F448191

General Info

Members Datasets Scaffolds Average Seq Length
458 279 916 252

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10240834|Ga0157380_102408341
Length 283
Sequence LWTHRRPAGDVAAAALPVDAFTDGLGADPLYTLGMRAEGPVAVVTGAGSGIGRRVSLDLAAAGYRVVLAGRRVSTLDETAAAAPESTLVVATDVTDPAAVRDLFARARDRYGRVDVLFNNAGAFGRTAPIADVSYEQWQAVVDTNLTGAFLCAQEAFRAMRDQSPQGGRIINNGSISAHVPRPYAVGYTATKHAVTGLTKQIALEGRPYRIACGQIDIGNAATDMTAAMSQGVPQASGQIAAEPRMDVAHAASAVVYMAGLPLDANVLFLTVMATTMPYVGRG

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
259 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2508501050 Microvirga lupini Lut6 Isolate Nodule
263 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
264 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
265 2643221558 Rhizobium sp. Root149 Isolate Unclassified
266 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
267 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
268 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
269 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
270 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
271 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
272 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
273 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
274 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
275 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
276 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
277 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
278 641522639 Methylobacterium sp. 4-46 Isolate Nodule
279 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.07
Metatranscriptomes 0
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 2.4
Rhizoplane 3.71
Rhizosphere 89.52
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10240834 3300014326 Bacteria 1631
2 Ga0070676_10001919 3300005328 Bacteria 10570
3 Ga0070683_100079079 3300005329 Bacteria 3077
4 Ga0070690_100149786 3300005330 Bacteria 1591
5 Ga0070670_100000942 3300005331 Bacteria 22849
6 Ga0070670_100119509 3300005331 Bacteria 2273
7 Ga0070670_100324426 3300005331 Bacteria 1349
8 Ga0068869_100162242 3300005334 Bacteria 1740
9 Ga0070666_10000980 3300005335 Bacteria 17428
10 Ga0070666_10001480 3300005335 Bacteria 14261
11 Ga0070680_100002207 3300005336 Bacteria 14358
12 Ga0068868_100008656 3300005338 Bacteria 7288
13 Ga0068868_100031507 3300005338 Bacteria 4074
14 Ga0068868_100039202 3300005338 Bacteria 3681
15 Ga0068868_100518586 3300005338 Bacteria 1046
16 Ga0070660_100017052 3300005339 Bacteria 5288
17 Ga0070689_100087994 3300005340 Bacteria 2444
18 Ga0070687_100254601 3300005343 Bacteria 1092
19 Ga0070661_100002539 3300005344 Bacteria 12500
20 Ga0070661_100005214 3300005344 Bacteria 8948
21 Ga0070661_100014138 3300005344 Bacteria 5622
22 Ga0070661_100218494 3300005344 Bacteria 1461
23 Ga0070692_10010952 3300005345 Bacteria 4150
24 Ga0070668_100002148 3300005347 Bacteria 14431
25 Ga0070669_100000902 3300005353 Bacteria 21625
26 Ga0070675_100005393 3300005354 Bacteria 9777
27 Ga0070675_100012086 3300005354 Bacteria 6767
28 Ga0070671_100025620 3300005355 Bacteria 4841
29 Ga0070671_100027700 3300005355 Bacteria 4665
30 Ga0070673_100008859 3300005364 Bacteria 6720
31 Ga0070673_100029541 3300005364 Bacteria 4089
32 Ga0070659_100165797 3300005366 Bacteria 1808
33 Ga0070667_100005034 3300005367 Bacteria 11058
34 Ga0070667_100020528 3300005367 Bacteria 5485
35 Ga0070667_100048426 3300005367 Bacteria 3577
36 Ga0070703_10022795 3300005406 Bacteria 1840
37 Ga0070709_10043314 3300005434 Bacteria 2783
38 Ga0070709_10317924 3300005434 Bacteria 1142
39 Ga0070714_100000907 3300005435 Bacteria 20951
40 Ga0070714_100161610 3300005435 Bacteria 2027
41 Ga0070713_100024026 3300005436 Bacteria 4741
42 Ga0070713_100274591 3300005436 Bacteria 1545
43 Ga0070711_100136754 3300005439 Bacteria 1832
44 Ga0070708_100348695 3300005445 Bacteria 1395
45 Ga0070663_100119695 3300005455 Bacteria 1987
46 Ga0070663_100165476 3300005455 Bacteria 1705
47 Ga0070678_100011013 3300005456 Bacteria 5556
48 Ga0070662_100418389 3300005457 Bacteria 1108
49 Ga0070681_10013713 3300005458 Bacteria 8067
50 Ga0070681_10021019 3300005458 Bacteria 6539
51 Ga0070681_10039652 3300005458 Bacteria 4721
52 Ga0070681_10060262 3300005458 Bacteria 3773
53 Ga0070681_10236846 3300005458 Bacteria 1739
54 Ga0070681_10792465 3300005458 Bacteria 865
55 Ga0068867_100001642 3300005459 Bacteria 15531
56 Ga0068867_100028049 3300005459 Bacteria 4052
