F448202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 458 | 225 | 457 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300025917|Ga0207660_10314148|Ga0207660_103141483 |
| Length | 220 |
| Sequence | MTDSRVGQPLFFAKSLSAAQVARLVAGIEEALDVDVVEFTGDAGGDVMRWLLWLPLALFALIIAVVMSGLIHPASTDIRSQLVGKPLPEFALPAGVPSHPPLAKADLRGGPRLINIFASWCLPCAVEAPQLMVLKRAGVVIDGIAIRDRPEDLAAFLARYGDPYSRIGSDANSRVQLALGSSGVPESFVVDGRGVIRLQHIGDIREENIPTILAAIEAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 140 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 207 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 208 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 209 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 210 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 217 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 218 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 219 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 220 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 221 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 222 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 223 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 224 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 225 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.24 |
| Nodule | 0 |
| Rhizoplane | 2.18 |
| Rhizosphere | 87.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1008122 | 3300001915 | Bacteria | 1995 |
| 2 | JGI24741J21665_1009364 | 3300001915 | Bacteria | 1802 |
| 3 | JGI24752J21851_1000242 | 3300001976 | Bacteria | 7530 |
| 4 | JGI24740J21852_10011002 | 3300001979 | Bacteria | 3459 |
| 5 | JGI24740J21852_10011194 | 3300001979 | Bacteria | 3423 |
| 6 | JGI24737J22298_10002896 | 3300001990 | Bacteria | 6085 |
| 7 | JGI24742J22300_10012191 | 3300002244 | Bacteria | 1431 |
| 8 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 9 | rootH1_10192496 | 3300003323 | Bacteria | 1011 |
| 10 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 11 | Ga0055542_1000037 | 3300003762 | Bacteria | 225640 |
| 12 | Ga0055529_1000042 | 3300003763 | Bacteria | 225663 |
| 13 | Ga0065704_10073578 | 3300005289 | Bacteria | 6987 |
| 14 | Ga0065715_10003484 | 3300005293 | Bacteria | 5985 |
| 15 | Ga0065715_10205784 | 3300005293 | Bacteria | 1338 |
| 16 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 17 | Ga0070658_10005620 | 3300005327 | Bacteria | 10170 |
| 18 | Ga0070658_10140211 | 3300005327 | Bacteria | 2019 |
| 19 | Ga0070676_10119402 | 3300005328 | Bacteria | 1653 |
| 20 | Ga0070683_100053304 | 3300005329 | Bacteria | 3748 |
| 21 | Ga0070683_100245806 | 3300005329 | Bacteria | 1702 |
| 22 | Ga0070670_100000021 | 3300005331 | Bacteria | 202776 |
| 23 | Ga0070670_100016348 | 3300005331 | Bacteria | 6372 |
| 24 | Ga0070670_100024180 | 3300005331 | Bacteria | 5227 |
| 25 | Ga0070677_10001614 | 3300005333 | Bacteria | 7126 |
| 26 | Ga0070680_100000587 | 3300005336 | Bacteria | 25132 |
| 27 | Ga0070680_100043759 | 3300005336 | Bacteria | 3637 |
| 28 | Ga0070680_100091068 | 3300005336 | Bacteria | 2524 |
| 29 | Ga0070660_100000441 | 3300005339 | Bacteria | 27579 |
| 30 | Ga0070660_100004924 | 3300005339 | Bacteria | 9236 |
| 31 | Ga0070660_100014616 | 3300005339 | Bacteria | 5662 |
| 32 | Ga0070660_100159900 | 3300005339 | Bacteria | 1815 |
| 33 | Ga0070661_100000028 | 3300005344 | Bacteria | 117932 |
| 34 | Ga0070661_100031923 | 3300005344 | Bacteria | 3810 |
| 35 | Ga0070661_100226022 | 3300005344 | Bacteria | 1437 |
| 36 | Ga0070661_100414549 | 3300005344 | Bacteria | 1067 |
| 37 | Ga0070692_10001382 | 3300005345 | Bacteria | 8772 |
| 38 | Ga0070692_10067412 | 3300005345 | Bacteria | 1900 |
| 39 | Ga0070668_100009253 | 3300005347 | Bacteria | 7306 |
| 40 | Ga0070668_100010572 | 3300005347 | Bacteria | 6865 |
| 41 | Ga0070669_100000937 | 3300005353 | Bacteria | 21274 |
| 42 | Ga0070675_100001185 | 3300005354 | Bacteria | 18941 |
| 43 | Ga0070671_100236372 | 3300005355 | Bacteria | 1551 |
| 44 | Ga0070671_100307630 | 3300005355 | Bacteria | 1350 |
| 45 | Ga0070671_101079424 | 3300005355 | Bacteria | 705 |
| 46 | Ga0070674_100009326 | 3300005356 | Bacteria | 5874 |
| 47 | Ga0070674_100009392 | 3300005356 | Bacteria | 5855 |
| 48 | Ga0070674_100049058 | 3300005356 | Bacteria | 2901 |
| 49 | Ga0070674_100356658 | 3300005356 | Bacteria | 1183 |
| 50 | Ga0070673_100045471 | 3300005364 | Bacteria | 3405 |
| 51 | Ga0070673_100204735 | 3300005364 | Bacteria | 1701 |
| 52 | Ga0070688_100704503 | 3300005365 | Bacteria | 782 |
| 53 | Ga0070659_100041715 | 3300005366 | Bacteria | 3588 |
| 54 | Ga0070659_100042737 | 3300005366 | Bacteria | 3544 |
| 55 | Ga0070659_100043718 | 3300005366 | Bacteria | 3504 |
| 56 | Ga0070659_100083428 | 3300005366 | Bacteria | 2554 |
| 57 | Ga0070659_100088185 | 3300005366 | Bacteria | 2484 |
| 58 | Ga0070667_100000221 | 3300005367 | Bacteria | 65664 |
| 59 | Ga0070667_100042504 | 3300005367 | Bacteria | 3813 |
| 60 | Ga0070667_100127963 | 3300005367 | Bacteria | 2215 |
| 61 | Ga0070700_100087528 | 3300005441 | Bacteria | 2025 |
| 62 | Ga0070663_100007682 | 3300005455 | Bacteria | 6583 |
| 63 | Ga0070663_100123227 | 3300005455 | Bacteria | 1960 |
| 64 | Ga0070663_100277369 | 3300005455 | Bacteria | 1335 |
| 65 | Ga0070663_100290313 | 3300005455 | Bacteria | 1306 |
| 66 | Ga0070678_100005834 | 3300005456 | Bacteria | 7164 |
| 67 | Ga0070678_100076643 | 3300005456 | Bacteria | 2519 |
| 68 | Ga0070662_100004518 | 3300005457 | Bacteria | 8816 |
| 69 | Ga0070662_100062222 | 3300005457 | Bacteria | 2726 |
| 70 | Ga0070662_100087326 | 3300005457 | Bacteria | 2334 |
| 71 | Ga0070662_100344075 | 3300005457 | Bacteria | 1220 |
| 72 | Ga0070662_100872980 | 3300005457 | Bacteria | 767 |
| 73 | Ga0070681_10033289 | 3300005458 | Bacteria | 5174 |
| 74 | Ga0070681_10085836 | 3300005458 | Bacteria | 3100 |
| 75 | Ga0070681_10598544 | 3300005458 | Bacteria | 1017 |
| 76 | Ga0068867_100150593 | 3300005459 | Bacteria | 1827 |
| 77 | Ga0070679_100000010 | 3300005530 | Bacteria | 166632 |
| 78 | Ga0070679_100084102 | 3300005530 | Bacteria | 3170 |
| 79 | Ga0070679_100215445 | 3300005530 | Bacteria | 1883 |
| 80 | Ga0068853_100072459 | 3300005539 | Bacteria | 3002 |
| 81 | Ga0068853_100174604 | 3300005539 | Bacteria | 1946 |
| 82 | Ga0070672_100047162 | 3300005543 | Bacteria | 3343 |
| 83 | Ga0070672_100089372 | 3300005543 | Bacteria | 2482 |
| 84 | Ga0070672_100785584 | 3300005543 | Bacteria | 837 |
| 85 | Ga0070665_100002410 | 3300005548 | Bacteria | 20612 |
| 86 | Ga0068855_100036336 | 3300005563 | Bacteria | 5864 |
| 87 | Ga0068855_100120630 | 3300005563 | Bacteria | 3001 |
| 88 | Ga0068855_100317368 | 3300005563 | Bacteria | 1723 |
| 89 | Ga0068855_101049947 | 3300005563 | Bacteria | 854 |
| 90 | Ga0070664_100086710 | 3300005564 | Bacteria | 2705 |
| 91 | Ga0070664_100166266 | 3300005564 | Bacteria | 1955 |
| 92 | Ga0068854_100009240 | 3300005578 | Bacteria | 6360 |
| 93 | Ga0068854_100055840 | 3300005578 | Bacteria | 2845 |
| 94 | Ga0068854_100137243 | 3300005578 | Bacteria | 1873 |
| 95 | Ga0068854_100208171 | 3300005578 | Bacteria | 1541 |
| 96 | Ga0068854_101164493 | 3300005578 | Bacteria | 689 |
| 97 | Ga0068856_101021232 | 3300005614 | Bacteria | 845 |
| 98 | Ga0068852_100293930 | 3300005616 | Bacteria | 1570 |
| 99 | Ga0068852_100879884 | 3300005616 | Unclassified | 912 |
| 100 | Ga0068859_100013822 | 3300005617 | Bacteria | 8095 |
| 101 | Ga0068859_100314660 | 3300005617 | Bacteria | 1659 |
| 102 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 103 | Ga0068864_100090561 | 3300005618 | Bacteria | 2697 |
| 104 | Ga0068864_100111865 | 3300005618 | Bacteria | 2433 |
| 105 | Ga0068864_100394580 | 3300005618 | Bacteria | 1314 |
| 106 | Ga0068861_100317448 | 3300005719 | Bacteria | 1356 |
| 107 | Ga0068851_10032579 | 3300005834 | Bacteria | 2593 |
| 108 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 109 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 110 | Ga0068862_100358717 | 3300005844 | Bacteria | 1354 |
