0495609_0013125
686 Ga0495609_0022772
687 Ga0495609_0047119
688 Ga0495597_0018209
689 Ga0495597_0019213
690 Ga0495597_0144858
691 Ga0495645_0085512
692 Ga0495645_0220384
693 Ga0495622_0001557
694 Ga0495622_0002032
695 Ga0495622_0026381
696 Ga0495656_0010213
697 Ga0495656_0060623
698 Ga0495668_0000253
699 Ga0495668_0049223
700 Ga0495668_0187580
701 Ga0495634_0002612
702 Ga0495634_0048277
703 Ga0495625_0000103
704 Ga0495625_0011576
705 Ga0495625_0012072
706 Ga0495625_0012312
707 Ga0495625_0013454
708 Ga0495625_0034807
709 Ga0495625_0060597
710 Ga0495625_0179663
711 Ga0495625_0247023
712 Ga0495659_0000295
713 Ga0495659_0007527
714 Ga0495661_0006911
715 Ga0495661_0017243
716 Ga0495661_0156533
717 Ga0495588_0010735
718 Ga0495588_0012182
719 Ga0495646_0000385
720 Ga0495646_0074962
721 Ga0495669_0016387
722 Ga0495669_0018920
723 Ga0495669_0089584
724 Ga0495613_0004033
725 Ga0495624_0000530
726 Ga0495670_0000491
727 Ga0495670_0008571
728 Ga0495670_0009442
729 Ga0495671_0000950
730 Ga0495671_0000961
731 Ga0495671_0001769
732 Ga0495671_0007198
733 Ga0495671_0009194
734 Ga0495671_0011441
735 Ga0495671_0023582
736 Ga0495671_0036168
737 Ga0495671_0036952
738 Ga0495671_0071970
739 Ga0495649_0000060
740 Ga0495649_0000566
741 Ga0495649_0001326
742 Ga0495649_0009074
743 Ga0495649_0009742
744 Ga0495649_0030338
745 Ga0495589_0000629
746 Ga0495589_0021050
747 Ga0495589_0022753
748 Ga0495589_0024127
749 Ga0495589_0062729
750 Ga0495589_0082279
751 Ga0495600_0011275
752 Ga0495600_0285638
753 Ga0495660_0000136
754 Ga0495660_0002857
755 Ga0495660_0004959
756 Ga0495660_0006220
757 Ga0495660_0007132
758 Ga0495660_0008786
759 Ga0495660_0046868
760 Ga0495660_0047481
761 Ga0495660_0057014
762 Ga0495581_0007539
763 Ga0495581_0030082
764 Ga0495604_0006449
765 Ga0495604_0045749
766 Ga0495636_0064020
767 Ga0495672_0000158
768 Ga0495672_0000190
769 Ga0495672_0004616
770 Ga0495672_0004811
771 Ga0495672_0005190
772 Ga0495672_0012797
773 Ga0495672_0013593
774 Ga0495672_0024229
775 Ga0495672_0085824
776 Ga0495672_0118431
777 Ga0495676_0000984
778 Ga0495680_0001081
779 Ga0495680_0004517
780 Ga0495683_0001223
781 Ga0495683_0002675
782 Ga0495683_0002985
783 Ga0495683_0008648
784 Ga0495683_0018557
785 Ga0495683_0061739
786 Ga0495683_0064296
787 Ga0495683_0086059
788 Ga0495687_000222
789 Ga0495675_0312173
790 Ga0495677_0022784
791 Ga0495679_000440
792 Ga0495673_0000112
793 Ga0495673_0000288
794 Ga0495673_0000447
795 Ga0495673_0002300
796 Ga0495673_0009003
797 Ga0495673_0023821
798 Ga0495673_0026107
799 Ga0495673_0092093
800 Ga0495681_0000141
801 Ga0495681_0000668
802 Ga0495681_0005440
803 Ga0495681_0006859
804 Ga0495681_0009693
805 Ga0495681_0037736
806 Ga0495681_0040118
807 Ga0495684_0002261
808 Ga0495686_0030343
809 Ga0495686_0057010
810 Ga0495593_0000713
811 Ga0495593_0062992
812 Ga0495602_0002811
813 Ga0495626_0000032
814 Ga0495626_0000072
815 Ga0495626_0000074
816 Ga0495626_0001795
817 Ga0495626_0002407
818 Ga0495626_0022077
819 Ga0495626_0022846
820 Ga0496102_0001644
821 Ga0496103_0000781
822 Ga0496110_0008890
823 Ga0496111_0471922
824 Ga0496112_0199284
825 Ga0496116_0000858
826 Ga0496116_0001153
827 Ga0496117_0004465
828 Ga0496117_0004826
829 Ga0496117_0046956
830 Ga0496117_0178807
831 Ga0496117_0262096
832 Ga0496118_0008855
833 Ga0496118_0015141
834 Ga0496118_0179096
835 Ga0496118_0187560
836 Ga0496121_0002524
837 Ga0496121_0033101
838 Ga0496121_0372552
839 Ga0496121_0379493
840 Ga0496122_0011216
841 Ga0496122_0015428
842 Ga0496123_0004671
843 Ga0496123_0022424
844 Ga0496123_0067514
845 Ga0496124_0000547
846 Ga0496124_0019950
847 Ga0496124_0038414
848 Ga0496124_0121882
849 Ga0496124_0146828
850 Ga0496124_0239344
851 Ga0496125_0000465
852 Ga0496125_0016036
853 Ga0495678_001048
854 Ga0495678_002781
855 Ga0495678_003236
856 Ga0495678_004902
857 Ga0495678_011020
858 Ga0495678_012979
859 Ga0495678_017392
860 Ga0495678_019482
861 Ga0495678_026413
862 Ga0495682_0000483
863 Ga0495682_0003159
864 Ga0495682_0008879
865 Ga0495682_0042914
866 Ga0495682_0057046
867 Ga0495682_0067872
868 Ga0495682_0108364
869 Ga0501222_000135
870 Ga0501269_005083
871 nmdc:mga03683_24622_c1
872 nmdc:mga00v17_114453_c1
873 nmdc:mga00v17_46307_c1
874 2511257491
875 2511290373
876 2511303556
877 2511316501
878 2511325538
879 2511332912
880 2511358148
881 2555669375
882 2599970850
883 2601799402
884 2606130473
885 2624492924
886 2643845830
887 2652544753
888 2715760083
889 2739197442
890 2739262346
891 2774119049
892 2784312688
893 2794598033
894 2808857163
895 2808925044
896 2808937235
897 2808947146
898 2808965551
899 2809000493
900 2826585343
901 2842820446
902 2842849050
903 2842857814
904 2878032298
905 2904550747
906 2912967007
907 2919703562
908 2988728650
909 3007256173
910 3007514739
911 3007619245
912 3007872193
913 8019782207
914 8056129056
915 8056140122
916 8056146365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12847