57 Ga0070706_100000025 3300005467 Bacteria 156371
58 Ga0070707_100148919 3300005468 Bacteria 2278
59 Ga0070679_100008661 3300005530 Bacteria 9586
60 Ga0070679_100019317 3300005530 Bacteria 6623
61 Ga0070679_100032622 3300005530 Bacteria 5153
62 Ga0070684_100031057 3300005535 Bacteria 4545
63 Ga0070684_100031806 3300005535 Bacteria 4494
64 Ga0070697_100363806 3300005536 Bacteria 1251
65 Ga0068853_100005415 3300005539 Bacteria 10002
66 Ga0068853_100331286 3300005539 Bacteria 1413
67 Ga0070672_100001696 3300005543 Bacteria 13754
68 Ga0070686_100026508 3300005544 Bacteria 3499
69 Ga0070693_100009090 3300005547 Bacteria 4932
70 Ga0070665_100001166 3300005548 Bacteria 32311
71 Ga0070665_100016646 3300005548 Bacteria 7369
72 Ga0068855_100001261 3300005563 Bacteria 31420
73 Ga0068855_100026942 3300005563 Bacteria 6878
74 Ga0068855_100035818 3300005563 Bacteria 5910
75 Ga0070664_100001374 3300005564 Bacteria 19392
76 Ga0068854_100014241 3300005578 Bacteria 5238
77 Ga0068856_101011246 3300005614 Bacteria 849
78 Ga0070702_100023072 3300005615 Bacteria 3301
79 Ga0068852_100003496 3300005616 Bacteria 10984
80 Ga0068852_100190205 3300005616 Bacteria 1936
81 Ga0068859_100002054 3300005617 Bacteria 20554
82 Ga0068859_100062611 3300005617 Bacteria 3750
83 Ga0068859_100503778 3300005617 Bacteria 1306
84 Ga0068864_100000613 3300005618 Bacteria 30125
85 Ga0068864_100002502 3300005618 Bacteria 15196
86 Ga0068861_100032999 3300005719 Bacteria 3816
87 Ga0068861_100134140 3300005719 Bacteria 2013
88 Ga0068861_100141362 3300005719 Bacteria 1965
89 Ga0068851_10130876 3300005834 Bacteria 1357
90 Ga0068863_100002665 3300005841 Bacteria 17651
91 Ga0068863_100057817 3300005841 Bacteria 3670
92 Ga0068863_100206523 3300005841 Bacteria 1890
93 Ga0068863_100401452 3300005841 Bacteria 1341
94 Ga0068858_100004520 3300005842 Bacteria 13638
95 Ga0068858_100061667 3300005842 Bacteria 3467
96 Ga0068858_100066124 3300005842 Bacteria 3346
97 Ga0068858_100130275 3300005842 Bacteria 2358
98 Ga0068860_100003039 3300005843 Bacteria 17319
99 Ga0068862_100006717 3300005844 Bacteria 9543
100 Ga0068862_100103917 3300005844 Bacteria 2488
101 Ga0081539_10050721 3300005985 Bacteria 2346
102 Ga0070717_10014990 3300006028 Bacteria 5971
103 Ga0075365_10160986 3300006038 Bacteria 1564
104 Ga0070715_10026240 3300006163 Unclassified 2316
105 Ga0070716_100024008 3300006173 Bacteria 3241
106 Ga0070716_100033397 3300006173 Bacteria 2814
107 Ga0070712_100131016 3300006175 Bacteria 1900
108 Ga0097621_100004867 3300006237 Bacteria 9411
109 Ga0068871_100001733 3300006358 Bacteria 14694
110 Ga0075428_100114014 3300006844 Bacteria 2945
111 Ga0075433_10157192 3300006852 Bacteria 2023
112 Ga0075434_100172235 3300006871 Bacteria 2185
113 Ga0068865_100023973 3300006881 Bacteria 4000
114 Ga0068865_100059936 3300006881 Bacteria 2663
115 Ga0068865_100158104 3300006881 Bacteria 1726
116 Ga0097620_100002054 3300006931 Bacteria 20554
117 Ga0097620_100006397 3300006931 Bacteria 11951
118 Ga0097620_100062611 3300006931 Bacteria 3750
119 Ga0097620_100503761 3300006931 Bacteria 1306
120 Ga0099794_10002241 3300007265 Bacteria 7077
121 Ga0105240_10000085 3300009093 Bacteria 189341
122 Ga0105240_10010005 3300009093 Bacteria 13361
123 Ga0105240_10015177 3300009093 Bacteria 10485
124 Ga0105240_10176930 3300009093 Bacteria 2522
125 Ga0105240_10541544 3300009093 Bacteria 1289
126 Ga0105240_11021969 3300009093 Bacteria 883
127 Ga0111539_10043773 3300009094 Bacteria 5367
128 Ga0111539_10131605 3300009094 Bacteria 2929
129 Ga0105245_10030840 3300009098 Bacteria 4741
130 Ga0105245_10034531 3300009098 Bacteria 4486
131 Ga0105245_10153378 3300009098 Bacteria 2180
132 Ga0105245_10311603 3300009098 Bacteria 1548
133 Ga0114129_10004635 3300009147 Bacteria 19400
134 Ga0105243_10043004 3300009148 Bacteria 3540
135 Ga0105243_10254838 3300009148 Bacteria 1568
136 Ga0105248_10016212 3300009177 Bacteria 8201
137 Ga0105248_10023288 3300009177 Bacteria 6878
138 Ga0105248_10606474 3300009177 Bacteria 1235
139 Ga0105237_10018125 3300009545 Bacteria 7290
140 Ga0105237_10025942 3300009545 Bacteria 5991
141 Ga0105237_10203401 3300009545 Bacteria 1981
142 Ga0105238_10005011 3300009551 Bacteria 13089
143 Ga0105238_10188306 3300009551 Bacteria 2040
144 Ga0105238_10262862 3300009551 Bacteria 1705
145 Ga0105239_10000381 3300010375 Bacteria 64672
146 Ga0105239_10206195 3300010375 Bacteria 2203
147 Ga0105239_10392876 3300010375 Bacteria 1569