| 111 | Ga0068862_100364278 | 3300005844 | Bacteria | 1344 |
| 112 | Ga0068862_100465937 | 3300005844 | Bacteria | 1193 |
| 113 | Ga0068862_100873135 | 3300005844 | Bacteria | 883 |
| 114 | Ga0075366_10284255 | 3300006195 | Bacteria | 1011 |
| 115 | Ga0097621_100107713 | 3300006237 | Bacteria | 2352 |
| 116 | Ga0075430_101024091 | 3300006846 | Bacteria | 680 |
| 117 | Ga0068865_100012798 | 3300006881 | Bacteria | 5289 |
| 118 | Ga0068865_100203858 | 3300006881 | Bacteria | 1537 |
| 119 | Ga0097620_100013822 | 3300006931 | Bacteria | 8095 |
| 120 | Ga0097620_100314679 | 3300006931 | Bacteria | 1659 |
| 121 | Ga0105251_10002504 | 3300009011 | Bacteria | 14365 |
| 122 | Ga0105240_10000433 | 3300009093 | Bacteria | 77418 |
| 123 | Ga0105240_10168812 | 3300009093 | Bacteria | 2593 |
| 124 | Ga0105240_10638380 | 3300009093 | Bacteria | 1168 |
| 125 | Ga0111539_10024750 | 3300009094 | Bacteria | 7362 |
| 126 | Ga0111539_12217497 | 3300009094 | Bacteria | 637 |
| 127 | Ga0105247_10106507 | 3300009101 | Bacteria | 1799 |
| 128 | Ga0105243_10000082 | 3300009148 | Bacteria | 108252 |
| 129 | Ga0105241_10049342 | 3300009174 | Bacteria | 3205 |
| 130 | Ga0105242_10670270 | 3300009176 | Bacteria | 1011 |
| 131 | Ga0105248_10000010 | 3300009177 | Bacteria | 344314 |
| 132 | Ga0105248_10039462 | 3300009177 | Bacteria | 5288 |
| 133 | Ga0105248_10099642 | 3300009177 | Bacteria | 3274 |
| 134 | Ga0105237_10199980 | 3300009545 | Bacteria | 1998 |
| 135 | Ga0105237_10437664 | 3300009545 | Bacteria | 1313 |
| 136 | Ga0105238_10257043 | 3300009551 | Bacteria | 1726 |
| 137 | Ga0105238_10557265 | 3300009551 | Bacteria | 1151 |
| 138 | Ga0105249_10000122 | 3300009553 | Bacteria | 105623 |
| 139 | Ga0105249_10113449 | 3300009553 | Bacteria | 2564 |
| 140 | Ga0105239_10000279 | 3300010375 | Bacteria | 75291 |
| 141 | Ga0105239_10908777 | 3300010375 | Bacteria | 1011 |
| 142 | Ga0157373_10187693 | 3300013100 | Bacteria | 1456 |
| 143 | Ga0157371_10000183 | 3300013102 | Bacteria | 92426 |
| 144 | Ga0157369_10069615 | 3300013105 | Bacteria | 3780 |
| 145 | Ga0157369_10072097 | 3300013105 | Bacteria | 3707 |
| 146 | Ga0157374_12395875 | 3300013296 | Bacteria | 555 |
| 147 | Ga0163162_10047626 | 3300013306 | Bacteria | 4296 |
| 148 | Ga0163162_10208264 | 3300013306 | Bacteria | 2085 |
| 149 | Ga0157375_10620561 | 3300013308 | Bacteria | 1239 |
| 150 | Ga0163163_10305346 | 3300014325 | Bacteria | 1644 |
| 151 | Ga0157380_10004293 | 3300014326 | Bacteria | 9874 |
| 152 | Ga0157380_10111187 | 3300014326 | Bacteria | 2303 |
| 153 | Ga0157380_10407059 | 3300014326 | Bacteria | 1293 |
| 154 | Ga0182008_10247646 | 3300014497 | Bacteria | 918 |
| 155 | Ga0157379_10025566 | 3300014968 | Bacteria | 5246 |
| 156 | Ga0157376_10604446 | 3300014969 | Bacteria | 1092 |
| 157 | Ga0163161_10044597 | 3300017792 | Bacteria | 3194 |
| 158 | Ga0213876_10000766 | 3300021384 | Bacteria | 22166 |
| 159 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 160 | Ga0209026_1013842 | 3300025250 | Bacteria | 1362 |
| 161 | Ga0209677_108619 | 3300025253 | Bacteria | 1946 |
| 162 | Ga0209148_1000026 | 3300025254 | Bacteria | 629213 |
| 163 | Ga0209233_1021259 | 3300025261 | Bacteria | 1684 |
| 164 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 165 | Ga0209455_1012760 | 3300025272 | Bacteria | 1990 |
| 166 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 167 | Ga0209758_1132548 | 3300025297 | Bacteria | 657 |
| 168 | Ga0207697_10001553 | 3300025315 | Bacteria | 12409 |
| 169 | Ga0207656_10023174 | 3300025321 | Bacteria | 2497 |
| 170 | Ga0207713_1003344 | 3300025735 | Bacteria | 11010 |
| 171 | Ga0207682_10003978 | 3300025893 | Bacteria | 6292 |
| 172 | Ga0207710_10056697 | 3300025900 | Bacteria | 1768 |
| 173 | Ga0207688_10026842 | 3300025901 | Bacteria | 3168 |
| 174 | Ga0207688_10053916 | 3300025901 | Bacteria | 2255 |
| 175 | Ga0207647_10055333 | 3300025904 | Bacteria | 2439 |
| 176 | Ga0207645_10012515 | 3300025907 | Bacteria | 5754 |
| 177 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 178 | Ga0207705_10000397 | 3300025909 | Bacteria | 38200 |
| 179 | Ga0207705_10001479 | 3300025909 | Bacteria | 18709 |
| 180 | Ga0207707_10046798 | 3300025912 | Bacteria | 3768 |
| 181 | Ga0207707_10114770 | 3300025912 | Bacteria | 2354 |
| 182 | Ga0207707_10530690 | 3300025912 | Bacteria | 1001 |
| 183 | Ga0207695_10000285 | 3300025913 | Bacteria | 125917 |
| 184 | Ga0207695_10134056 | 3300025913 | Bacteria | 2432 |
| 185 | Ga0207695_10180319 | 3300025913 | Bacteria | 2033 |
| 186 | Ga0207671_10007571 | 3300025914 | Bacteria | 9404 |
| 187 | Ga0207671_10092953 | 3300025914 | Bacteria | 2275 |
| 188 | Ga0207671_10183874 | 3300025914 | Bacteria | 1628 |
| 189 | Ga0207660_10002232 | 3300025917 | Bacteria | 12807 |
| 190 | Ga0207660_10040817 | 3300025917 | Bacteria | 3250 |
| 191 | Ga0207660_10314148 | 3300025917 | Bacteria | 1250 |
| 192 | Ga0207657_10001100 | 3300025919 | Bacteria | 28711 |
| 193 | Ga0207657_10006640 | 3300025919 | Bacteria | 11974 |
| 194 | Ga0207657_10044420 | 3300025919 | Bacteria | 3906 |
| 195 | Ga0207657_10088426 | 3300025919 | Bacteria | 2589 |
| 196 | Ga0207657_10096262 | 3300025919 | Bacteria | 2462 |
| 197 | Ga0207657_10510332 | 3300025919 | Bacteria | 941 |
| 198 | Ga0207649_10000079 | 3300025920 | Bacteria | 82899 |
| 199 | Ga0207649_10000472 | 3300025920 | Bacteria | 28723 |
| 200 | Ga0207649_10009506 | 3300025920 | Bacteria | 5321 |
| 201 | Ga0207649_10467794 | 3300025920 | Bacteria | 954 |
| 202 | Ga0207652_10000005 | 3300025921 | Bacteria | 343384 |
| 203 | Ga0207652_10000006 | 3300025921 | Bacteria | 302991 |
| 204 | Ga0207652_10000007 | 3300025921 | Bacteria | 301303 |
| 205 | Ga0207652_10000009 | 3300025921 | Bacteria | 257234 |
| 206 | Ga0207652_10001258 | 3300025921 | Bacteria | 22543 |
| 207 | Ga0207694_10024798 | 3300025924 | Bacteria | 4555 |
| 208 | Ga0207694_10091803 | 3300025924 | Bacteria | 2396 |
| 209 | Ga0207650_10000298 | 3300025925 | Bacteria | 49421 |
| 210 | Ga0207650_10003435 | 3300025925 | Bacteria | 10893 |
| 211 | Ga0207650_10087462 | 3300025925 | Bacteria | 2374 |
| 212 | Ga0207659_10803635 | 3300025926 | Bacteria | 808 |
| 213 | Ga0207644_10227013 | 3300025931 | Bacteria | 1482 |
| 214 | Ga0207644_10300102 | 3300025931 | Bacteria | 1294 |
| 215 | Ga0207644_10726109 | 3300025931 | Bacteria | 829 |
| 216 | Ga0207690_10001240 | 3300025932 | Bacteria | 16125 |
| 217 | Ga0207690_10001443 | 3300025932 | Bacteria | 14876 |
| 218 | Ga0207690_10061560 | 3300025932 | Bacteria | 2552 |
| 219 | Ga0207690_10101896 | 3300025932 | Bacteria | 2052 |
| 220 | Ga0207690_10190197 | 3300025932 | Bacteria | 1552 |
| 221 | Ga0207690_10826154 | 3300025932 | Bacteria | 766 |
| 222 | Ga0207706_10001405 | 3300025933 | Bacteria | 24086 |
| 223 | Ga0207706_10005272 | 3300025933 | Bacteria | 12055 |
| 224 | Ga0207706_10015511 | 3300025933 | Bacteria | 6885 |
| 225 | Ga0207706_10282040 | 3300025933 | Bacteria | 1449 |
| 226 | Ga0207709_10000507 | 3300025935 | Bacteria | 34401 |
| 227 | Ga0207669_10000061 | 3300025937 | Bacteria | 54347 |
| 228 | Ga0207669_10002470 | 3300025937 | Bacteria | 7884 |
| 229 | Ga0207669_10105603 | 3300025937 | Bacteria | 1874 |
| 230 | Ga0207669_10404579 | 3300025937 | Bacteria | 1070 |
| 231 | Ga0207669_10428830 | 3300025937 | Bacteria | 1043 |
| 232 | Ga0207704_10050188 | 3300025938 | Bacteria | 2515 |
| 233 | Ga0207704_10166657 | 3300025938 | Bacteria | 1575 |
| 234 | Ga0207691_10000696 | 3300025940 | Bacteria | 33255 |
| 235 | Ga0207691_10126278 | 3300025940 | Bacteria | 2263 |
| 236 | Ga0207711_10000038 | 3300025941 | Bacteria | 163520 |
| 237 | Ga0207711_10319726 | 3300025941 | Bacteria | 1434 |
| 238 | Ga0207661_11223701 | 3300025944 | Bacteria | 691 |
| 239 | Ga0207679_10324477 | 3300025945 | Bacteria | 1334 |
| 240 | Ga0207667_10000107 | 3300025949 | Bacteria | 133066 |