Methyltransf_18

Methyltransferase domain

32

178

0.99

PF04816

TrmK

tRNA (adenine(22)-N(1))-methyltransferase

49

245

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gnl-assembly2.cif.gz_B structure of uncharacterized protein (lmof2365_1472) from listeria monocytogenes serotype 4b 0.949 31 253
3ku1-assembly2.cif.gz_B crystal structure of streptococcus pneumoniae sp1610, a putative trna (m1a22) methyltransferase, in complex with s-adenosyl-l-methionine 0.9423 31 253
3ku1-assembly2.cif.gz_B crystal structure of streptococcus pneumoniae sp1610, a putative trna (m1a22) methyltransferase, in complex with s-adenosyl-l-methionine 0.938 31 253
3lec-assembly1.cif.gz_A the crystal structure of a protein in the nadb-rossmann superfamily from streptococcus agalactiae to 1.8a 0.9352 31 253
6q56-assembly4.cif.gz_D crystal structure of the b. subtilis m1a22 trna methyltransferase trmk 0.9236 30 253
ID Description Score Start End Superfamily
af_Q2FY13_1_163_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9657 31 189 3.40.50.150
3gnlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9518 31 188 3.40.50.150
3lecA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9495 31 185 3.40.50.150
af_Q2FY13_1_163_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9368 31 189 3.40.50.150
3gnlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9346 31 188 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6L3MCM4-F1-model_v4 deleted 0.9969 29 135
AF-A0A4U3MR54-F1-model_v4 SAM-dependent methyltransferase 0.9944 29 111 GO:0032259
GO:0160105
AF-A0A1T2Z700-F1-model_v4 tRNA (Adenine-N(1))-methyltransferase 0.9929 29 105 GO:0008168
GO:0032259
AF-A0A3M2VW08-F1-model_v4 SAM-dependent methyltransferase 0.9896 28 153
AF-A0A519EMQ9-F1-model_v4 tRNA (Adenine-N(1))-methyltransferase 0.9852 29 199 GO:0032259
GO:0160105

Map