148 Ga0157342_1015203 3300012507 Bacteria 840
149 Ga0157371_10191225 3300013102 Bacteria 1465
150 Ga0157370_10001215 3300013104 Bacteria 32262
151 Ga0157370_10003299 3300013104 Bacteria 19024
152 Ga0157370_10008587 3300013104 Bacteria 11001
153 Ga0157370_10487154 3300013104 Bacteria 1133
154 Ga0157370_10583589 3300013104 Bacteria 1024
155 Ga0157369_10011912 3300013105 Bacteria 9876
156 Ga0157369_10026580 3300013105 Bacteria 6419
157 Ga0157374_10008322 3300013296 Bacteria 8853
158 Ga0157374_10052178 3300013296 Bacteria 3808
159 Ga0157374_10510951 3300013296 Bacteria 1207
160 Ga0163162_10003019 3300013306 Bacteria 16081
161 Ga0163162_10487913 3300013306 Bacteria 1363
162 Ga0163162_10496222 3300013306 Bacteria 1351
163 Ga0163162_10516440 3300013306 Bacteria 1324
164 Ga0157372_10023566 3300013307 Bacteria 6675
165 Ga0157375_10411405 3300013308 Bacteria 1519
166 Ga0163163_10086457 3300014325 Bacteria 3145
167 Ga0157380_10125785 3300014326 Bacteria 2179
168 Ga0157377_10113842 3300014745 Bacteria 1630
169 Ga0157379_10011216 3300014968 Bacteria 7808
170 Ga0157376_10067119 3300014969 Bacteria 3033
171 Ga0157376_10150566 3300014969 Bacteria 2098
172 Ga0163161_10112427 3300017792 Bacteria 2037
173 Ga0163161_10150083 3300017792 Bacteria 1771
174 Ga0209563_102348 3300025230 Bacteria 4324
175 Ga0207697_10014150 3300025315 Bacteria 3316
176 Ga0207653_10000659 3300025885 Bacteria 11877
177 Ga0207642_10074147 3300025899 Bacteria 1630
178 Ga0207688_10017375 3300025901 Bacteria 3908
179 Ga0207680_10025115 3300025903 Bacteria 3282
180 Ga0207680_10207955 3300025903 Bacteria 1337
181 Ga0207680_10307890 3300025903 Bacteria 1105
182 Ga0207685_10082804 3300025905 Bacteria 1332
183 Ga0207645_10000097 3300025907 Bacteria 64388
184 Ga0207645_10150584 3300025907 Bacteria 1518
185 Ga0207705_10075394 3300025909 Bacteria 2450
186 Ga0207684_10000063 3300025910 Bacteria 196933
187 Ga0207684_10000072 3300025910 Bacteria 185716
188 Ga0207707_10007903 3300025912 Bacteria 9251
189 Ga0207707_10068222 3300025912 Bacteria 3098
190 Ga0207695_10000003 3300025913 Bacteria 1368691
191 Ga0207671_10023865 3300025914 Bacteria 4607
192 Ga0207671_10051862 3300025914 Bacteria 3039
193 Ga0207693_10002359 3300025915 Bacteria 16393
194 Ga0207693_10230832 3300025915 Bacteria 1453
195 Ga0207663_10042166 3300025916 Bacteria 2787
196 Ga0207660_10003146 3300025917 Bacteria 10803
197 Ga0207657_10011545 3300025919 Bacteria 8768
198 Ga0207657_10467470 3300025919 Bacteria 989
199 Ga0207649_10068111 3300025920 Bacteria 2262
200 Ga0207652_10003071 3300025921 Bacteria 13937
201 Ga0207646_10049414 3300025922 Bacteria 3767
202 Ga0207646_10070499 3300025922 Bacteria 3122
203 Ga0207681_10051172 3300025923 Bacteria 2797
204 Ga0207681_10203432 3300025923 Bacteria 1522
205 Ga0207694_10049364 3300025924 Bacteria 3258
206 Ga0207694_10217242 3300025924 Bacteria 1559
207 Ga0207650_10001752 3300025925 Bacteria 15406
208 Ga0207650_10019928 3300025925 Bacteria 4721
209 Ga0207650_10158501 3300025925 Bacteria 1791
210 Ga0207650_10268741 3300025925 Bacteria 1385
211 Ga0207659_10008567 3300025926 Bacteria 6357
212 Ga0207700_10024546 3300025928 Bacteria 4174
213 Ga0207700_10202136 3300025928 Bacteria 1675
214 Ga0207700_10410795 3300025928 Bacteria 1187
215 Ga0207664_10010932 3300025929 Bacteria 6427
216 Ga0207664_10486723 3300025929 Bacteria 1104
217 Ga0207644_10046231 3300025931 Bacteria 3100
218 Ga0207686_10079823 3300025934 Bacteria 2132
219 Ga0207686_10304260 3300025934 Bacteria 1185
220 Ga0207704_10141197 3300025938 Bacteria 1685
221 Ga0207665_10019453 3300025939 Bacteria 4464
222 Ga0207665_10387320 3300025939 Bacteria 1062
223 Ga0207691_10000327 3300025940 Bacteria 47338
224 Ga0207711_10013222 3300025941 Bacteria 6857
225 Ga0207711_10187408 3300025941 Bacteria 1884
226 Ga0207711_10283045 3300025941 Bacteria 1527
227 Ga0207689_10029346 3300025942 Bacteria 4594
228 Ga0207689_10122879 3300025942 Bacteria 2135
229 Ga0207689_10245021 3300025942 Bacteria 1482
230 Ga0207679_10100374 3300025945 Bacteria 2262
231 Ga0207679_10220236 3300025945 Bacteria 1596
232 Ga0207667_10000116 3300025949 Bacteria 128218
233 Ga0207651_10009142 3300025960 Bacteria 5399
234 Ga0207651_10021827 3300025960 Bacteria 3900
235 Ga0207712_10067783 3300025961 Bacteria 2555
236 Ga0207640_10122280 3300025981 Bacteria 1867
237 Ga0207640_10148937 3300025981 Bacteria 1717
238 Ga0207658_10005177 3300025986 Bacteria 8977
239 Ga0207658_10017684 3300025986 Bacteria 4916
240 Ga0207658_10069409 3300025986 Bacteria 2662