| 241 | Ga0207667_10094958 | 3300025949 | Bacteria | 3078 |
| 242 | Ga0207667_10112727 | 3300025949 | Bacteria | 2804 |
| 243 | Ga0207651_10050555 | 3300025960 | Bacteria | 2823 |
| 244 | Ga0207651_10117002 | 3300025960 | Bacteria | 2013 |
| 245 | Ga0207712_10001466 | 3300025961 | Bacteria | 16096 |
| 246 | Ga0207712_10114943 | 3300025961 | Bacteria | 2025 |
| 247 | Ga0207668_10109474 | 3300025972 | Bacteria | 2069 |
| 248 | Ga0207668_10142997 | 3300025972 | Bacteria | 1842 |
| 249 | Ga0207668_10268042 | 3300025972 | Bacteria | 1395 |
| 250 | Ga0207640_10003657 | 3300025981 | Bacteria | 8295 |
| 251 | Ga0207640_10038215 | 3300025981 | Bacteria | 3027 |
| 252 | Ga0207640_10096212 | 3300025981 | Bacteria | 2064 |
| 253 | Ga0207640_10105808 | 3300025981 | Bacteria | 1983 |
| 254 | Ga0207658_10000256 | 3300025986 | Bacteria | 55417 |
| 255 | Ga0207658_10031887 | 3300025986 | Bacteria | 3747 |
| 256 | Ga0207658_10247214 | 3300025986 | Bacteria | 1514 |
| 257 | Ga0207639_10000692 | 3300026041 | Bacteria | 23191 |
| 258 | Ga0207639_10137066 | 3300026041 | Bacteria | 2034 |
| 259 | Ga0207639_10145473 | 3300026041 | Bacteria | 1980 |
| 260 | Ga0207678_10001575 | 3300026067 | Bacteria | 20968 |
| 261 | Ga0207678_10002472 | 3300026067 | Bacteria | 16788 |
| 262 | Ga0207678_10086333 | 3300026067 | Bacteria | 2682 |
| 263 | Ga0207708_10048265 | 3300026075 | Bacteria | 3241 |
| 264 | Ga0207702_10007468 | 3300026078 | Bacteria | 9323 |
| 265 | Ga0207702_10572967 | 3300026078 | Bacteria | 1106 |
| 266 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 267 | Ga0207648_10039503 | 3300026089 | Bacteria | 4149 |
| 268 | Ga0207648_10295073 | 3300026089 | Bacteria | 1452 |
| 269 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 270 | Ga0207676_10144400 | 3300026095 | Bacteria | 2042 |
| 271 | Ga0207676_10200499 | 3300026095 | Bacteria | 1763 |
| 272 | Ga0207674_10266143 | 3300026116 | Bacteria | 1662 |
| 273 | Ga0207675_100387570 | 3300026118 | Bacteria | 1375 |
| 274 | Ga0207683_10015483 | 3300026121 | Bacteria | 6495 |
| 275 | Ga0207683_10173269 | 3300026121 | Bacteria | 1955 |
| 276 | Ga0207698_10193764 | 3300026142 | Bacteria | 1813 |
| 277 | Ga0207698_10615747 | 3300026142 | Bacteria | 1072 |
| 278 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 279 | Ga0268266_10013502 | 3300028379 | Bacteria | 7031 |
| 280 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 281 | Ga0268265_10266783 | 3300028380 | Bacteria | 1525 |
| 282 | Ga0268265_10335060 | 3300028380 | Bacteria | 1375 |
| 283 | Ga0268264_10025669 | 3300028381 | Bacteria | 4813 |
| 284 | Ga0307517_10027451 | 3300028786 | Bacteria | 6838 |
| 285 | Ga0316182_1064081 | 3300030745 | Bacteria | 2674 |
| 286 | Ga0307513_10008724 | 3300031456 | Bacteria | 12912 |
| 287 | Ga0307408_100023121 | 3300031548 | Bacteria | 4231 |
| 288 | Ga0307408_100139021 | 3300031548 | Bacteria | 1904 |
| 289 | Ga0307408_100152759 | 3300031548 | Bacteria | 1824 |
| 290 | Ga0307408_100595169 | 3300031548 | Bacteria | 982 |
| 291 | Ga0307408_100772636 | 3300031548 | Bacteria | 870 |
| 292 | Ga0307408_101607055 | 3300031548 | Bacteria | 617 |
| 293 | Ga0307405_10294867 | 3300031731 | Bacteria | 1227 |
| 294 | Ga0307405_10370888 | 3300031731 | Bacteria | 1111 |
| 295 | Ga0307413_10000223 | 3300031824 | Bacteria | 16635 |
| 296 | Ga0307413_10092926 | 3300031824 | Bacteria | 1970 |
| 297 | Ga0307413_10133015 | 3300031824 | Bacteria | 1705 |
| 298 | Ga0307413_10165558 | 3300031824 | Bacteria | 1559 |
| 299 | Ga0307413_10174893 | 3300031824 | Bacteria | 1524 |
| 300 | Ga0307413_10354637 | 3300031824 | Bacteria | 1133 |
| 301 | Ga0307413_10919256 | 3300031824 | Bacteria | 744 |
| 302 | Ga0307410_10047077 | 3300031852 | Bacteria | 2880 |
| 303 | Ga0307410_10075530 | 3300031852 | Bacteria | 2349 |
| 304 | Ga0307410_10154911 | 3300031852 | Bacteria | 1710 |
| 305 | Ga0307410_10156601 | 3300031852 | Bacteria | 1702 |
| 306 | Ga0307410_10194099 | 3300031852 | Bacteria | 1546 |
| 307 | Ga0307406_10149734 | 3300031901 | Bacteria | 1663 |
| 308 | Ga0307406_10180566 | 3300031901 | Bacteria | 1536 |
| 309 | Ga0307406_10313916 | 3300031901 | Bacteria | 1210 |
| 310 | Ga0307406_10384608 | 3300031901 | Bacteria | 1107 |
| 311 | Ga0307407_10041510 | 3300031903 | Bacteria | 2573 |
| 312 | Ga0307407_10056086 | 3300031903 | Bacteria | 2279 |
| 313 | Ga0307407_10100801 | 3300031903 | Bacteria | 1792 |
| 314 | Ga0307407_10335651 | 3300031903 | Bacteria | 1065 |
| 315 | Ga0307407_10624909 | 3300031903 | Bacteria | 804 |
| 316 | Ga0307412_10037457 | 3300031911 | Bacteria | 3116 |
| 317 | Ga0307412_10095777 | 3300031911 | Bacteria | 2087 |
| 318 | Ga0307412_10114454 | 3300031911 | Bacteria | 1931 |
| 319 | Ga0307412_10149968 | 3300031911 | Bacteria | 1719 |
| 320 | Ga0307412_10154007 | 3300031911 | Bacteria | 1699 |
| 321 | Ga0307412_10418891 | 3300031911 | Bacteria | 1095 |
| 322 | Ga0307412_10890768 | 3300031911 | Bacteria | 779 |
| 323 | Ga0307412_11169767 | 3300031911 | Bacteria | 687 |
| 324 | Ga0307409_100030576 | 3300031995 | Bacteria | 3871 |
| 325 | Ga0307409_100087812 | 3300031995 | Bacteria | 2536 |
| 326 | Ga0307409_100179127 | 3300031995 | Bacteria | 1874 |
| 327 | Ga0307409_100741281 | 3300031995 | Bacteria | 985 |
| 328 | Ga0307409_100762465 | 3300031995 | Bacteria | 972 |
| 329 | Ga0307409_100763600 | 3300031995 | Bacteria | 971 |
| 330 | Ga0307409_100992263 | 3300031995 | Bacteria | 857 |
| 331 | Ga0307416_100041477 | 3300032002 | Bacteria | 3585 |
| 332 | Ga0307416_100145275 | 3300032002 | Bacteria | 2164 |
| 333 | Ga0307414_10054730 | 3300032004 | Bacteria | 2790 |
| 334 | Ga0307414_10101496 | 3300032004 | Bacteria | 2166 |
| 335 | Ga0307414_10138424 | 3300032004 | Bacteria | 1902 |
| 336 | Ga0307414_10191815 | 3300032004 | Bacteria | 1654 |
| 337 | Ga0307414_10202474 | 3300032004 | Bacteria | 1616 |
| 338 | Ga0307414_10209628 | 3300032004 | Bacteria | 1591 |
| 339 | Ga0307414_10239016 | 3300032004 | Bacteria | 1502 |
| 340 | Ga0307414_10285225 | 3300032004 | Bacteria | 1389 |
| 341 | Ga0307414_10376913 | 3300032004 | Bacteria | 1225 |
| 342 | Ga0307414_10473527 | 3300032004 | Bacteria | 1103 |
| 343 | Ga0307414_10827845 | 3300032004 | Bacteria | 845 |
| 344 | Ga0307414_11322659 | 3300032004 | Bacteria | 669 |
| 345 | Ga0307411_10002034 | 3300032005 | Bacteria | 8674 |
| 346 | Ga0307411_10026369 | 3300032005 | Bacteria | 3499 |
| 347 | Ga0307411_10033317 | 3300032005 | Bacteria | 3194 |
| 348 | Ga0307411_10082645 | 3300032005 | Bacteria | 2216 |
| 349 | Ga0307411_10207172 | 3300032005 | Bacteria | 1511 |
| 350 | Ga0307411_10433780 | 3300032005 | Bacteria | 1095 |
| 351 | Ga0307411_10534446 | 3300032005 | Bacteria | 997 |
| 352 | Ga0307411_10655816 | 3300032005 | Bacteria | 909 |
| 353 | Ga0307411_11015152 | 3300032005 | Bacteria | 743 |
| 354 | Ga0307415_100188951 | 3300032126 | Bacteria | 1624 |
| 355 | Ga0307415_100189070 | 3300032126 | Bacteria | 1623 |
| 356 | Ga0307415_100238820 | 3300032126 | Bacteria | 1468 |
| 357 | Ga0307415_100507566 | 3300032126 | Bacteria | 1055 |
| 358 | Ga0307415_100785662 | 3300032126 | Bacteria | 867 |
| 359 | Ga0307415_101251112 | 3300032126 | Bacteria | 701 |
| 360 | Ga0395899_0000916 | 3300037312 | Bacteria | 27731 |
| 361 | Ga0395899_0060887 | 3300037312 | Bacteria | 2781 |
| 362 | Ga0395900_0001285 | 3300037418 | Bacteria | 30628 |
| 363 | Ga0395898_0001920 | 3300037466 | Bacteria | 26462 |
| 364 | Ga0395905_0001547 | 3300037471 | Bacteria | 27515 |
| 365 | Ga0395901_0000671 | 3300038443 | Bacteria | 39338 |
| 366 | Ga0436365_1596642 | 3300039437 | Bacteria | 39428 |
| 367 | Ga0439435_0165461 | 3300042436 | Bacteria | 716 |
| 368 | Ga0466966_0000027 | 3300044684 | Bacteria | 106520 |
| 369 | Ga0466959_0149686 | 3300045049 | Bacteria | 1646 |
| 370 | Ga0495638_0129332 | 3300046460 | Bacteria | 1485 |
| 371 | Ga0495650_0000461 | 3300046471 | Bacteria | 63382 |
| 372 | Ga0495584_0051595 | 3300046491 | Bacteria | 2071 |
| 373 | Ga0495585_0058227 | 3300046492 | Bacteria | 2131 |
| 374 | Ga0495596_0006245 | 3300046500 | Bacteria | 5514 |
| 375 | Ga0495583_0001174 | 3300046506 | Bacteria | 28270 |
| 376 | Ga0495583_0007203 | 3300046506 | Bacteria | 7057 |
| 377 | Ga0495583_0016431 | 3300046506 | Bacteria | 3978 |
| 378 | Ga0495606_0003980 | 3300046507 | Bacteria | 15126 |
| 379 | Ga0495606_0029846 | 3300046507 | Bacteria | 3821 |
| 380 | Ga0495606_0188956 | 3300046507 | Bacteria | 1182 |
| 381 | Ga0495610_0211225 | 3300046512 | Bacteria | 789 |
| 382 | Ga0495616_0231304 | 3300046513 | Bacteria | 801 |
| 383 | Ga0495631_0066205 | 3300046518 | Bacteria | 1563 |
| 384 | Ga0495632_0230633 | 3300046519 | Bacteria | 835 |
| 385 | Ga0495637_0041615 | 3300046520 | Bacteria | 1970 |
| 386 | Ga0495643_0006051 | 3300046522 | Bacteria | 8060 |
| 387 | Ga0495643_0006635 | 3300046522 | Bacteria | 7600 |
| 388 | Ga0495643_0035015 | 3300046522 | Bacteria | 2766 |
| 389 | Ga0495643_0066814 | 3300046522 | Bacteria | 1895 |
| 390 | Ga0495648_0000111 | 3300046524 | Bacteria | 100648 |
| 391 | Ga0495663_0000530 | 3300046525 | Bacteria | 13684 |
| 392 | Ga0495663_0115838 | 3300046525 | Bacteria | 894 |
| 393 | Ga0495642_0004819 | 3300046528 | Bacteria | 5214 |
| 394 | Ga0495598_0003391 | 3300046537 | Bacteria | 3382 |
| 395 | Ga0495598_0041201 | 3300046537 | Bacteria | 1350 |
| 396 | Ga0495609_0045108 | 3300046538 | Bacteria | 1976 |
| 397 | Ga0495621_0003234 | 3300046539 | Bacteria | 4477 |
| 398 | Ga0495622_0023138 | 3300046557 | Bacteria | 2896 |
| 399 | Ga0495633_0035401 | 3300046558 | Bacteria | 2397 |
| 400 | Ga0495668_0000325 | 3300046616 | Bacteria | 65404 |
| 401 | Ga0495611_0036929 | 3300046648 | Bacteria | 2170 |
| 402 | Ga0495611_0069142 | 3300046648 | Bacteria | 1613 |
| 403 | Ga0495625_0000221 | 3300046660 | Bacteria | 90175 |
| 404 | Ga0495625_0065990 | 3300046660 | Bacteria | 2550 |
| 405 | Ga0495669_0000159 | 3300046684 | Bacteria | 43128 |
| 406 | Ga0495670_0022564 | 3300046691 | Bacteria | 3108 |
| 407 | Ga0495670_0048982 | 3300046691 | Bacteria | 2113 |
| 408 | Ga0495671_0160406 | 3300046692 | Bacteria | 1094 |
| 409 | Ga0495660_0047010 | 3300046810 | Bacteria | 2365 |
| 410 | Ga0495683_0004709 | 3300047323 | Bacteria | 7671 |
| 411 | Ga0495683_0058042 | 3300047323 | Bacteria | 1923 |
| 412 | Ga0495687_000089 | 3300047443 | Bacteria | 141448 |
| 413 | Ga0495687_001092 | 3300047443 | Bacteria | 26544 |
| 414 | Ga0495677_0011904 | 3300047445 | Bacteria | 3175 |
| 415 | Ga0495677_0023183 | 3300047445 | Bacteria | 2253 |
| 416 | Ga0495681_0005617 | 3300047470 | Bacteria | 8363 |
| 417 | Ga0495681_0088038 | 3300047470 | Bacteria | 1376 |
| 418 | Ga0496101_0071614 | 3300048904 | Bacteria | 2542 |
| 419 | Ga0496102_0000067 | 3300048905 | Bacteria | 156790 |
| 420 | Ga0496102_0746163 | 3300048905 | Bacteria | 902 |
| 421 | Ga0496103_0000222 | 3300048906 | Bacteria | 56372 |
| 422 | Ga0496103_0228213 | 3300048906 | Bacteria | 1197 |
| 423 | Ga0496104_0003479 | 3300048907 | Bacteria | 13583 |
| 424 | Ga0496105_0000662 | 3300048908 | Bacteria | 23132 |
| 425 | Ga0496110_0012321 | 3300048913 | Bacteria | 7029 |
| 426 | Ga0496114_0007367 | 3300048917 | Bacteria | 8693 |
| 427 | Ga0496115_0000056 | 3300048918 | Bacteria | 104434 |
| 428 | Ga0496116_0039774 | 3300048919 | Bacteria | 3246 |
| 429 | Ga0496117_0000114 | 3300048920 | Bacteria | 180658 |
| 430 | Ga0496117_0010075 | 3300048920 | Bacteria | 8679 |
| 431 | Ga0496118_0000082 | 3300048921 | Bacteria | 185820 |
| 432 | Ga0496118_0000327 | 3300048921 | Bacteria | 82033 |
| 433 | Ga0496118_0142492 | 3300048921 | Bacteria | 1516 |
| 434 | Ga0496119_0004578 | 3300048922 | Bacteria | 13669 |
| 435 | Ga0496120_0040137 | 3300048923 | Bacteria | 2753 |
| 436 | Ga0496121_0000344 | 3300048924 | Bacteria | 96865 |
| 437 | Ga0496121_0014959 | 3300048924 | Bacteria | 8173 |
| 438 | Ga0496121_0039648 | 3300048924 | Bacteria | 4145 |
| 439 | Ga0496122_0018243 | 3300048925 | Bacteria | 6497 |
| 440 | Ga0496123_0033485 | 3300048926 | Bacteria | 3697 |
| 441 | Ga0496124_0000068 | 3300048927 | Bacteria | 221819 |
| 442 | Ga0496125_0002303 | 3300048928 | Bacteria | 25208 |
| 443 | Ga0496126_0000157 | 3300048929 | Bacteria | 156203 |
| 444 | Ga0496126_0020862 | 3300048929 | Bacteria | 6414 |
| 445 | nmdc:mga0k408_593036_c1 | 3300050493 | Bacteria | 654 |
| 446 | nmdc:mga06r32_10173_c1 | 3300050510 | Bacteria | 8491 |
| 447 | nmdc:mga08y16_1441416_c1 | 3300050511 | Bacteria | 651 |
| 448 | Ga0500610_0000206 | 3300053079 | Bacteria | 18104 |
| 449 | Ga0500643_045054 | 3300053087 | Bacteria | 1279 |
| 450 | Ga0500583_0211290 | 3300053092 | Bacteria | 963 |
| 451 | Ga0500595_000935 | 3300053119 | Bacteria | 16547 |
| 452 | Ga0500642_0000817 | 3300053130 | Bacteria | 9122 |
| 453 | Ga0500619_023512 | 3300053154 | Bacteria | 1802 |
| 454 | Ga0500636_0007450 | 3300053177 | Bacteria | 6336 |
| 455 | Ga0500645_000585 | 3300053730 | Bacteria | 23518 |
| 456 | Ga0500645_002731 | 3300053730 | Bacteria | 7658 |
| 457 | Ga0500596_000088 | 3300053735 | Bacteria | 12460 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_12395875 | Ga0157374_123958751 | 168 |
| 2 | iso_pu_bacteria | 8057101203 | 8057105703 | 171 |
| 3 | 3300037312 | Ga0395899_0060887 | Ga0395899_0060887_1101_1619 | 172 |
| 4 | 3300046460 | Ga0495638_0129332 | Ga0495638_0129332_884_1402 | 172 |
| 5 | 3300046471 | Ga0495650_0000461 | Ga0495650_0000461_30726_31244 | 172 |
| 6 | 3300046491 | Ga0495584_0051595 | Ga0495584_0051595_868_1386 | 172 |
| 7 | 3300046492 | Ga0495585_0058227 | Ga0495585_0058227_1112_1630 | 172 |
| 8 | 3300046500 | Ga0495596_0006245 | Ga0495596_0006245_2656_3174 | 172 |
| 9 | 3300046506 | Ga0495583_0001174 | Ga0495583_0001174_18934_19452 | 172 |
| 10 | 3300046506 | Ga0495583_0007203 | Ga0495583_0007203_1648_2166 | 172 |
| 11 | 3300046506 | Ga0495583_0016431 | Ga0495583_0016431_1308_1826 | 172 |
| 12 | 3300046507 | Ga0495606_0003980 | Ga0495606_0003980_2609_3127 | 172 |
| 13 | 3300046512 | Ga0495610_0211225 | Ga0495610_0211225_114_632 | 172 |
| 14 | 3300046513 | Ga0495616_0231304 | Ga0495616_0231304_80_598 | 172 |
| 15 | 3300046518 | Ga0495631_0066205 | Ga0495631_0066205_686_1204 | 172 |
| 16 | 3300046519 | Ga0495632_0230633 | Ga0495632_0230633_81_599 | 172 |
| 17 | 3300046520 | Ga0495637_0041615 | Ga0495637_0041615_921_1439 | 172 |
| 18 | 3300046522 | Ga0495643_0006051 | Ga0495643_0006051_4781_5299 | 172 |
| 19 | 3300046522 | Ga0495643_0006635 | Ga0495643_0006635_2652_3170 | 172 |
| 20 | 3300046522 | Ga0495643_0035015 | Ga0495643_0035015_677_1195 | 172 |
| 21 | 3300046524 | Ga0495648_0000111 | Ga0495648_0000111_21413_21931 | 172 |
| 22 | 3300046525 | Ga0495663_0000530 | Ga0495663_0000530_666_1184 | 172 |
| 23 | 3300046528 | Ga0495642_0004819 | Ga0495642_0004819_1576_2094 | 172 |
| 24 | 3300046538 | Ga0495609_0045108 | Ga0495609_0045108_552_1070 | 172 |
| 25 | 3300046558 | Ga0495633_0035401 | Ga0495633_0035401_963_1481 | 172 |
| 26 | 3300046616 | Ga0495668_0000325 | Ga0495668_0000325_59300_59818 | 172 |
| 27 | 3300046648 | Ga0495611_0036929 | Ga0495611_0036929_1572_2090 | 172 |
| 28 | 3300046648 | Ga0495611_0069142 | Ga0495611_0069142_206_724 | 172 |
| 29 | 3300046692 | Ga0495671_0160406 | Ga0495671_0160406_69_587 | 172 |
| 30 | 3300046810 | Ga0495660_0047010 | Ga0495660_0047010_241_759 | 172 |
| 31 | 3300047323 | Ga0495683_0004709 | Ga0495683_0004709_1165_1683 | 172 |
| 32 | 3300047323 | Ga0495683_0058042 | Ga0495683_0058042_238_756 | 172 |
| 33 | 3300047443 | Ga0495687_000089 | Ga0495687_000089_4895_5413 | 172 |
| 34 | 3300047443 | Ga0495687_001092 | Ga0495687_001092_2656_3174 | 172 |
| 35 | 3300047445 | Ga0495677_0011904 | Ga0495677_0011904_1489_2007 | 172 |
| 36 | 3300047470 | Ga0495681_0005617 | Ga0495681_0005617_6096_6614 | 172 |
| 37 | 3300047470 | Ga0495681_0088038 | Ga0495681_0088038_385_903 | 172 |
| 38 | 3300048905 | Ga0496102_0000067 | Ga0496102_0000067_143731_144249 | 172 |