241 Ga0207677_10013067 3300026023 Bacteria 4797
242 Ga0207677_10032018 3300026023 Bacteria 3375
243 Ga0207677_10151307 3300026023 Bacteria 1791
244 Ga0207677_10374843 3300026023 Bacteria 1199
245 Ga0207677_10453154 3300026023 Bacteria 1100
246 Ga0207677_10821044 3300026023 Bacteria 833
247 Ga0207703_10064763 3300026035 Bacteria 3001
248 Ga0207703_10106045 3300026035 Bacteria 2390
249 Ga0207703_10167083 3300026035 Bacteria 1932
250 Ga0207703_10340031 3300026035 Bacteria 1379
251 Ga0207639_10348603 3300026041 Bacteria 1322
252 Ga0207678_10127480 3300026067 Bacteria 2171
253 Ga0207678_10203138 3300026067 Bacteria 1695
254 Ga0207708_10002344 3300026075 Bacteria 13905
255 Ga0207702_10314217 3300026078 Bacteria 1490
256 Ga0207641_10028361 3300026088 Bacteria 4625
257 Ga0207641_10099336 3300026088 Bacteria 2561
258 Ga0207648_10000426 3300026089 Bacteria 46419
259 Ga0207648_10208742 3300026089 Bacteria 1733
260 Ga0207648_10427906 3300026089 Bacteria 1203
261 Ga0207676_10077739 3300026095 Bacteria 2685
262 Ga0207676_10185073 3300026095 Bacteria 1827
263 Ga0207675_100002354 3300026118 Bacteria 18699
264 Ga0207675_100039462 3300026118 Bacteria 4406
265 Ga0207675_100164471 3300026118 Bacteria 2118
266 Ga0207675_100173042 3300026118 Bacteria 2065
267 Ga0207683_10000273 3300026121 Bacteria 46113
268 Ga0207698_10043097 3300026142 Bacteria 3378
269 Ga0207698_10244111 3300026142 Bacteria 1639
270 Ga0207428_10205340 3300027907 Bacteria 1482
271 Ga0268266_10012153 3300028379 Bacteria 7451
272 Ga0268266_10067043 3300028379 Bacteria 3105
273 Ga0268265_10125346 3300028380 Bacteria 2124
274 Ga0268265_10234838 3300028380 Bacteria 1614
275 Ga0268264_10014938 3300028381 Bacteria 6376
276 Ga0268264_10133116 3300028381 Bacteria 2207
277 Ga0268264_10468429 3300028381 Bacteria 1223
278 Ga0268264_10621354 3300028381 Bacteria 1067
279 Ga0265338_10204634 3300028800 Bacteria 1486
280 Ga0265338_10347874 3300028800 Bacteria 1067
281 Ga0265324_10044109 3300029957 Bacteria 1538
282 Ga0265320_10014274 3300031240 Bacteria 4528
283 Ga0265340_10052677 3300031247 Bacteria 1967
284 Ga0265331_10008083 3300031250 Bacteria 6009
285 Ga0265316_10000651 3300031344 Bacteria 38560
286 Ga0265314_10179166 3300031711 Bacteria 1272
287 Ga0326468_10006837 3300031889 Bacteria 1066
288 Ga0307415_100001722 3300032126 Bacteria 10643
289 Ga0307510_10158978 3300033180 Bacteria 1860
290 Ga0373960_0054170 3300035121 Bacteria 1199
291 Ga0316574_0237752 3300035398 Bacteria 1165
292 Ga0373931_0240766 3300035691 Bacteria 1097
293 Ga0373927_0100431 3300035695 Bacteria 1881
294 Ga0373933_0165837 3300035724 Bacteria 1404
295 Ga0373947_0074796 3300035725 Bacteria 2085
296 Ga0373937_0016489 3300036401 Bacteria 6563
297 Ga0373925_0002903 3300037068 Bacteria 13525
298 Ga0395899_0000044 3300037312 Bacteria 248735
299 Ga0395900_0000042 3300037418 Bacteria 242667
300 Ga0395898_0000080 3300037466 Bacteria 242667
301 Ga0395905_0000044 3300037471 Bacteria 242916
302 Ga0395905_0021169 3300037471 Bacteria 6156
303 Ga0395901_0000027 3300038443 Bacteria 244204
304 Ga0436365_0747596 3300039437 Bacteria 1394
305 Ga0439449_0139633 3300042007 Bacteria 902
306 Ga0451577_0005641 3300042876 Bacteria 12717
307 Ga0451577_0068778 3300042876 Bacteria 3158
308 Ga0453683_0166429 3300044673 Bacteria 1396
309 Ga0453684_0000841 3300044712 Bacteria 103501
310 Ga0453684_0154651 3300044712 Bacteria 2721
311 Ga0466959_0073112 3300045049 Bacteria 2481
312 Ga0451576_0009034 3300045051 Bacteria 11607
313 Ga0466967_0601827 3300045976 Bacteria 1085
314 Ga0495592_0048388 3300046454 Bacteria 3163
315 Ga0495651_0142604 3300046462 Bacteria 1735
316 Ga0495653_0032468 3300046463 Bacteria 4144
317 Ga0495650_0000018 3300046471 Bacteria 538888
318 Ga0495662_0157993 3300046476 Bacteria 1117
319 Ga0495608_0003409 3300046511 Bacteria 11389
320 Ga0495618_0073679 3300046514 Bacteria 2174
321 Ga0495643_0010116 3300046522 Bacteria 5816
322 Ga0495652_0335743 3300046529 Bacteria 1087
323 Ga0495640_0034338 3300046533 Bacteria 3598
324 Ga0495587_0136821 3300046536 Bacteria 1399
325 Ga0495645_0124646 3300046543 Bacteria 1811
326 Ga0495645_0232839 3300046543 Bacteria 1233
327 Ga0495667_0003850 3300046559 Bacteria 10074
328 Ga0495667_0346798 3300046559 Bacteria 938
329 Ga0495634_0107372 3300046642 Bacteria 1798
330 Ga0495635_0008980 3300046663 Bacteria 6976
331 Ga0495661_0003924 3300046665 Bacteria 10856
332 Ga0495657_0051737 3300046675 Bacteria 2757