| 39 | 3300048906 | Ga0496103_0000222 | Ga0496103_0000222_54568_55086 | 172 |
| 40 | 3300048907 | Ga0496104_0003479 | Ga0496104_0003479_3997_4515 | 172 |
| 41 | 3300048908 | Ga0496105_0000662 | Ga0496105_0000662_12936_13454 | 172 |
| 42 | 3300048913 | Ga0496110_0012321 | Ga0496110_0012321_1361_1879 | 172 |
| 43 | 3300048917 | Ga0496114_0007367 | Ga0496114_0007367_8101_8619 | 172 |
| 44 | 3300048918 | Ga0496115_0000056 | Ga0496115_0000056_91069_91587 | 172 |
| 45 | 3300048919 | Ga0496116_0039774 | Ga0496116_0039774_1899_2417 | 172 |
| 46 | 3300048920 | Ga0496117_0000114 | Ga0496117_0000114_12474_12992 | 172 |
| 47 | 3300048921 | Ga0496118_0000082 | Ga0496118_0000082_172193_172711 | 172 |
| 48 | 3300048922 | Ga0496119_0004578 | Ga0496119_0004578_1368_1886 | 172 |
| 49 | 3300048923 | Ga0496120_0040137 | Ga0496120_0040137_1082_1600 | 172 |
| 50 | 3300048924 | Ga0496121_0000344 | Ga0496121_0000344_12591_13109 | 172 |
| 51 | 3300048925 | Ga0496122_0018243 | Ga0496122_0018243_4283_4801 | 172 |
| 52 | 3300048926 | Ga0496123_0033485 | Ga0496123_0033485_1247_1765 | 172 |
| 53 | 3300048927 | Ga0496124_0000068 | Ga0496124_0000068_12611_13129 | 172 |
| 54 | 3300048928 | Ga0496125_0002303 | Ga0496125_0002303_12627_13145 | 172 |
| 55 | 3300048929 | Ga0496126_0000157 | Ga0496126_0000157_12623_13141 | 172 |
| 56 | 3300053079 | Ga0500610_0000206 | Ga0500610_0000206_1777_2295 | 172 |
| 57 | 3300053087 | Ga0500643_045054 | Ga0500643_045054_587_1105 | 172 |
| 58 | 3300053092 | Ga0500583_0211290 | Ga0500583_0211290_250_768 | 172 |
| 59 | 3300053130 | Ga0500642_0000817 | Ga0500642_0000817_2977_3495 | 172 |
| 60 | 3300053154 | Ga0500619_023512 | Ga0500619_023512_1223_1741 | 172 |
| 61 | 3300053177 | Ga0500636_0007450 | Ga0500636_0007450_3428_3946 | 172 |
| 62 | 3300053730 | Ga0500645_000585 | Ga0500645_000585_21351_21869 | 172 |
| 63 | 3300053735 | Ga0500596_000088 | Ga0500596_000088_29_547 | 172 |
| 64 | 3300005356 | Ga0070674_100009392 | Ga0070674_1000093926 | 174 |
| 65 | 3300005364 | Ga0070673_100204735 | Ga0070673_1002047351 | 174 |
| 66 | 3300005457 | Ga0070662_100344075 | Ga0070662_1003440752 | 174 |
| 67 | 3300005539 | Ga0068853_100174604 | Ga0068853_1001746043 | 174 |
| 68 | 3300005563 | Ga0068855_101049947 | Ga0068855_1010499472 | 174 |
| 69 | 3300025901 | Ga0207688_10053916 | Ga0207688_100539163 | 174 |
| 70 | 3300025917 | Ga0207660_10314148 | Ga0207660_103141483 | 174 |
| 71 | 3300025937 | Ga0207669_10002470 | Ga0207669_100024709 | 174 |
| 72 | 3300025960 | Ga0207651_10050555 | Ga0207651_100505553 | 174 |
| 73 | 3300026041 | Ga0207639_10145473 | Ga0207639_101454732 | 174 |
| 74 | 3300026121 | Ga0207683_10173269 | Ga0207683_101732692 | 174 |
| 75 | 3300031548 | Ga0307408_100023121 | Ga0307408_1000231213 | 174 |
| 76 | 3300031548 | Ga0307408_100139021 | Ga0307408_1001390213 | 174 |
| 77 | 3300031548 | Ga0307408_100152759 | Ga0307408_1001527593 | 174 |
| 78 | 3300031548 | Ga0307408_100595169 | Ga0307408_1005951692 | 174 |
| 79 | 3300031731 | Ga0307405_10294867 | Ga0307405_102948672 | 174 |
| 80 | 3300031824 | Ga0307413_10133015 | Ga0307413_101330152 | 174 |
| 81 | 3300031824 | Ga0307413_10165558 | Ga0307413_101655581 | 174 |
| 82 | 3300031824 | Ga0307413_10174893 | Ga0307413_101748931 | 174 |
| 83 | 3300031824 | Ga0307413_10354637 | Ga0307413_103546372 | 174 |
| 84 | 3300031824 | Ga0307413_10919256 | Ga0307413_109192561 | 174 |
| 85 | 3300031852 | Ga0307410_10075530 | Ga0307410_100755302 | 174 |
| 86 | 3300031852 | Ga0307410_10156601 | Ga0307410_101566012 | 174 |
| 87 | 3300031901 | Ga0307406_10384608 | Ga0307406_103846082 | 174 |
| 88 | 3300031903 | Ga0307407_10056086 | Ga0307407_100560863 | 174 |
| 89 | 3300031903 | Ga0307407_10100801 | Ga0307407_101008012 | 174 |
| 90 | 3300031903 | Ga0307407_10335651 | Ga0307407_103356512 | 174 |
| 91 | 3300031903 | Ga0307407_10624909 | Ga0307407_106249092 | 174 |
| 92 | 3300031911 | Ga0307412_10037457 | Ga0307412_100374572 | 174 |
| 93 | 3300031911 | Ga0307412_10114454 | Ga0307412_101144542 | 174 |
| 94 | 3300031911 | Ga0307412_10149968 | Ga0307412_101499682 | 174 |
| 95 | 3300031911 | Ga0307412_10154007 | Ga0307412_101540072 | 174 |
| 96 | 3300031911 | Ga0307412_10890768 | Ga0307412_108907681 | 174 |
| 97 | 3300031911 | Ga0307412_11169767 | Ga0307412_111697671 | 174 |
| 98 | 3300031995 | Ga0307409_100741281 | Ga0307409_1007412812 | 174 |
| 99 | 3300031995 | Ga0307409_100762465 | Ga0307409_1007624652 | 174 |
| 100 | 3300031995 | Ga0307409_100992263 | Ga0307409_1009922632 | 174 |
| 101 | 3300032002 | Ga0307416_100145275 | Ga0307416_1001452752 | 174 |
| 102 | 3300032004 | Ga0307414_10101496 | Ga0307414_101014962 | 174 |
| 103 | 3300032004 | Ga0307414_10202474 | Ga0307414_102024743 | 174 |
| 104 | 3300032004 | Ga0307414_10239016 | Ga0307414_102390162 | 174 |
| 105 | 3300032004 | Ga0307414_10285225 | Ga0307414_102852251 | 174 |
| 106 | 3300032004 | Ga0307414_10376913 | Ga0307414_103769132 | 174 |
| 107 | 3300032005 | Ga0307411_10002034 | Ga0307411_100020346 | 174 |
| 108 | 3300032005 | Ga0307411_10033317 | Ga0307411_100333172 | 174 |
| 109 | 3300032005 | Ga0307411_10655816 | Ga0307411_106558162 | 174 |
| 110 | 3300032005 | Ga0307411_11015152 | Ga0307411_110151521 | 174 |
| 111 | 3300032126 | Ga0307415_100188951 | Ga0307415_1001889512 | 174 |
| 112 | 3300032126 | Ga0307415_100189070 | Ga0307415_1001890703 | 174 |
| 113 | 3300032126 | Ga0307415_100507566 | Ga0307415_1005075662 | 174 |
| 114 | 3300032126 | Ga0307415_100785662 | Ga0307415_1007856622 | 174 |
| 115 | 3300032126 | Ga0307415_101251112 | Ga0307415_1012511122 | 174 |
| 116 | 3300050493 | nmdc:mga0k408_593036_c1 | nmdc:mga0k408_593036_c1_98_622 | 174 |
| 117 | 3300001915 | JGI24741J21665_1008122 | JGI24741J21665_10081222 | 175 |
| 118 | 3300001915 | JGI24741J21665_1009364 | JGI24741J21665_10093642 | 175 |
| 119 | 3300001976 | JGI24752J21851_1000242 | JGI24752J21851_10002429 | 175 |
| 120 | 3300001979 | JGI24740J21852_10011002 | JGI24740J21852_100110022 | 175 |
| 121 | 3300001979 | JGI24740J21852_10011194 | JGI24740J21852_100111944 | 175 |
| 122 | 3300001990 | JGI24737J22298_10002896 | JGI24737J22298_100028967 | 175 |
| 123 | 3300002244 | JGI24742J22300_10012191 | JGI24742J22300_100121911 | 175 |
| 124 | 3300003215 | JGI25153J46596_10000002 | JGI25153J46596_10000002101 | 175 |
| 125 | 3300003323 | rootH1_10192496 | rootH1_101924962 | 175 |
| 126 | 3300003759 | Ga0055525_1000104 | Ga0055525_100010442 | 175 |
| 127 | 3300003762 | Ga0055542_1000037 | Ga0055542_1000037211 | 175 |
| 128 | 3300003763 | Ga0055529_1000042 | Ga0055529_1000042211 | 175 |
| 129 | 3300005289 | Ga0065704_10073578 | Ga0065704_100735783 | 175 |
| 130 | 3300005293 | Ga0065715_10003484 | Ga0065715_100034844 | 175 |
| 131 | 3300005293 | Ga0065715_10205784 | Ga0065715_102057842 | 175 |
| 132 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001271 | 175 |
| 133 | 3300005327 | Ga0070658_10005620 | Ga0070658_100056204 | 175 |
| 134 | 3300005327 | Ga0070658_10140211 | Ga0070658_101402112 | 175 |
| 135 | 3300005328 | Ga0070676_10119402 | Ga0070676_101194022 | 175 |
| 136 | 3300005329 | Ga0070683_100053304 | Ga0070683_1000533045 | 175 |
| 137 | 3300005329 | Ga0070683_100245806 | Ga0070683_1002458062 | 175 |
| 138 | 3300005331 | Ga0070670_100000021 | Ga0070670_100000021103 | 175 |
| 139 | 3300005331 | Ga0070670_100016348 | Ga0070670_1000163484 | 175 |
| 140 | 3300005331 | Ga0070670_100024180 | Ga0070670_1000241802 | 175 |
| 141 | 3300005333 | Ga0070677_10001614 | Ga0070677_100016147 | 175 |
| 142 | 3300005336 | Ga0070680_100000587 | Ga0070680_1000005879 | 175 |
| 143 | 3300005336 | Ga0070680_100043759 | Ga0070680_1000437593 | 175 |
| 144 | 3300005336 | Ga0070680_100091068 | Ga0070680_1000910682 | 175 |
| 145 | 3300005339 | Ga0070660_100000441 | Ga0070660_1000004419 | 175 |
| 146 | 3300005339 | Ga0070660_100004924 | Ga0070660_1000049242 | 175 |
| 147 | 3300005339 | Ga0070660_100014616 | Ga0070660_1000146162 | 175 |