333 Ga0495657_0160164 3300046675 Bacteria 1393
334 Ga0495623_0018544 3300046679 Bacteria 4494
335 Ga0495646_0003120 3300046680 Bacteria 10278
336 Ga0495613_0151545 3300046689 Bacteria 1653
337 Ga0495600_0017593 3300046809 Bacteria 4549
338 Ga0495581_0110059 3300047315 Bacteria 1602
339 Ga0495604_0006432 3300047317 Bacteria 9322
340 Ga0495674_0016831 3300047319 Bacteria 6818
341 Ga0495674_0069119 3300047319 Bacteria 3055
342 Ga0495674_0224184 3300047319 Bacteria 1553
343 Ga0495680_0046568 3300047322 Bacteria 3418
344 Ga0495687_003696 3300047443 Bacteria 10874
345 Ga0495675_0075778 3300047444 Bacteria 2120
346 Ga0495602_0017602 3300048088 Bacteria 7160
347 Ga0496101_0337810 3300048904 Bacteria 1183
348 Ga0496102_0063941 3300048905 Bacteria 3370
349 Ga0496102_0224635 3300048905 Bacteria 1770
350 Ga0496102_0476808 3300048905 Bacteria 1169
351 Ga0496104_0002404 3300048907 Bacteria 16117
352 Ga0496104_0077368 3300048907 Bacteria 3170
353 Ga0496105_0069959 3300048908 Bacteria 2901
354 Ga0496106_0056724 3300048909 Bacteria 2961
355 Ga0496106_0631014 3300048909 Bacteria 857
356 Ga0496107_0046856 3300048910 Bacteria 3112
357 Ga0496107_0317258 3300048910 Bacteria 1160
358 Ga0496109_0064433 3300048912 Bacteria 3354
359 Ga0496109_0369309 3300048912 Bacteria 1355
360 Ga0496110_0172679 3300048913 Bacteria 1961
361 Ga0496110_0185885 3300048913 Bacteria 1887
362 Ga0496110_0471042 3300048913 Bacteria 1144
363 Ga0496114_0028963 3300048917 Bacteria 4549
364 Ga0496119_0001511 3300048922 Bacteria 27813
365 Ga0496122_0005927 3300048925 Bacteria 14303
366 Ga0496122_0081181 3300048925 Bacteria 2258
367 Ga0496123_0000792 3300048926 Bacteria 51045
368 Ga0496125_0183016 3300048928 Bacteria 1393
369 Ga0495682_0002300 3300049460 Bacteria 9120
370 Ga0501031_0025706 3300049568 Bacteria 3840
371 Ga0501032_0118802 3300049569 Bacteria 1748
372 Ga0501032_0126839 3300049569 Bacteria 1685
373 Ga0501033_0040650 3300049570 Bacteria 3471
374 Ga0501034_0004787 3300049571 Bacteria 14971
375 Ga0501034_0124552 3300049571 Bacteria 2562
376 Ga0501034_0381695 3300049571 Bacteria 1334
377 Ga0501036_0020555 3300049572 Bacteria 5544
378 Ga0501037_0158110 3300049573 Bacteria 1616
379 Ga0501037_0206633 3300049573 Bacteria 1386
380 Ga0501038_0025422 3300049574 Bacteria 5278
381 Ga0501039_0063133 3300049575 Bacteria 2870
382 Ga0501039_0309125 3300049575 Bacteria 1242
383 Ga0501042_0002188 3300049578 Bacteria 11923
384 Ga0501043_0125058 3300049579 Bacteria 2016
385 Ga0501043_0231735 3300049579 Bacteria 1426
386 Ga0501046_0003878 3300049580 Bacteria 13680
387 Ga0501046_0119187 3300049580 Bacteria 2009
388 Ga0501046_0292903 3300049580 Bacteria 1190
389 Ga0501047_0001576 3300049581 Bacteria 22267
390 Ga0501047_0058228 3300049581 Bacteria 3732
391 Ga0501047_0060020 3300049581 Bacteria 3671
392 Ga0501067_0000855 3300049583 Bacteria 16420
393 Ga0501067_0009581 3300049583 Bacteria 5364
394 Ga0501068_0002310 3300049584 Bacteria 10161
395 Ga0501068_0137907 3300049584 Bacteria 1528
396 Ga0501069_0003760 3300049585 Bacteria 7803
397 Ga0501069_0030501 3300049585 Bacteria 2961
398 Ga0501070_0003737 3300049586 Bacteria 13143
399 Ga0501072_0014867 3300049588 Bacteria 5966
400 Ga0501073_0000326 3300049589 Bacteria 31963
401 Ga0501073_0029505 3300049589 Bacteria 3919
402 Ga0501073_0037948 3300049589 Bacteria 3419
403 Ga0501074_0000161 3300049590 Bacteria 35505
404 Ga0501074_0026688 3300049590 Bacteria 4187
405 Ga0501076_0124907 3300049592 Bacteria 2085
406 Ga0501076_0233132 3300049592 Bacteria 1505
407 Ga0501079_0238740 3300049741 Bacteria 1420
408 Ga0501079_0305589 3300049741 Bacteria 1244
409 Ga0501080_0000713 3300049742 Bacteria 26727
410 Ga0501080_0022235 3300049742 Bacteria 5874
411 Ga0501083_0000202 3300049744 Bacteria 38376
412 Ga0501083_0083188 3300049744 Bacteria 2120
413 Ga0501035_0004618 3300049822 Bacteria 13059
414 Ga0501035_0010215 3300049822 Bacteria 8712
415 Ga0501035_0321027 3300049822 Bacteria 1301
416 Ga0501044_0062945 3300049823 Bacteria 3791
417 Ga0501044_0239058 3300049823 Bacteria 1760
418 Ga0501045_0012731 3300049824 Bacteria 5925
419 nmdc:mga0k408_191138_c1 3300050493 Bacteria 1221
420 nmdc:mga05p37_2781_c1 3300050507 Bacteria 20350
421 nmdc:mga06r32_133970_c1 3300050510 Bacteria 2452
422 nmdc:mga08y16_157779_c1 3300050511 Bacteria 2358
423 nmdc:mga08y16_412674_c1 3300050511 Bacteria 1381
424 nmdc:mga0n895_212665_c1 3300050512 Bacteria 1964
425 nmdc:mga0a205_177819_c1 3300050515 Unclassified 2023
426 nmdc:mga0a205_9430_c1 3300050515 Bacteria 6759
427 Ga0495612_0060723 3300053078 Bacteria 1565
428 Ga0495595_0020746 3300053084 Bacteria 2862
429 Ga0495595_0021701 3300053084 Bacteria 2808
430 Ga0495619_0022654 3300053085 Bacteria 4022
431 Ga0495619_0025460 3300053085 Bacteria 3800
432 Ga0500556_0000155 3300053104 Bacteria 57500
433 Ga0500624_006223 3300053157 Bacteria 1610
434 Ga0500634_0000019 3300053161 Bacteria 109764
435 Ga0500634_0135305 3300053161 Bacteria 1176
436 Ga0500645_034082 3300053730 Bacteria 1521
437 Ga0501084_0000771 3300054114 Bacteria 24363
438 Ga0501084_0008592 3300054114 Bacteria 8445
439 Ga0501082_0000764 3300060353 Bacteria 28162
440 Ga0501082_0160234 3300060353 Bacteria 1955
441 2508734889 2508501050 Bacteria 9633614
442 2509078623 2508501114 Bacteria 7082538
443 2545672556 2545555834 Bacteria 8130841
444 2643814635 2643221558 Bacteria 5460675
445 2687239739 2684623219 Bacteria 8442773
446 2776259270 2775506901 Bacteria 9631051
447 2827630834 2827628540 Bacteria 6858585
448 2835316580 2835312727 Bacteria 7413381
449 2842265267 2842264693 Bacteria 6472963
450 2842428680 2842428310 Bacteria 6767288
451 2842435293 2842434925 Bacteria 6502746
452 2842441844 2842441272 Bacteria 6769273
453 2842463104 2842462802 Bacteria 6588055
454 2842469624 2842469257 Bacteria 6752936
455 2919451177 2919450847 Bacteria 5631160
456 3002141965 3002141150 Bacteria 5254435
457 641644324 641522639 Bacteria 7737025
458 8001848640 8001845381 Bacteria 5804942
459 Ga0157380_10240834
460 Ga0070676_10001919
461 Ga0070683_100079079
462 Ga0070690_100149786
463 Ga0070670_100000942
464 Ga0070670_100119509
465 Ga0070670_100324426
466 Ga0068869_100162242
467 Ga0070666_10000980
468 Ga0070666_10001480
469 Ga0070680_100002207
470 Ga0068868_100008656
471 Ga0068868_100031507
472 Ga0068868_100039202
473 Ga0068868_100518586
474 Ga0070660_100017052
475 Ga0070689_100087994
476 Ga0070687_100254601
477 Ga0070661_100002539
478 Ga0070661_100005214
479 Ga0070661_100014138
480 Ga0070661_100218494
481 Ga0070692_10010952
482 Ga0070668_100002148
483 Ga0070669_100000902
484 Ga0070675_100005393
485 Ga0070675_100012086
486 Ga0070671_100025620
487 Ga0070671_100027700
488 Ga0070673_100008859
489 Ga0070673_100029541
490 Ga0070659_100165797
491 Ga0070667_100005034
492 Ga0070667_100020528
493 Ga0070667_100048426
494 Ga0070703_10022795
495 Ga0070709_10043314
496 Ga0070709_10317924
497 Ga0070714_100000907
498 Ga0070714_100161610
499 Ga0070713_100024026
500 Ga0070713_100274591
501 Ga0070711_100136754
502 Ga0070708_100348695
503 Ga0070663_100119695
504 Ga0070663_100165476
505 Ga0070678_100011013
506 Ga0070662_100418389
507 Ga0070681_10013713
508 Ga0070681_10021019
509 Ga0070681_10039652
510 Ga0070681_10060262
511 Ga0070681_10236846
512 Ga0070681_10792465
513 Ga0068867_100001642
514 Ga0068867_100028049
515 Ga0070706_100000025
516 Ga0070707_100148919
517 Ga0070679_100008661
518 Ga0070679_100019317
519 Ga0070679_100032622
520 Ga0070684_100031057
521 Ga0070684_100031806
522 Ga0070697_100363806
523 Ga0068853_100005415
524 Ga0068853_100331286
525 Ga0070672_100001696
526 Ga0070686_100026508
527 Ga0070693_100009090
528 Ga0070665_100001166
529 Ga0070665_100016646
530 Ga0068855_100001261
531 Ga0068855_100026942
532 Ga0068855_100035818
533 Ga0070664_100001374
534 Ga0068854_100014241
535 Ga0068856_101011246
536 Ga0070702_100023072
537 Ga0068852_100003496
538 Ga0068852_100190205
539 Ga0068859_100002054
540 Ga0068859_100062611
541 Ga0068859_100503778
542 Ga0068864_100000613
543 Ga0068864_100002502
544 Ga0068861_100032999
545 Ga0068861_100134140
546 Ga0068861_100141362
547 Ga0068851_10130876
548 Ga0068863_100002665
549 Ga0068863_100057817
550 Ga0068863_100206523
551 Ga0068863_100401452
552 Ga0068858_100004520
553 Ga0068858_100061667
554 Ga0068858_100066124
555 Ga0068858_100130275
556 Ga0068860_100003039
557 Ga0068862_100006717
558 Ga0068862_100103917
559 Ga0081539_10050721
560 Ga0070717_10014990
561 Ga0075365_10160986
562 Ga0070715_10026240
563 Ga0070716_100024008
564 Ga0070716_100033397
565 Ga0070712_100131016
566 Ga0097621_100004867
567 Ga0068871_100001733
568 Ga0075428_100114014
569 Ga0075433_10157192
570 Ga0075434_100172235
571 Ga0068865_100023973
572 Ga0068865_100059936
573 Ga0068865_100158104
574 Ga0097620_100002054
575 Ga0097620_100006397
576 Ga0097620_100062611
577 Ga0097620_100503761
578 Ga0099794_10002241
579 Ga0105240_10000085
580 Ga0105240_10010005
581 Ga0105240_10015177
582 Ga0105240_10176930
583 Ga0105240_10541544
584 Ga0105240_11021969
585 Ga0111539_10043773
586 Ga0111539_10131605
587 Ga0105245_10030840
588 Ga0105245_10034531
589 Ga0105245_10153378
590 Ga0105245_10311603
591 Ga0114129_10004635
592 Ga0105243_10043004
593 Ga0105243_10254838
594 Ga0105248_10016212
595 Ga0105248_10023288
596 Ga0105248_10606474
597 Ga0105237_10018125
598 Ga0105237_10025942
599 Ga0105237_10203401
600 Ga0105238_10005011
601 Ga0105238_10188306
602 Ga0105238_10262862
603 Ga0105239_10000381
604 Ga0105239_10206195
605 Ga0105239_10392876
606 Ga0157342_1015203
607 Ga0157371_10191225
608 Ga0157370_10001215
609 Ga0157370_10003299
610 Ga0157370_10008587
611 Ga0157370_10487154
612 Ga0157370_10583589
613 Ga0157369_10011912
614 Ga0157369_10026580
615 Ga0157374_10008322
616 Ga0157374_10052178
617 Ga0157374_10510951
618 Ga0163162_10003019
619 Ga0163162_10487913
620 Ga0163162_10496222
621 Ga0163162_10516440
622 Ga0157372_10023566
623 Ga0157375_10411405
624 Ga0163163_10086457
625 Ga0157380_10125785
626 Ga0157377_10113842
627 Ga0157379_10011216
628 Ga0157376_10067119
629 Ga0157376_10150566
630 Ga0163161_10112427
631 Ga0163161_10150083
632 Ga0209563_102348
633 Ga0207697_10014150
634 Ga0207653_10000659
635 Ga0207642_10074147
636 Ga0207688_10017375
637 Ga0207680_10025115
638 Ga0207680_10207955
639 Ga0207680_10307890
640 Ga0207685_10082804
641 Ga0207645_10000097
642 Ga0207645_10150584
643 Ga0207705_10075394
644 Ga0207684_10000063
645 Ga0207684_10000072
646 Ga0207707_10007903
647 Ga0207707_10068222
648 Ga0207695_10000003
649 Ga0207671_10023865
650 Ga0207671_10051862
651 Ga0207693_10002359
652 Ga0207693_10230832
653 Ga0207663_10042166
654 Ga0207660_10003146
655 Ga0207657_10011545
656 Ga0207657_10467470
657 Ga0207649_10068111
658 Ga0207652_10003071
659 Ga0207646_10049414
660 Ga0207646_10070499
661 Ga0207681_10051172
662 Ga0207681_10203432
663 Ga0207694_10049364
664 Ga0207694_10217242
665 Ga0207650_10001752
666 Ga0207650_10019928
667 Ga0207650_10158501
668 Ga0207650_10268741
669 Ga0207659_10008567
670 Ga0207700_10024546
671 Ga0207700_10202136
672 Ga0207700_10410795
673 Ga0207664_10010932
674 Ga0207664_10486723
675 Ga0207644_10046231
676 Ga0207686_10079823
677 Ga0207686_10304260
678 Ga0207704_10141197
679 Ga0207665_10019453
680 Ga0207665_10387320
681 Ga0207691_10000327
682 Ga0207711_10013222
683 Ga0207711_10187408
684 Ga0207711_10283045
685 Ga0207689_10029346
686 Ga0207689_10122879
687 Ga0207689_10245021
688 Ga0207679_10100374
689 Ga0207679_10220236
690 Ga0207667_10000116
691 Ga0207651_10009142
692 Ga0207651_10021827
693 Ga0207712_10067783
694 Ga0207640_10122280
695 Ga0207640_10148937
696 Ga0207658_10005177
697 Ga0207658_10017684
698 Ga0207658_10069409
699 Ga0207677_10013067
700 Ga0207677_10032018
701 Ga0207677_10151307
702 Ga0207677_10374843
703 Ga0207677_10453154
704 Ga0207677_10821044
705 Ga0207703_10064763
706 Ga0207703_10106045
707 Ga0207703_10167083
708 Ga0207703_10340031
709 Ga0207639_10348603
710 Ga0207678_10127480
711 Ga0207678_10203138
712 Ga0207708_10002344
713 Ga0207702_10314217
714 Ga0207641_10028361
715 Ga0207641_10099336
716 Ga0207648_10000426
717 Ga0207648_10208742
718 Ga0207648_10427906
719 Ga0207676_10077739
720 Ga0207676_10185073
721 Ga0207675_100002354
722 Ga0207675_100039462
723 Ga0207675_100164471
724 Ga0207675_100173042
725 Ga0207683_10000273
726 Ga0207698_10043097
727 Ga0207698_10244111
728 Ga0207428_10205340
729 Ga0268266_10012153
730 Ga0268266_10067043
731 Ga0268265_10125346
732 Ga0268265_10234838
733 Ga0268264_10014938
734 Ga0268264_10133116
735 Ga0268264_10468429
736 Ga0268264_10621354
737 Ga0265338_10204634
738 Ga0265338_10347874
739 Ga0265324_10044109
740 Ga0265320_10014274
741 Ga0265340_10052677
742 Ga0265331_10008083
743 Ga0265316_10000651
744 Ga0265314_10179166
745 Ga0326468_10006837
746 Ga0307415_100001722
747 Ga0307510_10158978
748 Ga0373960_0054170
749 Ga0316574_0237752
750 Ga0373931_0240766
751 Ga0373927_0100431
752 Ga0373933_0165837
753 Ga0373947_0074796
754 Ga0373937_0016489
755 Ga0373925_0002903
756 Ga0395899_0000044
757 Ga0395900_0000042
758 Ga0395898_0000080
759 Ga0395905_0000044
760 Ga0395905_0021169
761 Ga0395901_0000027
762 Ga0436365_0747596
763 Ga0439449_0139633
764 Ga0451577_0005641
765 Ga0451577_0068778
766 Ga0453683_0166429
767 Ga0453684_0000841
768 Ga0453684_0154651
769 Ga0466959_0073112
770 Ga0451576_0009034
771 Ga0466967_0601827
772 Ga0495592_0048388
773 Ga0495651_0142604
774 Ga0495653_0032468
775 Ga0495650_0000018
776 Ga0495662_0157993
777 Ga0495608_0003409
778 Ga0495618_0073679
779 Ga0495643_0010116
780 Ga0495652_0335743
781 Ga0495640_0034338
782 Ga0495587_0136821
783 Ga0495645_0124646
784 Ga0495645_0232839
785 Ga0495667_0003850
786 Ga0495667_0346798
787 Ga0495634_0107372
788 Ga0495635_0008980
789 Ga0495661_0003924
790 Ga0495657_0051737
791 Ga0495657_0160164
792 Ga0495623_0018544
793 Ga0495646_0003120
794 Ga0495613_0151545
795 Ga0495600_0017593
796 Ga0495581_0110059
797 Ga0495604_0006432
798 Ga0495674_0016831
799 Ga0495674_0069119
800 Ga0495674_0224184
801 Ga0495680_0046568
802 Ga0495687_003696
803 Ga0495675_0075778
804 Ga0495602_0017602
805 Ga0496101_0337810
806 Ga0496102_0063941
807 Ga0496102_0224635
808 Ga0496102_0476808
809 Ga0496104_0002404
810 Ga0496104_0077368
811 Ga0496105_0069959
812 Ga0496106_0056724
813 Ga0496106_0631014
814 Ga0496107_0046856
815 Ga0496107_0317258
816 Ga0496109_0064433
817 Ga0496109_0369309
818 Ga0496110_0172679
819 Ga0496110_0185885
820 Ga0496110_0471042
821 Ga0496114_0028963
822 Ga0496119_0001511
823 Ga0496122_0005927
824 Ga0496122_0081181
825 Ga0496123_0000792
826 Ga0496125_0183016
827 Ga0495682_0002300
828 Ga0501031_0025706
829 Ga0501032_0118802
830 Ga0501032_0126839
831 Ga0501033_0040650
832 Ga0501034_0004787
833 Ga0501034_0124552
834 Ga0501034_0381695
835 Ga0501036_0020555
836 Ga0501037_0158110
837 Ga0501037_0206633
838 Ga0501038_0025422
839 Ga0501039_0063133
840 Ga0501039_0309125
841 Ga0501042_0002188
842 Ga0501043_0125058
843 Ga0501043_0231735
844 Ga0501046_0003878
845 Ga0501046_0119187
846 Ga0501046_0292903
847 Ga0501047_0001576
848 Ga0501047_0058228
849 Ga0501047_0060020
850 Ga0501067_0000855
851 Ga0501067_0009581
852 Ga0501068_0002310
853 Ga0501068_0137907
854 Ga0501069_0003760
855 Ga0501069_0030501
856 Ga0501070_0003737
857 Ga0501072_0014867
858 Ga0501073_0000326
859 Ga0501073_0029505
860 Ga0501073_0037948
861 Ga0501074_0000161
862 Ga0501074_0026688
863 Ga0501076_0124907
864 Ga0501076_0233132
865 Ga0501079_0238740
866 Ga0501079_0305589
867 Ga0501080_0000713
868 Ga0501080_0022235
869 Ga0501083_0000202
870 Ga0501083_0083188
871 Ga0501035_0004618
872 Ga0501035_0010215
873 Ga0501035_0321027
874 Ga0501044_0062945
875 Ga0501044_0239058
876 Ga0501045_0012731
877 nmdc:mga0k408_191138_c1
878 nmdc:mga05p37_2781_c1
879 nmdc:mga06r32_133970_c1
880 nmdc:mga08y16_157779_c1
881 nmdc:mga08y16_412674_c1
882 nmdc:mga0n895_212665_c1
883 nmdc:mga0a205_177819_c1
884 nmdc:mga0a205_9430_c1
885 Ga0495612_0060723
886 Ga0495595_0020746
887 Ga0495595_0021701
888 Ga0495619_0022654
889 Ga0495619_0025460
890 Ga0500556_0000155
891 Ga0500624_006223
892 Ga0500634_0000019
893 Ga0500634_0135305
894 Ga0500645_034082
895 Ga0501084_0000771
896 Ga0501084_0008592
897 Ga0501082_0000764
898 Ga0501082_0160234
899 2508734889
900 2509078623
901 2545672556
902 2643814635
903 2687239739
904 2776259270
905 2827630834
906 2835316580
907 2842265267
908 2842428680
909 2842435293
910 2842441844
911 2842463104
912 2842469624
913 2919451177
914 3002141965
915 641644324
916 8001848640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

234

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

261

0.9

PF08659

KR

KR domain

41

219

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9687 6 244
4dyv-assembly1.cif.gz_A crystal structure of a short-chain dehydrogenase/reductase sdr from xanthobacter autotrophicus py2 0.9598 6 244
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9407 6 252
4dry-assembly1.cif.gz_D the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9403 6 252
4dry-assembly1.cif.gz_A the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from rhizobium meliloti 0.9369 6 252
ID Description Score Start End Superfamily
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 6 240 3.40.50.720
4dyvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9478 6 240 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9408 6 241 3.40.50.720
4dryA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 6 252 3.40.50.720
af_P9WGS3_322_571_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9342 6 196 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5C7QR01-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9897 6 145
AF-A0A382N0H9-F1-model_v4 3-oxoacyl-ACP reductase 0.9777 1 223 GO:0016491
AF-A0A520G145-F1-model_v4 SDR family oxidoreductase 0.9723 2 224 GO:0016491
AF-A0A3C0Y7A3-F1-model_v4 3-oxoacyl-ACP reductase 0.9719 80 232 GO:0016491
AF-A0A536XAS5-F1-model_v4 SDR family oxidoreductase 0.967 1 252 GO:0016491

Map