| 148 | 3300005339 | Ga0070660_100159900 | Ga0070660_1001599002 | 175 |
| 149 | 3300005344 | Ga0070661_100000028 | Ga0070661_10000002881 | 175 |
| 150 | 3300005344 | Ga0070661_100031923 | Ga0070661_1000319234 | 175 |
| 151 | 3300005344 | Ga0070661_100226022 | Ga0070661_1002260222 | 175 |
| 152 | 3300005344 | Ga0070661_100414549 | Ga0070661_1004145492 | 175 |
| 153 | 3300005345 | Ga0070692_10001382 | Ga0070692_100013822 | 175 |
| 154 | 3300005345 | Ga0070692_10067412 | Ga0070692_100674122 | 175 |
| 155 | 3300005347 | Ga0070668_100009253 | Ga0070668_1000092537 | 175 |
| 156 | 3300005347 | Ga0070668_100010572 | Ga0070668_1000105729 | 175 |
| 157 | 3300005353 | Ga0070669_100000937 | Ga0070669_10000093723 | 175 |
| 158 | 3300005354 | Ga0070675_100001185 | Ga0070675_1000011852 | 175 |
| 159 | 3300005355 | Ga0070671_100236372 | Ga0070671_1002363722 | 175 |
| 160 | 3300005355 | Ga0070671_100307630 | Ga0070671_1003076302 | 175 |
| 161 | 3300005355 | Ga0070671_101079424 | Ga0070671_1010794241 | 175 |
| 162 | 3300005356 | Ga0070674_100009326 | Ga0070674_1000093264 | 175 |
| 163 | 3300005356 | Ga0070674_100049058 | Ga0070674_1000490582 | 175 |
| 164 | 3300005356 | Ga0070674_100356658 | Ga0070674_1003566582 | 175 |
| 165 | 3300005364 | Ga0070673_100045471 | Ga0070673_1000454712 | 175 |
| 166 | 3300005365 | Ga0070688_100704503 | Ga0070688_1007045031 | 175 |
| 167 | 3300005366 | Ga0070659_100041715 | Ga0070659_1000417154 | 175 |
| 168 | 3300005366 | Ga0070659_100042737 | Ga0070659_1000427372 | 175 |
| 169 | 3300005366 | Ga0070659_100043718 | Ga0070659_1000437184 | 175 |
| 170 | 3300005366 | Ga0070659_100083428 | Ga0070659_1000834282 | 175 |
| 171 | 3300005366 | Ga0070659_100088185 | Ga0070659_1000881852 | 175 |
| 172 | 3300005367 | Ga0070667_100000221 | Ga0070667_10000022140 | 175 |
| 173 | 3300005367 | Ga0070667_100042504 | Ga0070667_1000425042 | 175 |
| 174 | 3300005367 | Ga0070667_100127963 | Ga0070667_1001279631 | 175 |
| 175 | 3300005441 | Ga0070700_100087528 | Ga0070700_1000875282 | 175 |
| 176 | 3300005455 | Ga0070663_100007682 | Ga0070663_1000076826 | 175 |
| 177 | 3300005455 | Ga0070663_100123227 | Ga0070663_1001232272 | 175 |
| 178 | 3300005455 | Ga0070663_100277369 | Ga0070663_1002773692 | 175 |
| 179 | 3300005455 | Ga0070663_100290313 | Ga0070663_1002903132 | 175 |
| 180 | 3300005456 | Ga0070678_100005834 | Ga0070678_1000058346 | 175 |
| 181 | 3300005456 | Ga0070678_100076643 | Ga0070678_1000766433 | 175 |
| 182 | 3300005457 | Ga0070662_100004518 | Ga0070662_1000045182 | 175 |
| 183 | 3300005457 | Ga0070662_100062222 | Ga0070662_1000622224 | 175 |
| 184 | 3300005457 | Ga0070662_100087326 | Ga0070662_1000873262 | 175 |
| 185 | 3300005457 | Ga0070662_100872980 | Ga0070662_1008729802 | 175 |
| 186 | 3300005458 | Ga0070681_10033289 | Ga0070681_100332893 | 175 |
| 187 | 3300005458 | Ga0070681_10085836 | Ga0070681_100858362 | 175 |
| 188 | 3300005458 | Ga0070681_10598544 | Ga0070681_105985442 | 175 |
| 189 | 3300005459 | Ga0068867_100150593 | Ga0068867_1001505933 | 175 |
| 190 | 3300005530 | Ga0070679_100000010 | Ga0070679_10000001080 | 175 |
| 191 | 3300005530 | Ga0070679_100084102 | Ga0070679_1000841022 | 175 |
| 192 | 3300005530 | Ga0070679_100215445 | Ga0070679_1002154451 | 175 |
| 193 | 3300005539 | Ga0068853_100072459 | Ga0068853_1000724594 | 175 |
| 194 | 3300005543 | Ga0070672_100047162 | Ga0070672_1000471622 | 175 |
| 195 | 3300005543 | Ga0070672_100089372 | Ga0070672_1000893722 | 175 |
| 196 | 3300005543 | Ga0070672_100785584 | Ga0070672_1007855842 | 175 |
| 197 | 3300005548 | Ga0070665_100002410 | Ga0070665_1000024107 | 175 |
| 198 | 3300005563 | Ga0068855_100036336 | Ga0068855_1000363362 | 175 |
| 199 | 3300005563 | Ga0068855_100120630 | Ga0068855_1001206302 | 175 |
| 200 | 3300005563 | Ga0068855_100317368 | Ga0068855_1003173683 | 175 |
| 201 | 3300005564 | Ga0070664_100086710 | Ga0070664_1000867102 | 175 |
| 202 | 3300005564 | Ga0070664_100166266 | Ga0070664_1001662662 | 175 |
| 203 | 3300005578 | Ga0068854_100009240 | Ga0068854_1000092406 | 175 |
| 204 | 3300005578 | Ga0068854_100055840 | Ga0068854_1000558402 | 175 |
| 205 | 3300005578 | Ga0068854_100137243 | Ga0068854_1001372432 | 175 |
| 206 | 3300005578 | Ga0068854_100208171 | Ga0068854_1002081713 | 175 |
| 207 | 3300005578 | Ga0068854_101164493 | Ga0068854_1011644932 | 175 |
| 208 | 3300005614 | Ga0068856_101021232 | Ga0068856_1010212322 | 175 |
| 209 | 3300005616 | Ga0068852_100293930 | Ga0068852_1002939302 | 175 |
| 210 | 3300005616 | Ga0068852_100879884 | Ga0068852_1008798842 | 175 |
| 211 | 3300005617 | Ga0068859_100013822 | Ga0068859_1000138229 | 175 |
| 212 | 3300005617 | Ga0068859_100314660 | Ga0068859_1003146603 | 175 |
| 213 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004253 | 175 |
| 214 | 3300005618 | Ga0068864_100090561 | Ga0068864_1000905612 | 175 |
| 215 | 3300005618 | Ga0068864_100111865 | Ga0068864_1001118654 | 175 |
| 216 | 3300005618 | Ga0068864_100394580 | Ga0068864_1003945802 | 175 |
| 217 | 3300005719 | Ga0068861_100317448 | Ga0068861_1003174482 | 175 |
| 218 | 3300005834 | Ga0068851_10032579 | Ga0068851_100325792 | 175 |
| 219 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002254 | 175 |
| 220 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002248 | 175 |
| 221 | 3300005844 | Ga0068862_100358717 | Ga0068862_1003587172 | 175 |
| 222 | 3300005844 | Ga0068862_100364278 | Ga0068862_1003642782 | 175 |
| 223 | 3300005844 | Ga0068862_100465937 | Ga0068862_1004659373 | 175 |
| 224 | 3300005844 | Ga0068862_100873135 | Ga0068862_1008731352 | 175 |
| 225 | 3300006195 | Ga0075366_10284255 | Ga0075366_102842552 | 175 |
| 226 | 3300006237 | Ga0097621_100107713 | Ga0097621_1001077132 | 175 |
| 227 | 3300006846 | Ga0075430_101024091 | Ga0075430_1010240911 | 175 |
| 228 | 3300006881 | Ga0068865_100012798 | Ga0068865_1000127982 | 175 |
| 229 | 3300006881 | Ga0068865_100203858 | Ga0068865_1002038583 | 175 |
| 230 | 3300006931 | Ga0097620_100013822 | Ga0097620_1000138229 | 175 |
| 231 | 3300006931 | Ga0097620_100314679 | Ga0097620_1003146793 | 175 |
| 232 | 3300009011 | Ga0105251_10002504 | Ga0105251_1000250410 | 175 |
| 233 | 3300009093 | Ga0105240_10000433 | Ga0105240_100004337 | 175 |
| 234 | 3300009093 | Ga0105240_10168812 | Ga0105240_101688122 | 175 |
| 235 | 3300009093 | Ga0105240_10638380 | Ga0105240_106383802 | 175 |
| 236 | 3300009094 | Ga0111539_10024750 | Ga0111539_100247502 | 175 |
| 237 | 3300009094 | Ga0111539_12217497 | Ga0111539_122174971 | 175 |
| 238 | 3300009101 | Ga0105247_10106507 | Ga0105247_101065073 | 175 |
| 239 | 3300009148 | Ga0105243_10000082 | Ga0105243_1000008223 | 175 |
| 240 | 3300009174 | Ga0105241_10049342 | Ga0105241_100493422 | 175 |
| 241 | 3300009176 | Ga0105242_10670270 | Ga0105242_106702702 | 175 |
| 242 | 3300009177 | Ga0105248_10000010 | Ga0105248_1000001089 | 175 |
| 243 | 3300009177 | Ga0105248_10039462 | Ga0105248_100394626 | 175 |
| 244 | 3300009177 | Ga0105248_10099642 | Ga0105248_100996422 | 175 |
| 245 | 3300009545 | Ga0105237_10199980 | Ga0105237_101999802 | 175 |
| 246 | 3300009545 | Ga0105237_10437664 | Ga0105237_104376642 | 175 |
| 247 | 3300009551 | Ga0105238_10257043 | Ga0105238_102570433 | 175 |
| 248 | 3300009551 | Ga0105238_10557265 | Ga0105238_105572652 | 175 |
| 249 | 3300009553 | Ga0105249_10000122 | Ga0105249_1000012275 | 175 |
| 250 | 3300009553 | Ga0105249_10113449 | Ga0105249_101134492 | 175 |
| 251 | 3300010375 | Ga0105239_10000279 | Ga0105239_1000027930 | 175 |
| 252 | 3300010375 | Ga0105239_10908777 | Ga0105239_109087772 | 175 |
| 253 | 3300013100 | Ga0157373_10187693 | Ga0157373_101876931 | 175 |
| 254 | 3300013102 | Ga0157371_10000183 | Ga0157371_1000018339 | 175 |
| 255 | 3300013105 | Ga0157369_10069615 | Ga0157369_100696152 | 175 |
| 256 | 3300013105 | Ga0157369_10072097 | Ga0157369_100720972 | 175 |
| 257 | 3300013306 | Ga0163162_10047626 | Ga0163162_100476262 | 175 |
| 258 | 3300013306 | Ga0163162_10208264 | Ga0163162_102082642 | 175 |
| 259 | 3300013308 | Ga0157375_10620561 | Ga0157375_106205612 | 175 |
| 260 | 3300014325 | Ga0163163_10305346 | Ga0163163_103053462 | 175 |
| 261 | 3300014326 | Ga0157380_10004293 | Ga0157380_100042932 | 175 |
| 262 | 3300014326 | Ga0157380_10111187 | Ga0157380_101111872 | 175 |
| 263 | 3300014326 | Ga0157380_10407059 | Ga0157380_104070593 | 175 |
| 264 | 3300014497 | Ga0182008_10247646 | Ga0182008_102476462 | 175 |
| 265 | 3300014968 | Ga0157379_10025566 | Ga0157379_100255666 | 175 |
| 266 | 3300014969 | Ga0157376_10604446 | Ga0157376_106044462 | 175 |
| 267 | 3300017792 | Ga0163161_10044597 | Ga0163161_100445974 | 175 |
| 268 | 3300021384 | Ga0213876_10000766 | Ga0213876_1000076619 | 175 |
| 269 | 3300025230 | Ga0209563_100116 | Ga0209563_10011697 | 175 |
| 270 | 3300025250 | Ga0209026_1013842 | Ga0209026_10138422 | 175 |
| 271 | 3300025253 | Ga0209677_108619 | Ga0209677_1086192 | 175 |
| 272 | 3300025254 | Ga0209148_1000026 | Ga0209148_1000026593 | 175 |
| 273 | 3300025261 | Ga0209233_1021259 | Ga0209233_10212593 | 175 |
| 274 | 3300025272 | Ga0209455_1000005 | Ga0209455_10000051340 | 175 |
| 275 | 3300025272 | Ga0209455_1012760 | Ga0209455_10127602 | 175 |
| 276 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001899 | 175 |
| 277 | 3300025297 | Ga0209758_1132548 | Ga0209758_11325481 | 175 |
| 278 | 3300025315 | Ga0207697_10001553 | Ga0207697_100015534 | 175 |
| 279 | 3300025321 | Ga0207656_10023174 | Ga0207656_100231742 | 175 |
| 280 | 3300025735 | Ga0207713_1003344 | Ga0207713_10033445 | 175 |
| 281 | 3300025893 | Ga0207682_10003978 | Ga0207682_100039787 | 175 |
| 282 | 3300025900 | Ga0207710_10056697 | Ga0207710_100566972 | 175 |
| 283 | 3300025901 | Ga0207688_10026842 | Ga0207688_100268424 | 175 |
| 284 | 3300025904 | Ga0207647_10055333 | Ga0207647_100553332 | 175 |
| 285 | 3300025907 | Ga0207645_10012515 | Ga0207645_100125156 | 175 |
| 286 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021607 | 175 |
| 287 | 3300025909 | Ga0207705_10000397 | Ga0207705_100003979 | 175 |
| 288 | 3300025909 | Ga0207705_10001479 | Ga0207705_100014792 | 175 |
| 289 | 3300025912 | Ga0207707_10046798 | Ga0207707_100467983 | 175 |
| 290 | 3300025912 | Ga0207707_10114770 | Ga0207707_101147702 | 175 |
| 291 | 3300025912 | Ga0207707_10530690 | Ga0207707_105306902 | 175 |
| 292 | 3300025913 | Ga0207695_10000285 | Ga0207695_1000028559 | 175 |
| 293 | 3300025913 | Ga0207695_10134056 | Ga0207695_101340562 | 175 |
| 294 | 3300025913 | Ga0207695_10180319 | Ga0207695_101803193 | 175 |
| 295 | 3300025914 | Ga0207671_10007571 | Ga0207671_100075712 | 175 |
| 296 | 3300025914 | Ga0207671_10092953 | Ga0207671_100929533 | 175 |
| 297 | 3300025914 | Ga0207671_10183874 | Ga0207671_101838742 | 175 |
| 298 | 3300025917 | Ga0207660_10002232 | Ga0207660_100022329 | 175 |
| 299 | 3300025917 | Ga0207660_10040817 | Ga0207660_100408174 | 175 |
| 300 | 3300025919 | Ga0207657_10001100 | Ga0207657_1000110024 | 175 |
| 301 | 3300025919 | Ga0207657_10006640 | Ga0207657_100066408 | 175 |
| 302 | 3300025919 | Ga0207657_10044420 | Ga0207657_100444202 | 175 |
| 303 | 3300025919 | Ga0207657_10088426 | Ga0207657_100884262 | 175 |
| 304 | 3300025919 | Ga0207657_10096262 | Ga0207657_100962622 | 175 |
| 305 | 3300025919 | Ga0207657_10510332 | Ga0207657_105103321 | 175 |
| 306 | 3300025920 | Ga0207649_10000079 | Ga0207649_1000007927 | 175 |
| 307 | 3300025920 | Ga0207649_10000472 | Ga0207649_1000047217 | 175 |
| 308 | 3300025920 | Ga0207649_10009506 | Ga0207649_100095062 | 175 |
| 309 | 3300025920 | Ga0207649_10467794 | Ga0207649_104677942 | 175 |
| 310 | 3300025921 | Ga0207652_10000005 | Ga0207652_10000005201 | 175 |
| 311 | 3300025921 | Ga0207652_10000006 | Ga0207652_1000000680 | 175 |
| 312 | 3300025921 | Ga0207652_10000007 | Ga0207652_1000000781 | 175 |
| 313 | 3300025921 | Ga0207652_10000009 | Ga0207652_1000000941 | 175 |
| 314 | 3300025921 | Ga0207652_10001258 | Ga0207652_1000125822 | 175 |
| 315 | 3300025924 | Ga0207694_10024798 | Ga0207694_100247986 | 175 |
| 316 | 3300025924 | Ga0207694_10091803 | Ga0207694_100918032 | 175 |
| 317 | 3300025925 | Ga0207650_10000298 | Ga0207650_1000029841 | 175 |
| 318 | 3300025925 | Ga0207650_10003435 | Ga0207650_1000343514 | 175 |
| 319 | 3300025925 | Ga0207650_10087462 | Ga0207650_100874622 | 175 |
| 320 | 3300025926 | Ga0207659_10803635 | Ga0207659_108036352 | 175 |
| 321 | 3300025931 | Ga0207644_10227013 | Ga0207644_102270132 | 175 |
| 322 | 3300025931 | Ga0207644_10300102 | Ga0207644_103001022 | 175 |
| 323 | 3300025931 | Ga0207644_10726109 | Ga0207644_107261092 | 175 |
| 324 | 3300025932 | Ga0207690_10001240 | Ga0207690_1000124017 | 175 |
| 325 | 3300025932 | Ga0207690_10001443 | Ga0207690_100014436 | 175 |
| 326 | 3300025932 | Ga0207690_10061560 | Ga0207690_100615603 | 175 |
| 327 | 3300025932 | Ga0207690_10101896 | Ga0207690_101018962 | 175 |
| 328 | 3300025932 | Ga0207690_10190197 | Ga0207690_101901972 | 175 |
| 329 | 3300025932 | Ga0207690_10826154 | Ga0207690_108261542 | 175 |
| 330 | 3300025933 | Ga0207706_10001405 | Ga0207706_1000140520 | 175 |
| 331 | 3300025933 | Ga0207706_10005272 | Ga0207706_1000527216 | 175 |
| 332 | 3300025933 | Ga0207706_10015511 | Ga0207706_100155117 | 175 |
| 333 | 3300025933 | Ga0207706_10282040 | Ga0207706_102820402 | 175 |
| 334 | 3300025935 | Ga0207709_10000507 | Ga0207709_1000050723 | 175 |
| 335 | 3300025937 | Ga0207669_10000061 | Ga0207669_100000616 | 175 |
| 336 | 3300025937 | Ga0207669_10105603 | Ga0207669_101056032 | 175 |
| 337 | 3300025937 | Ga0207669_10404579 | Ga0207669_104045792 | 175 |
| 338 | 3300025937 | Ga0207669_10428830 | Ga0207669_104288302 | 175 |
| 339 | 3300025938 | Ga0207704_10050188 | Ga0207704_100501882 | 175 |
| 340 | 3300025938 | Ga0207704_10166657 | Ga0207704_101666573 | 175 |
| 341 | 3300025940 | Ga0207691_10000696 | Ga0207691_100006969 | 175 |
| 342 | 3300025940 | Ga0207691_10126278 | Ga0207691_101262782 | 175 |
| 343 | 3300025941 | Ga0207711_10000038 | Ga0207711_1000003888 | 175 |
| 344 | 3300025941 | Ga0207711_10319726 | Ga0207711_103197263 | 175 |
| 345 | 3300025944 | Ga0207661_11223701 | Ga0207661_112237012 | 175 |
| 346 | 3300025945 | Ga0207679_10324477 | Ga0207679_103244772 | 175 |
| 347 | 3300025949 | Ga0207667_10000107 | Ga0207667_1000010761 | 175 |
| 348 | 3300025949 | Ga0207667_10094958 | Ga0207667_100949583 | 175 |
| 349 | 3300025949 | Ga0207667_10112727 | Ga0207667_101127273 | 175 |
| 350 | 3300025960 | Ga0207651_10117002 | Ga0207651_101170023 | 175 |
| 351 | 3300025961 | Ga0207712_10001466 | Ga0207712_1000146616 | 175 |
| 352 | 3300025961 | Ga0207712_10114943 | Ga0207712_101149432 | 175 |
| 353 | 3300025972 | Ga0207668_10109474 | Ga0207668_101094744 | 175 |
| 354 | 3300025972 | Ga0207668_10142997 | Ga0207668_101429972 | 175 |
| 355 | 3300025972 | Ga0207668_10268042 | Ga0207668_102680424 | 175 |
| 356 | 3300025981 | Ga0207640_10003657 | Ga0207640_100036579 | 175 |
| 357 | 3300025981 | Ga0207640_10038215 | Ga0207640_100382153 | 175 |
| 358 | 3300025981 | Ga0207640_10096212 | Ga0207640_100962124 | 175 |
| 359 | 3300025981 | Ga0207640_10105808 | Ga0207640_101058084 | 175 |
| 360 | 3300025986 | Ga0207658_10000256 | Ga0207658_1000025626 | 175 |
| 361 | 3300025986 | Ga0207658_10031887 | Ga0207658_100318872 | 175 |
| 362 | 3300025986 | Ga0207658_10247214 | Ga0207658_102472142 | 175 |
| 363 | 3300026041 | Ga0207639_10000692 | Ga0207639_1000069211 | 175 |
| 364 | 3300026041 | Ga0207639_10137066 | Ga0207639_101370662 | 175 |
| 365 | 3300026067 | Ga0207678_10001575 | Ga0207678_100015756 | 175 |
| 366 | 3300026067 | Ga0207678_10002472 | Ga0207678_1000247211 | 175 |
| 367 | 3300026067 | Ga0207678_10086333 | Ga0207678_100863332 | 175 |
| 368 | 3300026075 | Ga0207708_10048265 | Ga0207708_100482653 | 175 |
| 369 | 3300026078 | Ga0207702_10007468 | Ga0207702_100074686 | 175 |
| 370 | 3300026078 | Ga0207702_10572967 | Ga0207702_105729672 | 175 |
| 371 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002734 | 175 |
| 372 | 3300026089 | Ga0207648_10039503 | Ga0207648_100395036 | 175 |
| 373 | 3300026089 | Ga0207648_10295073 | Ga0207648_102950733 | 175 |
| 374 | 3300026095 | Ga0207676_10000005 | Ga0207676_1000000573 | 175 |
| 375 | 3300026095 | Ga0207676_10144400 | Ga0207676_101444003 | 175 |
| 376 | 3300026095 | Ga0207676_10200499 | Ga0207676_102004992 | 175 |
| 377 | 3300026116 | Ga0207674_10266143 | Ga0207674_102661432 | 175 |
| 378 | 3300026118 | Ga0207675_100387570 | Ga0207675_1003875702 | 175 |
| 379 | 3300026121 | Ga0207683_10015483 | Ga0207683_100154836 | 175 |
| 380 | 3300026142 | Ga0207698_10193764 | Ga0207698_101937642 | 175 |
| 381 | 3300026142 | Ga0207698_10615747 | Ga0207698_106157472 | 175 |
| 382 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021888 | 175 |
| 383 | 3300028379 | Ga0268266_10013502 | Ga0268266_100135029 | 175 |
| 384 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003255 | 175 |
| 385 | 3300028380 | Ga0268265_10266783 | Ga0268265_102667832 | 175 |
| 386 | 3300028380 | Ga0268265_10335060 | Ga0268265_103350602 | 175 |
| 387 | 3300028381 | Ga0268264_10025669 | Ga0268264_100256695 | 175 |
| 388 | 3300028786 | Ga0307517_10027451 | Ga0307517_100274515 | 175 |
| 389 | 3300030745 | Ga0316182_1064081 | Ga0316182_10640812 | 175 |
| 390 | 3300031456 | Ga0307513_10008724 | Ga0307513_100087243 | 175 |
| 391 | 3300031548 | Ga0307408_100772636 | Ga0307408_1007726361 | 175 |
| 392 | 3300031548 | Ga0307408_101607055 | Ga0307408_1016070551 | 175 |
| 393 | 3300031731 | Ga0307405_10370888 | Ga0307405_103708882 | 175 |
| 394 | 3300031824 | Ga0307413_10000223 | Ga0307413_1000022311 | 175 |
| 395 | 3300031824 | Ga0307413_10092926 | Ga0307413_100929262 | 175 |
| 396 | 3300031852 | Ga0307410_10047077 | Ga0307410_100470772 | 175 |
| 397 | 3300031852 | Ga0307410_10154911 | Ga0307410_101549113 | 175 |
| 398 | 3300031852 | Ga0307410_10194099 | Ga0307410_101940992 | 175 |
| 399 | 3300031901 | Ga0307406_10149734 | Ga0307406_101497343 | 175 |
| 400 | 3300031901 | Ga0307406_10180566 | Ga0307406_101805661 | 175 |
| 401 | 3300031901 | Ga0307406_10313916 | Ga0307406_103139162 | 175 |
| 402 | 3300031903 | Ga0307407_10041510 | Ga0307407_100415102 | 175 |
| 403 | 3300031911 | Ga0307412_10095777 | Ga0307412_100957774 | 175 |
| 404 | 3300031911 | Ga0307412_10418891 | Ga0307412_104188912 | 175 |
| 405 | 3300031995 | Ga0307409_100030576 | Ga0307409_1000305764 | 175 |
| 406 | 3300031995 | Ga0307409_100087812 | Ga0307409_1000878122 | 175 |
| 407 | 3300031995 | Ga0307409_100179127 | Ga0307409_1001791272 | 175 |
| 408 | 3300031995 | Ga0307409_100763600 | Ga0307409_1007636002 | 175 |
| 409 | 3300032002 | Ga0307416_100041477 | Ga0307416_1000414773 | 175 |
| 410 | 3300032004 | Ga0307414_10054730 | Ga0307414_100547302 | 175 |
| 411 | 3300032004 | Ga0307414_10138424 | Ga0307414_101384244 | 175 |
| 412 | 3300032004 | Ga0307414_10191815 | Ga0307414_101918154 | 175 |
| 413 | 3300032004 | Ga0307414_10209628 | Ga0307414_102096282 | 175 |
| 414 | 3300032004 | Ga0307414_10473527 | Ga0307414_104735272 | 175 |
| 415 | 3300032004 | Ga0307414_10827845 | Ga0307414_108278452 | 175 |
| 416 | 3300032004 | Ga0307414_11322659 | Ga0307414_113226592 | 175 |
| 417 | 3300032005 | Ga0307411_10026369 | Ga0307411_100263692 | 175 |
| 418 | 3300032005 | Ga0307411_10082645 | Ga0307411_100826452 | 175 |
| 419 | 3300032005 | Ga0307411_10207172 | Ga0307411_102071722 | 175 |
| 420 | 3300032005 | Ga0307411_10433780 | Ga0307411_104337803 | 175 |
| 421 | 3300032005 | Ga0307411_10534446 | Ga0307411_105344462 | 175 |
| 422 | 3300032126 | Ga0307415_100238820 | Ga0307415_1002388203 | 175 |
| 423 | 3300037312 | Ga0395899_0000916 | Ga0395899_0000916_19880_20407 | 175 |
| 424 | 3300037418 | Ga0395900_0001285 | Ga0395900_0001285_20001_20528 | 175 |
| 425 | 3300037466 | Ga0395898_0001920 | Ga0395898_0001920_16633_17160 | 175 |
| 426 | 3300037471 | Ga0395905_0001547 | Ga0395905_0001547_19664_20191 | 175 |
| 427 | 3300038443 | Ga0395901_0000671 | Ga0395901_0000671_10101_10628 | 175 |
| 428 | 3300039437 | Ga0436365_1596642 | Ga0436365_1596642_9291_9866 | 175 |
| 429 | 3300042436 | Ga0439435_0165461 | Ga0439435_0165461_105_632 | 175 |
| 430 | 3300044684 | Ga0466966_0000027 | Ga0466966_0000027_17570_18118 | 175 |
| 431 | 3300045049 | Ga0466959_0149686 | Ga0466959_0149686_984_1559 | 175 |
| 432 | 3300046507 | Ga0495606_0029846 | Ga0495606_0029846_390_917 | 175 |
| 433 | 3300046507 | Ga0495606_0188956 | Ga0495606_0188956_259_786 | 175 |
| 434 | 3300046522 | Ga0495643_0066814 | Ga0495643_0066814_668_1195 | 175 |
| 435 | 3300046525 | Ga0495663_0115838 | Ga0495663_0115838_35_562 | 175 |
| 436 | 3300046537 | Ga0495598_0003391 | Ga0495598_0003391_401_928 | 175 |
| 437 | 3300046537 | Ga0495598_0041201 | Ga0495598_0041201_121_648 | 175 |
| 438 | 3300046539 | Ga0495621_0003234 | Ga0495621_0003234_3202_3729 | 175 |
| 439 | 3300046557 | Ga0495622_0023138 | Ga0495622_0023138_2070_2597 | 175 |
| 440 | 3300046660 | Ga0495625_0000221 | Ga0495625_0000221_85066_85593 | 175 |
| 441 | 3300046660 | Ga0495625_0065990 | Ga0495625_0065990_1899_2426 | 175 |
| 442 | 3300046684 | Ga0495669_0000159 | Ga0495669_0000159_31605_32132 | 175 |
| 443 | 3300046691 | Ga0495670_0022564 | Ga0495670_0022564_1165_1692 | 175 |
| 444 | 3300046691 | Ga0495670_0048982 | Ga0495670_0048982_563_1090 | 175 |
| 445 | 3300047445 | Ga0495677_0023183 | Ga0495677_0023183_1299_1826 | 175 |
| 446 | 3300048904 | Ga0496101_0071614 | Ga0496101_0071614_1538_2071 | 175 |
| 447 | 3300048905 | Ga0496102_0746163 | Ga0496102_0746163_139_678 | 175 |
| 448 | 3300048906 | Ga0496103_0228213 | Ga0496103_0228213_417_950 | 175 |
| 449 | 3300048920 | Ga0496117_0010075 | Ga0496117_0010075_6938_7471 | 175 |
| 450 | 3300048921 | Ga0496118_0000327 | Ga0496118_0000327_26032_26565 | 175 |
| 451 | 3300048921 | Ga0496118_0142492 | Ga0496118_0142492_273_812 | 175 |
| 452 | 3300048924 | Ga0496121_0014959 | Ga0496121_0014959_7356_7895 | 175 |
| 453 | 3300048924 | Ga0496121_0039648 | Ga0496121_0039648_217_756 | 175 |
| 454 | 3300048929 | Ga0496126_0020862 | Ga0496126_0020862_106_645 | 175 |
| 455 | 3300050510 | nmdc:mga06r32_10173_c1 | nmdc:mga06r32_10173_c1_2069_2599 | 175 |
| 456 | 3300050511 | nmdc:mga08y16_1441416_c1 | nmdc:mga08y16_1441416_c1_40_567 | 175 |
| 457 | 3300053119 | Ga0500595_000935 | Ga0500595_000935_5519_6046 | 175 |
| 458 | 3300053730 | Ga0500645_002731 | Ga0500645_002731_1567_2094 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kng-assembly1.cif.gz_A | crystal structure of ccmg reducing oxidoreductase at 1.14 a | 0.9329 | 39 | 175 |
| 2g0f-assembly1.cif.gz_A | crystal structure of p144a mutant of e.coli ccmg protein | 0.9134 | 32 | 174 |
| 2b1k-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9085 | 32 | 174 |
| 3kh9-assembly1.cif.gz_A | crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa | 0.8956 | 34 | 174 |
| 3k8n-assembly1.cif.gz_A | crystal structure of e. coli ccmg | 0.8837 | 27 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9329 | 39 | 175 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9085 | 32 | 174 | 3.40.30.10 |
| 1kngA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8836 | 39 | 175 | 3.40.30.10 |
| 3iosA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8702 | 43 | 171 | 3.40.30.10 |
| 2b1kA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8683 | 32 | 174 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JFX6-F1-model_v4 | DsbE family thiol:disulfide interchange protein | 0.9789 | 70 | 175 |
GO:0016491
GO:0017004 |
| AF-A0A2W4YS53-F1-model_v4 | deleted | 0.9783 | 41 | 175 |
|
| AF-A0A7Y1T832-F1-model_v4 | deleted | 0.9771 | 7 | 175 |
|
| AF-A0A2W4YS53-F1-model_v4 | deleted | 0.9712 | 41 | 175 |
|
| AF-F1ZCJ6-F1-model_v4 | Periplasmic protein thiol | 0.9671 | 2 | 174 |
GO:0015036
GO:0016020 GO:0017004 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar