F448202

General Info

Members Datasets Scaffolds Average Seq Length
458 225 457 175

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10314148|Ga0207660_103141483
Length 220
Sequence MTDSRVGQPLFFAKSLSAAQVARLVAGIEEALDVDVVEFTGDAGGDVMRWLLWLPLALFALIIAVVMSGLIHPASTDIRSQLVGKPLPEFALPAGVPSHPPLAKADLRGGPRLINIFASWCLPCAVEAPQLMVLKRAGVVIDGIAIRDRPEDLAAFLARYGDPYSRIGSDANSRVQLALGSSGVPESFVVDGRGVIRLQHIGDIREENIPTILAAIEAAK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
221 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
222 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 2.18
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008122 3300001915 Bacteria 1995
2 JGI24741J21665_1009364 3300001915 Bacteria 1802
3 JGI24752J21851_1000242 3300001976 Bacteria 7530
4 JGI24740J21852_10011002 3300001979 Bacteria 3459
5 JGI24740J21852_10011194 3300001979 Bacteria 3423
6 JGI24737J22298_10002896 3300001990 Bacteria 6085
7 JGI24742J22300_10012191 3300002244 Bacteria 1431
8 JGI25153J46596_10000002 3300003215 Bacteria 653569
9 rootH1_10192496 3300003323 Bacteria 1011
10 Ga0055525_1000104 3300003759 Bacteria 134560
11 Ga0055542_1000037 3300003762 Bacteria 225640
12 Ga0055529_1000042 3300003763 Bacteria 225663
13 Ga0065704_10073578 3300005289 Bacteria 6987
14 Ga0065715_10003484 3300005293 Bacteria 5985
15 Ga0065715_10205784 3300005293 Bacteria 1338
16 Ga0070658_10000001 3300005327 Bacteria 856789
17 Ga0070658_10005620 3300005327 Bacteria 10170
18 Ga0070658_10140211 3300005327 Bacteria 2019
19 Ga0070676_10119402 3300005328 Bacteria 1653
20 Ga0070683_100053304 3300005329 Bacteria 3748
21 Ga0070683_100245806 3300005329 Bacteria 1702
22 Ga0070670_100000021 3300005331 Bacteria 202776
23 Ga0070670_100016348 3300005331 Bacteria 6372
24 Ga0070670_100024180 3300005331 Bacteria 5227
25 Ga0070677_10001614 3300005333 Bacteria 7126
26 Ga0070680_100000587 3300005336 Bacteria 25132
27 Ga0070680_100043759 3300005336 Bacteria 3637
28 Ga0070680_100091068 3300005336 Bacteria 2524
29 Ga0070660_100000441 3300005339 Bacteria 27579
30 Ga0070660_100004924 3300005339 Bacteria 9236
31 Ga0070660_100014616 3300005339 Bacteria 5662
32 Ga0070660_100159900 3300005339 Bacteria 1815
33 Ga0070661_100000028 3300005344 Bacteria 117932
34 Ga0070661_100031923 3300005344 Bacteria 3810
35 Ga0070661_100226022 3300005344 Bacteria 1437
36 Ga0070661_100414549 3300005344 Bacteria 1067
37 Ga0070692_10001382 3300005345 Bacteria 8772
38 Ga0070692_10067412 3300005345 Bacteria 1900
39 Ga0070668_100009253 3300005347 Bacteria 7306
40 Ga0070668_100010572 3300005347 Bacteria 6865
41 Ga0070669_100000937 3300005353 Bacteria 21274
42 Ga0070675_100001185 3300005354 Bacteria 18941
43 Ga0070671_100236372 3300005355 Bacteria 1551
44 Ga0070671_100307630 3300005355 Bacteria 1350
45 Ga0070671_101079424 3300005355 Bacteria 705
46 Ga0070674_100009326 3300005356 Bacteria 5874
47 Ga0070674_100009392 3300005356 Bacteria 5855
48 Ga0070674_100049058 3300005356 Bacteria 2901
49 Ga0070674_100356658 3300005356 Bacteria 1183
50 Ga0070673_100045471 3300005364 Bacteria 3405
51 Ga0070673_100204735 3300005364 Bacteria 1701
52 Ga0070688_100704503 3300005365 Bacteria 782
53 Ga0070659_100041715 3300005366 Bacteria 3588
54 Ga0070659_100042737 3300005366 Bacteria 3544
55 Ga0070659_100043718 3300005366 Bacteria 3504
56 Ga0070659_100083428 3300005366 Bacteria 2554
57 Ga0070659_100088185 3300005366 Bacteria 2484
58 Ga0070667_100000221 3300005367 Bacteria 65664
59 Ga0070667_100042504 3300005367 Bacteria 3813
60 Ga0070667_100127963 3300005367 Bacteria 2215
61 Ga0070700_100087528 3300005441 Bacteria 2025
62 Ga0070663_100007682 3300005455 Bacteria 6583
63 Ga0070663_100123227 3300005455 Bacteria 1960
64 Ga0070663_100277369 3300005455 Bacteria 1335
65 Ga0070663_100290313 3300005455 Bacteria 1306
66 Ga0070678_100005834 3300005456 Bacteria 7164
67 Ga0070678_100076643 3300005456 Bacteria 2519
68 Ga0070662_100004518 3300005457 Bacteria 8816
69 Ga0070662_100062222 3300005457 Bacteria 2726
70 Ga0070662_100087326 3300005457 Bacteria 2334
71 Ga0070662_100344075 3300005457 Bacteria 1220
72 Ga0070662_100872980 3300005457 Bacteria 767
73 Ga0070681_10033289 3300005458 Bacteria 5174
74 Ga0070681_10085836 3300005458 Bacteria 3100
75 Ga0070681_10598544 3300005458 Bacteria 1017
76 Ga0068867_100150593 3300005459 Bacteria 1827
77 Ga0070679_100000010 3300005530 Bacteria 166632
78 Ga0070679_100084102 3300005530 Bacteria 3170
79 Ga0070679_100215445 3300005530 Bacteria 1883
80 Ga0068853_100072459 3300005539 Bacteria 3002
81 Ga0068853_100174604 3300005539 Bacteria 1946
82 Ga0070672_100047162 3300005543 Bacteria 3343
83 Ga0070672_100089372 3300005543 Bacteria 2482
84 Ga0070672_100785584 3300005543 Bacteria 837
85 Ga0070665_100002410 3300005548 Bacteria 20612
86 Ga0068855_100036336 3300005563 Bacteria 5864
87 Ga0068855_100120630 3300005563 Bacteria 3001
88 Ga0068855_100317368 3300005563 Bacteria 1723
89 Ga0068855_101049947 3300005563 Bacteria 854
90 Ga0070664_100086710 3300005564 Bacteria 2705
91 Ga0070664_100166266 3300005564 Bacteria 1955
92 Ga0068854_100009240 3300005578 Bacteria 6360
93 Ga0068854_100055840 3300005578 Bacteria 2845
94 Ga0068854_100137243 3300005578 Bacteria 1873
95 Ga0068854_100208171 3300005578 Bacteria 1541
96 Ga0068854_101164493 3300005578 Bacteria 689
97 Ga0068856_101021232 3300005614 Bacteria 845
98 Ga0068852_100293930 3300005616 Bacteria 1570
99 Ga0068852_100879884 3300005616 Unclassified 912
100 Ga0068859_100013822 3300005617 Bacteria 8095
101 Ga0068859_100314660 3300005617 Bacteria 1659
102 Ga0068864_100000004 3300005618 Bacteria 489341
103 Ga0068864_100090561 3300005618 Bacteria 2697
104 Ga0068864_100111865 3300005618 Bacteria 2433
105 Ga0068864_100394580 3300005618 Bacteria 1314
106 Ga0068861_100317448 3300005719 Bacteria 1356
107 Ga0068851_10032579 3300005834 Bacteria 2593
108 Ga0068863_100000002 3300005841 Bacteria 489510
109 Ga0068862_100000002 3300005844 Bacteria 489341
110 Ga0068862_100358717 3300005844 Bacteria 1354
111 Ga0068862_100364278 3300005844 Bacteria 1344
112 Ga0068862_100465937 3300005844 Bacteria 1193
113 Ga0068862_100873135 3300005844 Bacteria 883
114 Ga0075366_10284255 3300006195 Bacteria 1011
115 Ga0097621_100107713 3300006237 Bacteria 2352
116 Ga0075430_101024091 3300006846 Bacteria 680
117 Ga0068865_100012798 3300006881 Bacteria 5289
118 Ga0068865_100203858 3300006881 Bacteria 1537
119 Ga0097620_100013822 3300006931 Bacteria 8095
120 Ga0097620_100314679 3300006931 Bacteria 1659
121 Ga0105251_10002504 3300009011 Bacteria 14365
122 Ga0105240_10000433 3300009093 Bacteria 77418
123 Ga0105240_10168812 3300009093 Bacteria 2593
124 Ga0105240_10638380 3300009093 Bacteria 1168
125 Ga0111539_10024750 3300009094 Bacteria 7362
126 Ga0111539_12217497 3300009094 Bacteria 637
127 Ga0105247_10106507 3300009101 Bacteria 1799
128 Ga0105243_10000082 3300009148 Bacteria 108252
129 Ga0105241_10049342 3300009174 Bacteria 3205
130 Ga0105242_10670270 3300009176 Bacteria 1011
131 Ga0105248_10000010 3300009177 Bacteria 344314
132 Ga0105248_10039462 3300009177 Bacteria 5288
133 Ga0105248_10099642 3300009177 Bacteria 3274
134 Ga0105237_10199980 3300009545 Bacteria 1998
135 Ga0105237_10437664 3300009545 Bacteria 1313
136 Ga0105238_10257043 3300009551 Bacteria 1726
137 Ga0105238_10557265 3300009551 Bacteria 1151
138 Ga0105249_10000122 3300009553 Bacteria 105623
139 Ga0105249_10113449 3300009553 Bacteria 2564
140 Ga0105239_10000279 3300010375 Bacteria 75291
141 Ga0105239_10908777 3300010375 Bacteria 1011
142 Ga0157373_10187693 3300013100 Bacteria 1456
143 Ga0157371_10000183 3300013102 Bacteria 92426
144 Ga0157369_10069615 3300013105 Bacteria 3780
145 Ga0157369_10072097 3300013105 Bacteria 3707
146 Ga0157374_12395875 3300013296 Bacteria 555
147 Ga0163162_10047626 3300013306 Bacteria 4296
148 Ga0163162_10208264 3300013306 Bacteria 2085
149 Ga0157375_10620561 3300013308 Bacteria 1239
150 Ga0163163_10305346 3300014325 Bacteria 1644
151 Ga0157380_10004293 3300014326 Bacteria 9874
152 Ga0157380_10111187 3300014326 Bacteria 2303
153 Ga0157380_10407059 3300014326 Bacteria 1293
154 Ga0182008_10247646 3300014497 Bacteria 918
155 Ga0157379_10025566 3300014968 Bacteria 5246
156 Ga0157376_10604446 3300014969 Bacteria 1092
157 Ga0163161_10044597 3300017792 Bacteria 3194
158 Ga0213876_10000766 3300021384 Bacteria 22166
159 Ga0209563_100116 3300025230 Bacteria 134661
160 Ga0209026_1013842 3300025250 Bacteria 1362
161 Ga0209677_108619 3300025253 Bacteria 1946
162 Ga0209148_1000026 3300025254 Bacteria 629213
163 Ga0209233_1021259 3300025261 Bacteria 1684
164 Ga0209455_1000005 3300025272 Bacteria 1416756
165 Ga0209455_1012760 3300025272 Bacteria 1990
166 Ga0209758_1000001 3300025297 Bacteria 1981790
167 Ga0209758_1132548 3300025297 Bacteria 657
168 Ga0207697_10001553 3300025315 Bacteria 12409
169 Ga0207656_10023174 3300025321 Bacteria 2497
170 Ga0207713_1003344 3300025735 Bacteria 11010
171 Ga0207682_10003978 3300025893 Bacteria 6292
172 Ga0207710_10056697 3300025900 Bacteria 1768
173 Ga0207688_10026842 3300025901 Bacteria 3168
174 Ga0207688_10053916 3300025901 Bacteria 2255
175 Ga0207647_10055333 3300025904 Bacteria 2439
176 Ga0207645_10012515 3300025907 Bacteria 5754
177 Ga0207705_10000002 3300025909 Bacteria 2046852
178 Ga0207705_10000397 3300025909 Bacteria 38200
179 Ga0207705_10001479 3300025909 Bacteria 18709
180 Ga0207707_10046798 3300025912 Bacteria 3768
181 Ga0207707_10114770 3300025912 Bacteria 2354
182 Ga0207707_10530690 3300025912 Bacteria 1001
183 Ga0207695_10000285 3300025913 Bacteria 125917
184 Ga0207695_10134056 3300025913 Bacteria 2432
185 Ga0207695_10180319 3300025913 Bacteria 2033
186 Ga0207671_10007571 3300025914 Bacteria 9404
187 Ga0207671_10092953 3300025914 Bacteria 2275
188 Ga0207671_10183874 3300025914 Bacteria 1628
189 Ga0207660_10002232 3300025917 Bacteria 12807
190 Ga0207660_10040817 3300025917 Bacteria 3250
191 Ga0207660_10314148 3300025917 Bacteria 1250
192 Ga0207657_10001100 3300025919 Bacteria 28711
193 Ga0207657_10006640 3300025919 Bacteria 11974
194 Ga0207657_10044420 3300025919 Bacteria 3906
195 Ga0207657_10088426 3300025919 Bacteria 2589
196 Ga0207657_10096262 3300025919 Bacteria 2462
197 Ga0207657_10510332 3300025919 Bacteria 941
198 Ga0207649_10000079 3300025920 Bacteria 82899
199 Ga0207649_10000472 3300025920 Bacteria 28723
200 Ga0207649_10009506 3300025920 Bacteria 5321
201 Ga0207649_10467794 3300025920 Bacteria 954
202 Ga0207652_10000005 3300025921 Bacteria 343384
203 Ga0207652_10000006 3300025921 Bacteria 302991
204 Ga0207652_10000007 3300025921 Bacteria 301303
205 Ga0207652_10000009 3300025921 Bacteria 257234
206 Ga0207652_10001258 3300025921 Bacteria 22543
207 Ga0207694_10024798 3300025924 Bacteria 4555
208 Ga0207694_10091803 3300025924 Bacteria 2396
209 Ga0207650_10000298 3300025925 Bacteria 49421
210 Ga0207650_10003435 3300025925 Bacteria 10893
211 Ga0207650_10087462 3300025925 Bacteria 2374
212 Ga0207659_10803635 3300025926 Bacteria 808
213 Ga0207644_10227013 3300025931 Bacteria 1482
214 Ga0207644_10300102 3300025931 Bacteria 1294
215 Ga0207644_10726109 3300025931 Bacteria 829
216 Ga0207690_10001240 3300025932 Bacteria 16125
217 Ga0207690_10001443 3300025932 Bacteria 14876
218 Ga0207690_10061560 3300025932 Bacteria 2552
219 Ga0207690_10101896 3300025932 Bacteria 2052
220 Ga0207690_10190197 3300025932 Bacteria 1552
221 Ga0207690_10826154 3300025932 Bacteria 766
222 Ga0207706_10001405 3300025933 Bacteria 24086
223 Ga0207706_10005272 3300025933 Bacteria 12055
224 Ga0207706_10015511 3300025933 Bacteria 6885
225 Ga0207706_10282040 3300025933 Bacteria 1449
226 Ga0207709_10000507 3300025935 Bacteria 34401
227 Ga0207669_10000061 3300025937 Bacteria 54347
228 Ga0207669_10002470 3300025937 Bacteria 7884
229 Ga0207669_10105603 3300025937 Bacteria 1874
230 Ga0207669_10404579 3300025937 Bacteria 1070
231 Ga0207669_10428830 3300025937 Bacteria 1043
232 Ga0207704_10050188 3300025938 Bacteria 2515
233 Ga0207704_10166657 3300025938 Bacteria 1575
234 Ga0207691_10000696 3300025940 Bacteria 33255
235 Ga0207691_10126278 3300025940 Bacteria 2263
236 Ga0207711_10000038 3300025941 Bacteria 163520
237 Ga0207711_10319726 3300025941 Bacteria 1434
238 Ga0207661_11223701 3300025944 Bacteria 691
239 Ga0207679_10324477 3300025945 Bacteria 1334
240 Ga0207667_10000107 3300025949 Bacteria 133066
241 Ga0207667_10094958 3300025949 Bacteria 3078
242 Ga0207667_10112727 3300025949 Bacteria 2804
243 Ga0207651_10050555 3300025960 Bacteria 2823
244 Ga0207651_10117002 3300025960 Bacteria 2013
245 Ga0207712_10001466 3300025961 Bacteria 16096
246 Ga0207712_10114943 3300025961 Bacteria 2025
247 Ga0207668_10109474 3300025972 Bacteria 2069
248 Ga0207668_10142997 3300025972 Bacteria 1842
249 Ga0207668_10268042 3300025972 Bacteria 1395
250 Ga0207640_10003657 3300025981 Bacteria 8295
251 Ga0207640_10038215 3300025981 Bacteria 3027
252 Ga0207640_10096212 3300025981 Bacteria 2064
253 Ga0207640_10105808 3300025981 Bacteria 1983
254 Ga0207658_10000256 3300025986 Bacteria 55417
255 Ga0207658_10031887 3300025986 Bacteria 3747
256 Ga0207658_10247214 3300025986 Bacteria 1514
257 Ga0207639_10000692 3300026041 Bacteria 23191
258 Ga0207639_10137066 3300026041 Bacteria 2034
259 Ga0207639_10145473 3300026041 Bacteria 1980
260 Ga0207678_10001575 3300026067 Bacteria 20968
261 Ga0207678_10002472 3300026067 Bacteria 16788
262 Ga0207678_10086333 3300026067 Bacteria 2682
263 Ga0207708_10048265 3300026075 Bacteria 3241
264 Ga0207702_10007468 3300026078 Bacteria 9323
265 Ga0207702_10572967 3300026078 Bacteria 1106
266 Ga0207641_10000002 3300026088 Bacteria 981004
267 Ga0207648_10039503 3300026089 Bacteria 4149
268 Ga0207648_10295073 3300026089 Bacteria 1452
269 Ga0207676_10000005 3300026095 Bacteria 698744
270 Ga0207676_10144400 3300026095 Bacteria 2042
271 Ga0207676_10200499 3300026095 Bacteria 1763
272 Ga0207674_10266143 3300026116 Bacteria 1662
273 Ga0207675_100387570 3300026118 Bacteria 1375
274 Ga0207683_10015483 3300026121 Bacteria 6495
275 Ga0207683_10173269 3300026121 Bacteria 1955
276 Ga0207698_10193764 3300026142 Bacteria 1813
277 Ga0207698_10615747 3300026142 Bacteria 1072
278 Ga0268266_10000002 3300028379 Bacteria 3059047
279 Ga0268266_10013502 3300028379 Bacteria 7031
280 Ga0268265_10000003 3300028380 Bacteria 949201
281 Ga0268265_10266783 3300028380 Bacteria 1525
282 Ga0268265_10335060 3300028380 Bacteria 1375
283 Ga0268264_10025669 3300028381 Bacteria 4813
284 Ga0307517_10027451 3300028786 Bacteria 6838
285 Ga0316182_1064081 3300030745 Bacteria 2674
286 Ga0307513_10008724 3300031456 Bacteria 12912
287 Ga0307408_100023121 3300031548 Bacteria 4231
288 Ga0307408_100139021 3300031548 Bacteria 1904
289 Ga0307408_100152759 3300031548 Bacteria 1824
290 Ga0307408_100595169 3300031548 Bacteria 982
291 Ga0307408_100772636 3300031548 Bacteria 870
292 Ga0307408_101607055 3300031548 Bacteria 617
293 Ga0307405_10294867 3300031731 Bacteria 1227
294 Ga0307405_10370888 3300031731 Bacteria 1111
295 Ga0307413_10000223 3300031824 Bacteria 16635
296 Ga0307413_10092926 3300031824 Bacteria 1970
297 Ga0307413_10133015 3300031824 Bacteria 1705
298 Ga0307413_10165558 3300031824 Bacteria 1559
299 Ga0307413_10174893 3300031824 Bacteria 1524
300 Ga0307413_10354637 3300031824 Bacteria 1133
301 Ga0307413_10919256 3300031824 Bacteria 744
302 Ga0307410_10047077 3300031852 Bacteria 2880
303 Ga0307410_10075530 3300031852 Bacteria 2349
304 Ga0307410_10154911 3300031852 Bacteria 1710
305 Ga0307410_10156601 3300031852 Bacteria 1702
306 Ga0307410_10194099 3300031852 Bacteria 1546
307 Ga0307406_10149734 3300031901 Bacteria 1663
308 Ga0307406_10180566 3300031901 Bacteria 1536
309 Ga0307406_10313916 3300031901 Bacteria 1210
310 Ga0307406_10384608 3300031901 Bacteria 1107
311 Ga0307407_10041510 3300031903 Bacteria 2573
312 Ga0307407_10056086 3300031903 Bacteria 2279
313 Ga0307407_10100801 3300031903 Bacteria 1792
314 Ga0307407_10335651 3300031903 Bacteria 1065
315 Ga0307407_10624909 3300031903 Bacteria 804
316 Ga0307412_10037457 3300031911 Bacteria 3116
317 Ga0307412_10095777 3300031911 Bacteria 2087
318 Ga0307412_10114454 3300031911 Bacteria 1931
319 Ga0307412_10149968 3300031911 Bacteria 1719
320 Ga0307412_10154007 3300031911 Bacteria 1699
321 Ga0307412_10418891 3300031911 Bacteria 1095
322 Ga0307412_10890768 3300031911 Bacteria 779
323 Ga0307412_11169767 3300031911 Bacteria 687
324 Ga0307409_100030576 3300031995 Bacteria 3871
325 Ga0307409_100087812 3300031995 Bacteria 2536
326 Ga0307409_100179127 3300031995 Bacteria 1874
327 Ga0307409_100741281 3300031995 Bacteria 985
328 Ga0307409_100762465 3300031995 Bacteria 972
329 Ga0307409_100763600 3300031995 Bacteria 971
330 Ga0307409_100992263 3300031995 Bacteria 857
331 Ga0307416_100041477 3300032002 Bacteria 3585
332 Ga0307416_100145275 3300032002 Bacteria 2164
333 Ga0307414_10054730 3300032004 Bacteria 2790
334 Ga0307414_10101496 3300032004 Bacteria 2166
335 Ga0307414_10138424 3300032004 Bacteria 1902
336 Ga0307414_10191815 3300032004 Bacteria 1654
337 Ga0307414_10202474 3300032004 Bacteria 1616
338 Ga0307414_10209628 3300032004 Bacteria 1591
339 Ga0307414_10239016 3300032004 Bacteria 1502
340 Ga0307414_10285225 3300032004 Bacteria 1389
341 Ga0307414_10376913 3300032004 Bacteria 1225
342 Ga0307414_10473527 3300032004 Bacteria 1103
343 Ga0307414_10827845 3300032004 Bacteria 845
344 Ga0307414_11322659 3300032004 Bacteria 669
345 Ga0307411_10002034 3300032005 Bacteria 8674
346 Ga0307411_10026369 3300032005 Bacteria 3499
347 Ga0307411_10033317 3300032005 Bacteria 3194
348 Ga0307411_10082645 3300032005 Bacteria 2216
349 Ga0307411_10207172 3300032005 Bacteria 1511
350 Ga0307411_10433780 3300032005 Bacteria 1095
351 Ga0307411_10534446 3300032005 Bacteria 997
352 Ga0307411_10655816 3300032005 Bacteria 909
353 Ga0307411_11015152 3300032005 Bacteria 743
354 Ga0307415_100188951 3300032126 Bacteria 1624
355 Ga0307415_100189070 3300032126 Bacteria 1623
356 Ga0307415_100238820 3300032126 Bacteria 1468
357 Ga0307415_100507566 3300032126 Bacteria 1055
358 Ga0307415_100785662 3300032126 Bacteria 867
359 Ga0307415_101251112 3300032126 Bacteria 701
360 Ga0395899_0000916 3300037312 Bacteria 27731
361 Ga0395899_0060887 3300037312 Bacteria 2781
362 Ga0395900_0001285 3300037418 Bacteria 30628
363 Ga0395898_0001920 3300037466 Bacteria 26462
364 Ga0395905_0001547 3300037471 Bacteria 27515
365 Ga0395901_0000671 3300038443 Bacteria 39338
366 Ga0436365_1596642 3300039437 Bacteria 39428
367 Ga0439435_0165461 3300042436 Bacteria 716
368 Ga0466966_0000027 3300044684 Bacteria 106520
369 Ga0466959_0149686 3300045049 Bacteria 1646
370 Ga0495638_0129332 3300046460 Bacteria 1485
371 Ga0495650_0000461 3300046471 Bacteria 63382
372 Ga0495584_0051595 3300046491 Bacteria 2071
373 Ga0495585_0058227 3300046492 Bacteria 2131
374 Ga0495596_0006245 3300046500 Bacteria 5514
375 Ga0495583_0001174 3300046506 Bacteria 28270
376 Ga0495583_0007203 3300046506 Bacteria 7057
377 Ga0495583_0016431 3300046506 Bacteria 3978
378 Ga0495606_0003980 3300046507 Bacteria 15126
379 Ga0495606_0029846 3300046507 Bacteria 3821
380 Ga0495606_0188956 3300046507 Bacteria 1182
381 Ga0495610_0211225 3300046512 Bacteria 789
382 Ga0495616_0231304 3300046513 Bacteria 801
383 Ga0495631_0066205 3300046518 Bacteria 1563
384 Ga0495632_0230633 3300046519 Bacteria 835
385 Ga0495637_0041615 3300046520 Bacteria 1970
386 Ga0495643_0006051 3300046522 Bacteria 8060
387 Ga0495643_0006635 3300046522 Bacteria 7600
388 Ga0495643_0035015 3300046522 Bacteria 2766
389 Ga0495643_0066814 3300046522 Bacteria 1895
390 Ga0495648_0000111 3300046524 Bacteria 100648
391 Ga0495663_0000530 3300046525 Bacteria 13684
392 Ga0495663_0115838 3300046525 Bacteria 894
393 Ga0495642_0004819 3300046528 Bacteria 5214
394 Ga0495598_0003391 3300046537 Bacteria 3382
395 Ga0495598_0041201 3300046537 Bacteria 1350
396 Ga0495609_0045108 3300046538 Bacteria 1976
397 Ga0495621_0003234 3300046539 Bacteria 4477
398 Ga0495622_0023138 3300046557 Bacteria 2896
399 Ga0495633_0035401 3300046558 Bacteria 2397
400 Ga0495668_0000325 3300046616 Bacteria 65404
401 Ga0495611_0036929 3300046648 Bacteria 2170
402 Ga0495611_0069142 3300046648 Bacteria 1613
403 Ga0495625_0000221 3300046660 Bacteria 90175
404 Ga0495625_0065990 3300046660 Bacteria 2550
405 Ga0495669_0000159 3300046684 Bacteria 43128
406 Ga0495670_0022564 3300046691 Bacteria 3108
407 Ga0495670_0048982 3300046691 Bacteria 2113
408 Ga0495671_0160406 3300046692 Bacteria 1094
409 Ga0495660_0047010 3300046810 Bacteria 2365
410 Ga0495683_0004709 3300047323 Bacteria 7671
411 Ga0495683_0058042 3300047323 Bacteria 1923
412 Ga0495687_000089 3300047443 Bacteria 141448
413 Ga0495687_001092 3300047443 Bacteria 26544
414 Ga0495677_0011904 3300047445 Bacteria 3175
415 Ga0495677_0023183 3300047445 Bacteria 2253
416 Ga0495681_0005617 3300047470 Bacteria 8363
417 Ga0495681_0088038 3300047470 Bacteria 1376
418 Ga0496101_0071614 3300048904 Bacteria 2542
419 Ga0496102_0000067 3300048905 Bacteria 156790
420 Ga0496102_0746163 3300048905 Bacteria 902
421 Ga0496103_0000222 3300048906 Bacteria 56372
422 Ga0496103_0228213 3300048906 Bacteria 1197
423 Ga0496104_0003479 3300048907 Bacteria 13583
424 Ga0496105_0000662 3300048908 Bacteria 23132
425 Ga0496110_0012321 3300048913 Bacteria 7029
426 Ga0496114_0007367 3300048917 Bacteria 8693
427 Ga0496115_0000056 3300048918 Bacteria 104434
428 Ga0496116_0039774 3300048919 Bacteria 3246
429 Ga0496117_0000114 3300048920 Bacteria 180658
430 Ga0496117_0010075 3300048920 Bacteria 8679
431 Ga0496118_0000082 3300048921 Bacteria 185820
432 Ga0496118_0000327 3300048921 Bacteria 82033
433 Ga0496118_0142492 3300048921 Bacteria 1516
434 Ga0496119_0004578 3300048922 Bacteria 13669
435 Ga0496120_0040137 3300048923 Bacteria 2753
436 Ga0496121_0000344 3300048924 Bacteria 96865
437 Ga0496121_0014959 3300048924 Bacteria 8173
438 Ga0496121_0039648 3300048924 Bacteria 4145
439 Ga0496122_0018243 3300048925 Bacteria 6497
440 Ga0496123_0033485 3300048926 Bacteria 3697
441 Ga0496124_0000068 3300048927 Bacteria 221819
442 Ga0496125_0002303 3300048928 Bacteria 25208
443 Ga0496126_0000157 3300048929 Bacteria 156203
444 Ga0496126_0020862 3300048929 Bacteria 6414
445 nmdc:mga0k408_593036_c1 3300050493 Bacteria 654
446 nmdc:mga06r32_10173_c1 3300050510 Bacteria 8491
447 nmdc:mga08y16_1441416_c1 3300050511 Bacteria 651
448 Ga0500610_0000206 3300053079 Bacteria 18104
449 Ga0500643_045054 3300053087 Bacteria 1279
450 Ga0500583_0211290 3300053092 Bacteria 963
451 Ga0500595_000935 3300053119 Bacteria 16547
452 Ga0500642_0000817 3300053130 Bacteria 9122
453 Ga0500619_023512 3300053154 Bacteria 1802
454 Ga0500636_0007450 3300053177 Bacteria 6336
455 Ga0500645_000585 3300053730 Bacteria 23518
456 Ga0500645_002731 3300053730 Bacteria 7658
457 Ga0500596_000088 3300053735 Bacteria 12460

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_12395875 Ga0157374_123958751 168
2 iso_pu_bacteria 8057101203 8057105703 171
3 3300037312 Ga0395899_0060887 Ga0395899_0060887_1101_1619 172
4 3300046460 Ga0495638_0129332 Ga0495638_0129332_884_1402 172
5 3300046471 Ga0495650_0000461 Ga0495650_0000461_30726_31244 172
6 3300046491 Ga0495584_0051595 Ga0495584_0051595_868_1386 172
7 3300046492 Ga0495585_0058227 Ga0495585_0058227_1112_1630 172
8 3300046500 Ga0495596_0006245 Ga0495596_0006245_2656_3174 172
9 3300046506 Ga0495583_0001174 Ga0495583_0001174_18934_19452 172
10 3300046506 Ga0495583_0007203 Ga0495583_0007203_1648_2166 172
11 3300046506 Ga0495583_0016431 Ga0495583_0016431_1308_1826 172
12 3300046507 Ga0495606_0003980 Ga0495606_0003980_2609_3127 172
13 3300046512 Ga0495610_0211225 Ga0495610_0211225_114_632 172
14 3300046513 Ga0495616_0231304 Ga0495616_0231304_80_598 172
15 3300046518 Ga0495631_0066205 Ga0495631_0066205_686_1204 172
16 3300046519 Ga0495632_0230633 Ga0495632_0230633_81_599 172
17 3300046520 Ga0495637_0041615 Ga0495637_0041615_921_1439 172
18 3300046522 Ga0495643_0006051 Ga0495643_0006051_4781_5299 172
19 3300046522 Ga0495643_0006635 Ga0495643_0006635_2652_3170 172
20 3300046522 Ga0495643_0035015 Ga0495643_0035015_677_1195 172
21 3300046524 Ga0495648_0000111 Ga0495648_0000111_21413_21931 172
22 3300046525 Ga0495663_0000530 Ga0495663_0000530_666_1184 172
23 3300046528 Ga0495642_0004819 Ga0495642_0004819_1576_2094 172
24 3300046538 Ga0495609_0045108 Ga0495609_0045108_552_1070 172
25 3300046558 Ga0495633_0035401 Ga0495633_0035401_963_1481 172
26 3300046616 Ga0495668_0000325 Ga0495668_0000325_59300_59818 172
27 3300046648 Ga0495611_0036929 Ga0495611_0036929_1572_2090 172
28 3300046648 Ga0495611_0069142 Ga0495611_0069142_206_724 172
29 3300046692 Ga0495671_0160406 Ga0495671_0160406_69_587 172
30 3300046810 Ga0495660_0047010 Ga0495660_0047010_241_759 172
31 3300047323 Ga0495683_0004709 Ga0495683_0004709_1165_1683 172
32 3300047323 Ga0495683_0058042 Ga0495683_0058042_238_756 172
33 3300047443 Ga0495687_000089 Ga0495687_000089_4895_5413 172
34 3300047443 Ga0495687_001092 Ga0495687_001092_2656_3174 172
35 3300047445 Ga0495677_0011904 Ga0495677_0011904_1489_2007 172
36 3300047470 Ga0495681_0005617 Ga0495681_0005617_6096_6614 172
37 3300047470 Ga0495681_0088038 Ga0495681_0088038_385_903 172
38 3300048905 Ga0496102_0000067 Ga0496102_0000067_143731_144249 172
39 3300048906 Ga0496103_0000222 Ga0496103_0000222_54568_55086 172
40 3300048907 Ga0496104_0003479 Ga0496104_0003479_3997_4515 172
41 3300048908 Ga0496105_0000662 Ga0496105_0000662_12936_13454 172
42 3300048913 Ga0496110_0012321 Ga0496110_0012321_1361_1879 172
43 3300048917 Ga0496114_0007367 Ga0496114_0007367_8101_8619 172
44 3300048918 Ga0496115_0000056 Ga0496115_0000056_91069_91587 172
45 3300048919 Ga0496116_0039774 Ga0496116_0039774_1899_2417 172
46 3300048920 Ga0496117_0000114 Ga0496117_0000114_12474_12992 172
47 3300048921 Ga0496118_0000082 Ga0496118_0000082_172193_172711 172
48 3300048922 Ga0496119_0004578 Ga0496119_0004578_1368_1886 172
49 3300048923 Ga0496120_0040137 Ga0496120_0040137_1082_1600 172
50 3300048924 Ga0496121_0000344 Ga0496121_0000344_12591_13109 172
51 3300048925 Ga0496122_0018243 Ga0496122_0018243_4283_4801 172
52 3300048926 Ga0496123_0033485 Ga0496123_0033485_1247_1765 172
53 3300048927 Ga0496124_0000068 Ga0496124_0000068_12611_13129 172
54 3300048928 Ga0496125_0002303 Ga0496125_0002303_12627_13145 172
55 3300048929 Ga0496126_0000157 Ga0496126_0000157_12623_13141 172
56 3300053079 Ga0500610_0000206 Ga0500610_0000206_1777_2295 172
57 3300053087 Ga0500643_045054 Ga0500643_045054_587_1105 172
58 3300053092 Ga0500583_0211290 Ga0500583_0211290_250_768 172
59 3300053130 Ga0500642_0000817 Ga0500642_0000817_2977_3495 172
60 3300053154 Ga0500619_023512 Ga0500619_023512_1223_1741 172
61 3300053177 Ga0500636_0007450 Ga0500636_0007450_3428_3946 172
62 3300053730 Ga0500645_000585 Ga0500645_000585_21351_21869 172
63 3300053735 Ga0500596_000088 Ga0500596_000088_29_547 172
64 3300005356 Ga0070674_100009392 Ga0070674_1000093926 174
65 3300005364 Ga0070673_100204735 Ga0070673_1002047351 174
66 3300005457 Ga0070662_100344075 Ga0070662_1003440752 174
67 3300005539 Ga0068853_100174604 Ga0068853_1001746043 174
68 3300005563 Ga0068855_101049947 Ga0068855_1010499472 174
69 3300025901 Ga0207688_10053916 Ga0207688_100539163 174
70 3300025917 Ga0207660_10314148 Ga0207660_103141483 174
71 3300025937 Ga0207669_10002470 Ga0207669_100024709 174
72 3300025960 Ga0207651_10050555 Ga0207651_100505553 174
73 3300026041 Ga0207639_10145473 Ga0207639_101454732 174
74 3300026121 Ga0207683_10173269 Ga0207683_101732692 174
75 3300031548 Ga0307408_100023121 Ga0307408_1000231213 174
76 3300031548 Ga0307408_100139021 Ga0307408_1001390213 174
77 3300031548 Ga0307408_100152759 Ga0307408_1001527593 174
78 3300031548 Ga0307408_100595169 Ga0307408_1005951692 174
79 3300031731 Ga0307405_10294867 Ga0307405_102948672 174
80 3300031824 Ga0307413_10133015 Ga0307413_101330152 174
81 3300031824 Ga0307413_10165558 Ga0307413_101655581 174
82 3300031824 Ga0307413_10174893 Ga0307413_101748931 174
83 3300031824 Ga0307413_10354637 Ga0307413_103546372 174
84 3300031824 Ga0307413_10919256 Ga0307413_109192561 174
85 3300031852 Ga0307410_10075530 Ga0307410_100755302 174
86 3300031852 Ga0307410_10156601 Ga0307410_101566012 174
87 3300031901 Ga0307406_10384608 Ga0307406_103846082 174
88 3300031903 Ga0307407_10056086 Ga0307407_100560863 174
89 3300031903 Ga0307407_10100801 Ga0307407_101008012 174
90 3300031903 Ga0307407_10335651 Ga0307407_103356512 174
91 3300031903 Ga0307407_10624909 Ga0307407_106249092 174
92 3300031911 Ga0307412_10037457 Ga0307412_100374572 174
93 3300031911 Ga0307412_10114454 Ga0307412_101144542 174
94 3300031911 Ga0307412_10149968 Ga0307412_101499682 174
95 3300031911 Ga0307412_10154007 Ga0307412_101540072 174
96 3300031911 Ga0307412_10890768 Ga0307412_108907681 174
97 3300031911 Ga0307412_11169767 Ga0307412_111697671 174
98 3300031995 Ga0307409_100741281 Ga0307409_1007412812 174
99 3300031995 Ga0307409_100762465 Ga0307409_1007624652 174
100 3300031995 Ga0307409_100992263 Ga0307409_1009922632 174
101 3300032002 Ga0307416_100145275 Ga0307416_1001452752 174
102 3300032004 Ga0307414_10101496 Ga0307414_101014962 174
103 3300032004 Ga0307414_10202474 Ga0307414_102024743 174
104 3300032004 Ga0307414_10239016 Ga0307414_102390162 174
105 3300032004 Ga0307414_10285225 Ga0307414_102852251 174
106 3300032004 Ga0307414_10376913 Ga0307414_103769132 174
107 3300032005 Ga0307411_10002034 Ga0307411_100020346 174
108 3300032005 Ga0307411_10033317 Ga0307411_100333172 174
109 3300032005 Ga0307411_10655816 Ga0307411_106558162 174
110 3300032005 Ga0307411_11015152 Ga0307411_110151521 174
111 3300032126 Ga0307415_100188951 Ga0307415_1001889512 174
112 3300032126 Ga0307415_100189070 Ga0307415_1001890703 174
113 3300032126 Ga0307415_100507566 Ga0307415_1005075662 174
114 3300032126 Ga0307415_100785662 Ga0307415_1007856622 174
115 3300032126 Ga0307415_101251112 Ga0307415_1012511122 174
116 3300050493 nmdc:mga0k408_593036_c1 nmdc:mga0k408_593036_c1_98_622 174
117 3300001915 JGI24741J21665_1008122 JGI24741J21665_10081222 175
118 3300001915 JGI24741J21665_1009364 JGI24741J21665_10093642 175
119 3300001976 JGI24752J21851_1000242 JGI24752J21851_10002429 175
120 3300001979 JGI24740J21852_10011002 JGI24740J21852_100110022 175
121 3300001979 JGI24740J21852_10011194 JGI24740J21852_100111944 175
122 3300001990 JGI24737J22298_10002896 JGI24737J22298_100028967 175
123 3300002244 JGI24742J22300_10012191 JGI24742J22300_100121911 175
124 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002101 175
125 3300003323 rootH1_10192496 rootH1_101924962 175
126 3300003759 Ga0055525_1000104 Ga0055525_100010442 175
127 3300003762 Ga0055542_1000037 Ga0055542_1000037211 175
128 3300003763 Ga0055529_1000042 Ga0055529_1000042211 175
129 3300005289 Ga0065704_10073578 Ga0065704_100735783 175
130 3300005293 Ga0065715_10003484 Ga0065715_100034844 175
131 3300005293 Ga0065715_10205784 Ga0065715_102057842 175
132 3300005327 Ga0070658_10000001 Ga0070658_10000001271 175
133 3300005327 Ga0070658_10005620 Ga0070658_100056204 175
134 3300005327 Ga0070658_10140211 Ga0070658_101402112 175
135 3300005328 Ga0070676_10119402 Ga0070676_101194022 175
136 3300005329 Ga0070683_100053304 Ga0070683_1000533045 175
137 3300005329 Ga0070683_100245806 Ga0070683_1002458062 175
138 3300005331 Ga0070670_100000021 Ga0070670_100000021103 175
139 3300005331 Ga0070670_100016348 Ga0070670_1000163484 175
140 3300005331 Ga0070670_100024180 Ga0070670_1000241802 175
141 3300005333 Ga0070677_10001614 Ga0070677_100016147 175
142 3300005336 Ga0070680_100000587 Ga0070680_1000005879 175
143 3300005336 Ga0070680_100043759 Ga0070680_1000437593 175
144 3300005336 Ga0070680_100091068 Ga0070680_1000910682 175
145 3300005339 Ga0070660_100000441 Ga0070660_1000004419 175
146 3300005339 Ga0070660_100004924 Ga0070660_1000049242 175
147 3300005339 Ga0070660_100014616 Ga0070660_1000146162 175
148 3300005339 Ga0070660_100159900 Ga0070660_1001599002 175
149 3300005344 Ga0070661_100000028 Ga0070661_10000002881 175
150 3300005344 Ga0070661_100031923 Ga0070661_1000319234 175
151 3300005344 Ga0070661_100226022 Ga0070661_1002260222 175
152 3300005344 Ga0070661_100414549 Ga0070661_1004145492 175
153 3300005345 Ga0070692_10001382 Ga0070692_100013822 175
154 3300005345 Ga0070692_10067412 Ga0070692_100674122 175
155 3300005347 Ga0070668_100009253 Ga0070668_1000092537 175
156 3300005347 Ga0070668_100010572 Ga0070668_1000105729 175
157 3300005353 Ga0070669_100000937 Ga0070669_10000093723 175
158 3300005354 Ga0070675_100001185 Ga0070675_1000011852 175
159 3300005355 Ga0070671_100236372 Ga0070671_1002363722 175
160 3300005355 Ga0070671_100307630 Ga0070671_1003076302 175
161 3300005355 Ga0070671_101079424 Ga0070671_1010794241 175
162 3300005356 Ga0070674_100009326 Ga0070674_1000093264 175
163 3300005356 Ga0070674_100049058 Ga0070674_1000490582 175
164 3300005356 Ga0070674_100356658 Ga0070674_1003566582 175
165 3300005364 Ga0070673_100045471 Ga0070673_1000454712 175
166 3300005365 Ga0070688_100704503 Ga0070688_1007045031 175
167 3300005366 Ga0070659_100041715 Ga0070659_1000417154 175
168 3300005366 Ga0070659_100042737 Ga0070659_1000427372 175
169 3300005366 Ga0070659_100043718 Ga0070659_1000437184 175
170 3300005366 Ga0070659_100083428 Ga0070659_1000834282 175
171 3300005366 Ga0070659_100088185 Ga0070659_1000881852 175
172 3300005367 Ga0070667_100000221 Ga0070667_10000022140 175
173 3300005367 Ga0070667_100042504 Ga0070667_1000425042 175
174 3300005367 Ga0070667_100127963 Ga0070667_1001279631 175
175 3300005441 Ga0070700_100087528 Ga0070700_1000875282 175
176 3300005455 Ga0070663_100007682 Ga0070663_1000076826 175
177 3300005455 Ga0070663_100123227 Ga0070663_1001232272 175
178 3300005455 Ga0070663_100277369 Ga0070663_1002773692 175
179 3300005455 Ga0070663_100290313 Ga0070663_1002903132 175
180 3300005456 Ga0070678_100005834 Ga0070678_1000058346 175
181 3300005456 Ga0070678_100076643 Ga0070678_1000766433 175
182 3300005457 Ga0070662_100004518 Ga0070662_1000045182 175
183 3300005457 Ga0070662_100062222 Ga0070662_1000622224 175
184 3300005457 Ga0070662_100087326 Ga0070662_1000873262 175
185 3300005457 Ga0070662_100872980 Ga0070662_1008729802 175
186 3300005458 Ga0070681_10033289 Ga0070681_100332893 175
187 3300005458 Ga0070681_10085836 Ga0070681_100858362 175
188 3300005458 Ga0070681_10598544 Ga0070681_105985442 175
189 3300005459 Ga0068867_100150593 Ga0068867_1001505933 175
190 3300005530 Ga0070679_100000010 Ga0070679_10000001080 175
191 3300005530 Ga0070679_100084102 Ga0070679_1000841022 175
192 3300005530 Ga0070679_100215445 Ga0070679_1002154451 175
193 3300005539 Ga0068853_100072459 Ga0068853_1000724594 175
194 3300005543 Ga0070672_100047162 Ga0070672_1000471622 175
195 3300005543 Ga0070672_100089372 Ga0070672_1000893722 175
196 3300005543 Ga0070672_100785584 Ga0070672_1007855842 175
197 3300005548 Ga0070665_100002410 Ga0070665_1000024107 175
198 3300005563 Ga0068855_100036336 Ga0068855_1000363362 175
199 3300005563 Ga0068855_100120630 Ga0068855_1001206302 175
200 3300005563 Ga0068855_100317368 Ga0068855_1003173683 175
201 3300005564 Ga0070664_100086710 Ga0070664_1000867102 175
202 3300005564 Ga0070664_100166266 Ga0070664_1001662662 175
203 3300005578 Ga0068854_100009240 Ga0068854_1000092406 175
204 3300005578 Ga0068854_100055840 Ga0068854_1000558402 175
205 3300005578 Ga0068854_100137243 Ga0068854_1001372432 175
206 3300005578 Ga0068854_100208171 Ga0068854_1002081713 175
207 3300005578 Ga0068854_101164493 Ga0068854_1011644932 175
208 3300005614 Ga0068856_101021232 Ga0068856_1010212322 175
209 3300005616 Ga0068852_100293930 Ga0068852_1002939302 175
210 3300005616 Ga0068852_100879884 Ga0068852_1008798842 175
211 3300005617 Ga0068859_100013822 Ga0068859_1000138229 175
212 3300005617 Ga0068859_100314660 Ga0068859_1003146603 175
213 3300005618 Ga0068864_100000004 Ga0068864_100000004253 175
214 3300005618 Ga0068864_100090561 Ga0068864_1000905612 175
215 3300005618 Ga0068864_100111865 Ga0068864_1001118654 175
216 3300005618 Ga0068864_100394580 Ga0068864_1003945802 175
217 3300005719 Ga0068861_100317448 Ga0068861_1003174482 175
218 3300005834 Ga0068851_10032579 Ga0068851_100325792 175
219 3300005841 Ga0068863_100000002 Ga0068863_100000002254 175
220 3300005844 Ga0068862_100000002 Ga0068862_100000002248 175
221 3300005844 Ga0068862_100358717 Ga0068862_1003587172 175
222 3300005844 Ga0068862_100364278 Ga0068862_1003642782 175
223 3300005844 Ga0068862_100465937 Ga0068862_1004659373 175
224 3300005844 Ga0068862_100873135 Ga0068862_1008731352 175
225 3300006195 Ga0075366_10284255 Ga0075366_102842552 175
226 3300006237 Ga0097621_100107713 Ga0097621_1001077132 175
227 3300006846 Ga0075430_101024091 Ga0075430_1010240911 175
228 3300006881 Ga0068865_100012798 Ga0068865_1000127982 175
229 3300006881 Ga0068865_100203858 Ga0068865_1002038583 175
230 3300006931 Ga0097620_100013822 Ga0097620_1000138229 175
231 3300006931 Ga0097620_100314679 Ga0097620_1003146793 175
232 3300009011 Ga0105251_10002504 Ga0105251_1000250410 175
233 3300009093 Ga0105240_10000433 Ga0105240_100004337 175
234 3300009093 Ga0105240_10168812 Ga0105240_101688122 175
235 3300009093 Ga0105240_10638380 Ga0105240_106383802 175
236 3300009094 Ga0111539_10024750 Ga0111539_100247502 175
237 3300009094 Ga0111539_12217497 Ga0111539_122174971 175
238 3300009101 Ga0105247_10106507 Ga0105247_101065073 175
239 3300009148 Ga0105243_10000082 Ga0105243_1000008223 175
240 3300009174 Ga0105241_10049342 Ga0105241_100493422 175
241 3300009176 Ga0105242_10670270 Ga0105242_106702702 175
242 3300009177 Ga0105248_10000010 Ga0105248_1000001089 175
243 3300009177 Ga0105248_10039462 Ga0105248_100394626 175
244 3300009177 Ga0105248_10099642 Ga0105248_100996422 175
245 3300009545 Ga0105237_10199980 Ga0105237_101999802 175
246 3300009545 Ga0105237_10437664 Ga0105237_104376642 175
247 3300009551 Ga0105238_10257043 Ga0105238_102570433 175
248 3300009551 Ga0105238_10557265 Ga0105238_105572652 175
249 3300009553 Ga0105249_10000122 Ga0105249_1000012275 175
250 3300009553 Ga0105249_10113449 Ga0105249_101134492 175
251 3300010375 Ga0105239_10000279 Ga0105239_1000027930 175
252 3300010375 Ga0105239_10908777 Ga0105239_109087772 175
253 3300013100 Ga0157373_10187693 Ga0157373_101876931 175
254 3300013102 Ga0157371_10000183 Ga0157371_1000018339 175
255 3300013105 Ga0157369_10069615 Ga0157369_100696152 175
256 3300013105 Ga0157369_10072097 Ga0157369_100720972 175
257 3300013306 Ga0163162_10047626 Ga0163162_100476262 175
258 3300013306 Ga0163162_10208264 Ga0163162_102082642 175
259 3300013308 Ga0157375_10620561 Ga0157375_106205612 175
260 3300014325 Ga0163163_10305346 Ga0163163_103053462 175
261 3300014326 Ga0157380_10004293 Ga0157380_100042932 175
262 3300014326 Ga0157380_10111187 Ga0157380_101111872 175
263 3300014326 Ga0157380_10407059 Ga0157380_104070593 175
264 3300014497 Ga0182008_10247646 Ga0182008_102476462 175
265 3300014968 Ga0157379_10025566 Ga0157379_100255666 175
266 3300014969 Ga0157376_10604446 Ga0157376_106044462 175
267 3300017792 Ga0163161_10044597 Ga0163161_100445974 175
268 3300021384 Ga0213876_10000766 Ga0213876_1000076619 175
269 3300025230 Ga0209563_100116 Ga0209563_10011697 175
270 3300025250 Ga0209026_1013842 Ga0209026_10138422 175
271 3300025253 Ga0209677_108619 Ga0209677_1086192 175
272 3300025254 Ga0209148_1000026 Ga0209148_1000026593 175
273 3300025261 Ga0209233_1021259 Ga0209233_10212593 175
274 3300025272 Ga0209455_1000005 Ga0209455_10000051340 175
275 3300025272 Ga0209455_1012760 Ga0209455_10127602 175
276 3300025297 Ga0209758_1000001 Ga0209758_1000001899 175
277 3300025297 Ga0209758_1132548 Ga0209758_11325481 175
278 3300025315 Ga0207697_10001553 Ga0207697_100015534 175
279 3300025321 Ga0207656_10023174 Ga0207656_100231742 175
280 3300025735 Ga0207713_1003344 Ga0207713_10033445 175
281 3300025893 Ga0207682_10003978 Ga0207682_100039787 175
282 3300025900 Ga0207710_10056697 Ga0207710_100566972 175
283 3300025901 Ga0207688_10026842 Ga0207688_100268424 175
284 3300025904 Ga0207647_10055333 Ga0207647_100553332 175
285 3300025907 Ga0207645_10012515 Ga0207645_100125156 175
286 3300025909 Ga0207705_10000002 Ga0207705_100000021607 175
287 3300025909 Ga0207705_10000397 Ga0207705_100003979 175
288 3300025909 Ga0207705_10001479 Ga0207705_100014792 175
289 3300025912 Ga0207707_10046798 Ga0207707_100467983 175
290 3300025912 Ga0207707_10114770 Ga0207707_101147702 175
291 3300025912 Ga0207707_10530690 Ga0207707_105306902 175
292 3300025913 Ga0207695_10000285 Ga0207695_1000028559 175
293 3300025913 Ga0207695_10134056 Ga0207695_101340562 175
294 3300025913 Ga0207695_10180319 Ga0207695_101803193 175
295 3300025914 Ga0207671_10007571 Ga0207671_100075712 175
296 3300025914 Ga0207671_10092953 Ga0207671_100929533 175
297 3300025914 Ga0207671_10183874 Ga0207671_101838742 175
298 3300025917 Ga0207660_10002232 Ga0207660_100022329 175
299 3300025917 Ga0207660_10040817 Ga0207660_100408174 175
300 3300025919 Ga0207657_10001100 Ga0207657_1000110024 175
301 3300025919 Ga0207657_10006640 Ga0207657_100066408 175
302 3300025919 Ga0207657_10044420 Ga0207657_100444202 175
303 3300025919 Ga0207657_10088426 Ga0207657_100884262 175
304 3300025919 Ga0207657_10096262 Ga0207657_100962622 175
305 3300025919 Ga0207657_10510332 Ga0207657_105103321 175
306 3300025920 Ga0207649_10000079 Ga0207649_1000007927 175
307 3300025920 Ga0207649_10000472 Ga0207649_1000047217 175
308 3300025920 Ga0207649_10009506 Ga0207649_100095062 175
309 3300025920 Ga0207649_10467794 Ga0207649_104677942 175
310 3300025921 Ga0207652_10000005 Ga0207652_10000005201 175
311 3300025921 Ga0207652_10000006 Ga0207652_1000000680 175
312 3300025921 Ga0207652_10000007 Ga0207652_1000000781 175
313 3300025921 Ga0207652_10000009 Ga0207652_1000000941 175
314 3300025921 Ga0207652_10001258 Ga0207652_1000125822 175
315 3300025924 Ga0207694_10024798 Ga0207694_100247986 175
316 3300025924 Ga0207694_10091803 Ga0207694_100918032 175
317 3300025925 Ga0207650_10000298 Ga0207650_1000029841 175
318 3300025925 Ga0207650_10003435 Ga0207650_1000343514 175
319 3300025925 Ga0207650_10087462 Ga0207650_100874622 175
320 3300025926 Ga0207659_10803635 Ga0207659_108036352 175
321 3300025931 Ga0207644_10227013 Ga0207644_102270132 175
322 3300025931 Ga0207644_10300102 Ga0207644_103001022 175
323 3300025931 Ga0207644_10726109 Ga0207644_107261092 175
324 3300025932 Ga0207690_10001240 Ga0207690_1000124017 175
325 3300025932 Ga0207690_10001443 Ga0207690_100014436 175
326 3300025932 Ga0207690_10061560 Ga0207690_100615603 175
327 3300025932 Ga0207690_10101896 Ga0207690_101018962 175
328 3300025932 Ga0207690_10190197 Ga0207690_101901972 175
329 3300025932 Ga0207690_10826154 Ga0207690_108261542 175
330 3300025933 Ga0207706_10001405 Ga0207706_1000140520 175
331 3300025933 Ga0207706_10005272 Ga0207706_1000527216 175
332 3300025933 Ga0207706_10015511 Ga0207706_100155117 175
333 3300025933 Ga0207706_10282040 Ga0207706_102820402 175
334 3300025935 Ga0207709_10000507 Ga0207709_1000050723 175
335 3300025937 Ga0207669_10000061 Ga0207669_100000616 175
336 3300025937 Ga0207669_10105603 Ga0207669_101056032 175
337 3300025937 Ga0207669_10404579 Ga0207669_104045792 175
338 3300025937 Ga0207669_10428830 Ga0207669_104288302 175
339 3300025938 Ga0207704_10050188 Ga0207704_100501882 175
340 3300025938 Ga0207704_10166657 Ga0207704_101666573 175
341 3300025940 Ga0207691_10000696 Ga0207691_100006969 175
342 3300025940 Ga0207691_10126278 Ga0207691_101262782 175
343 3300025941 Ga0207711_10000038 Ga0207711_1000003888 175
344 3300025941 Ga0207711_10319726 Ga0207711_103197263 175
345 3300025944 Ga0207661_11223701 Ga0207661_112237012 175
346 3300025945 Ga0207679_10324477 Ga0207679_103244772 175
347 3300025949 Ga0207667_10000107 Ga0207667_1000010761 175
348 3300025949 Ga0207667_10094958 Ga0207667_100949583 175
349 3300025949 Ga0207667_10112727 Ga0207667_101127273 175
350 3300025960 Ga0207651_10117002 Ga0207651_101170023 175
351 3300025961 Ga0207712_10001466 Ga0207712_1000146616 175
352 3300025961 Ga0207712_10114943 Ga0207712_101149432 175
353 3300025972 Ga0207668_10109474 Ga0207668_101094744 175
354 3300025972 Ga0207668_10142997 Ga0207668_101429972 175
355 3300025972 Ga0207668_10268042 Ga0207668_102680424 175
356 3300025981 Ga0207640_10003657 Ga0207640_100036579 175
357 3300025981 Ga0207640_10038215 Ga0207640_100382153 175
358 3300025981 Ga0207640_10096212 Ga0207640_100962124 175
359 3300025981 Ga0207640_10105808 Ga0207640_101058084 175
360 3300025986 Ga0207658_10000256 Ga0207658_1000025626 175
361 3300025986 Ga0207658_10031887 Ga0207658_100318872 175
362 3300025986 Ga0207658_10247214 Ga0207658_102472142 175
363 3300026041 Ga0207639_10000692 Ga0207639_1000069211 175
364 3300026041 Ga0207639_10137066 Ga0207639_101370662 175
365 3300026067 Ga0207678_10001575 Ga0207678_100015756 175
366 3300026067 Ga0207678_10002472 Ga0207678_1000247211 175
367 3300026067 Ga0207678_10086333 Ga0207678_100863332 175
368 3300026075 Ga0207708_10048265 Ga0207708_100482653 175
369 3300026078 Ga0207702_10007468 Ga0207702_100074686 175
370 3300026078 Ga0207702_10572967 Ga0207702_105729672 175
371 3300026088 Ga0207641_10000002 Ga0207641_10000002734 175
372 3300026089 Ga0207648_10039503 Ga0207648_100395036 175
373 3300026089 Ga0207648_10295073 Ga0207648_102950733 175
374 3300026095 Ga0207676_10000005 Ga0207676_1000000573 175
375 3300026095 Ga0207676_10144400 Ga0207676_101444003 175
376 3300026095 Ga0207676_10200499 Ga0207676_102004992 175
377 3300026116 Ga0207674_10266143 Ga0207674_102661432 175
378 3300026118 Ga0207675_100387570 Ga0207675_1003875702 175
379 3300026121 Ga0207683_10015483 Ga0207683_100154836 175
380 3300026142 Ga0207698_10193764 Ga0207698_101937642 175
381 3300026142 Ga0207698_10615747 Ga0207698_106157472 175
382 3300028379 Ga0268266_10000002 Ga0268266_100000021888 175
383 3300028379 Ga0268266_10013502 Ga0268266_100135029 175
384 3300028380 Ga0268265_10000003 Ga0268265_10000003255 175
385 3300028380 Ga0268265_10266783 Ga0268265_102667832 175
386 3300028380 Ga0268265_10335060 Ga0268265_103350602 175
387 3300028381 Ga0268264_10025669 Ga0268264_100256695 175
388 3300028786 Ga0307517_10027451 Ga0307517_100274515 175
389 3300030745 Ga0316182_1064081 Ga0316182_10640812 175
390 3300031456 Ga0307513_10008724 Ga0307513_100087243 175
391 3300031548 Ga0307408_100772636 Ga0307408_1007726361 175
392 3300031548 Ga0307408_101607055 Ga0307408_1016070551 175
393 3300031731 Ga0307405_10370888 Ga0307405_103708882 175
394 3300031824 Ga0307413_10000223 Ga0307413_1000022311 175
395 3300031824 Ga0307413_10092926 Ga0307413_100929262 175
396 3300031852 Ga0307410_10047077 Ga0307410_100470772 175
397 3300031852 Ga0307410_10154911 Ga0307410_101549113 175
398 3300031852 Ga0307410_10194099 Ga0307410_101940992 175
399 3300031901 Ga0307406_10149734 Ga0307406_101497343 175
400 3300031901 Ga0307406_10180566 Ga0307406_101805661 175
401 3300031901 Ga0307406_10313916 Ga0307406_103139162 175
402 3300031903 Ga0307407_10041510 Ga0307407_100415102 175
403 3300031911 Ga0307412_10095777 Ga0307412_100957774 175
404 3300031911 Ga0307412_10418891 Ga0307412_104188912 175
405 3300031995 Ga0307409_100030576 Ga0307409_1000305764 175
406 3300031995 Ga0307409_100087812 Ga0307409_1000878122 175
407 3300031995 Ga0307409_100179127 Ga0307409_1001791272 175
408 3300031995 Ga0307409_100763600 Ga0307409_1007636002 175
409 3300032002 Ga0307416_100041477 Ga0307416_1000414773 175
410 3300032004 Ga0307414_10054730 Ga0307414_100547302 175
411 3300032004 Ga0307414_10138424 Ga0307414_101384244 175
412 3300032004 Ga0307414_10191815 Ga0307414_101918154 175
413 3300032004 Ga0307414_10209628 Ga0307414_102096282 175
414 3300032004 Ga0307414_10473527 Ga0307414_104735272 175
415 3300032004 Ga0307414_10827845 Ga0307414_108278452 175
416 3300032004 Ga0307414_11322659 Ga0307414_113226592 175
417 3300032005 Ga0307411_10026369 Ga0307411_100263692 175
418 3300032005 Ga0307411_10082645 Ga0307411_100826452 175
419 3300032005 Ga0307411_10207172 Ga0307411_102071722 175
420 3300032005 Ga0307411_10433780 Ga0307411_104337803 175
421 3300032005 Ga0307411_10534446 Ga0307411_105344462 175
422 3300032126 Ga0307415_100238820 Ga0307415_1002388203 175
423 3300037312 Ga0395899_0000916 Ga0395899_0000916_19880_20407 175
424 3300037418 Ga0395900_0001285 Ga0395900_0001285_20001_20528 175
425 3300037466 Ga0395898_0001920 Ga0395898_0001920_16633_17160 175
426 3300037471 Ga0395905_0001547 Ga0395905_0001547_19664_20191 175
427 3300038443 Ga0395901_0000671 Ga0395901_0000671_10101_10628 175
428 3300039437 Ga0436365_1596642 Ga0436365_1596642_9291_9866 175
429 3300042436 Ga0439435_0165461 Ga0439435_0165461_105_632 175
430 3300044684 Ga0466966_0000027 Ga0466966_0000027_17570_18118 175
431 3300045049 Ga0466959_0149686 Ga0466959_0149686_984_1559 175
432 3300046507 Ga0495606_0029846 Ga0495606_0029846_390_917 175
433 3300046507 Ga0495606_0188956 Ga0495606_0188956_259_786 175
434 3300046522 Ga0495643_0066814 Ga0495643_0066814_668_1195 175
435 3300046525 Ga0495663_0115838 Ga0495663_0115838_35_562 175
436 3300046537 Ga0495598_0003391 Ga0495598_0003391_401_928 175
437 3300046537 Ga0495598_0041201 Ga0495598_0041201_121_648 175
438 3300046539 Ga0495621_0003234 Ga0495621_0003234_3202_3729 175
439 3300046557 Ga0495622_0023138 Ga0495622_0023138_2070_2597 175
440 3300046660 Ga0495625_0000221 Ga0495625_0000221_85066_85593 175
441 3300046660 Ga0495625_0065990 Ga0495625_0065990_1899_2426 175
442 3300046684 Ga0495669_0000159 Ga0495669_0000159_31605_32132 175
443 3300046691 Ga0495670_0022564 Ga0495670_0022564_1165_1692 175
444 3300046691 Ga0495670_0048982 Ga0495670_0048982_563_1090 175
445 3300047445 Ga0495677_0023183 Ga0495677_0023183_1299_1826 175
446 3300048904 Ga0496101_0071614 Ga0496101_0071614_1538_2071 175
447 3300048905 Ga0496102_0746163 Ga0496102_0746163_139_678 175
448 3300048906 Ga0496103_0228213 Ga0496103_0228213_417_950 175
449 3300048920 Ga0496117_0010075 Ga0496117_0010075_6938_7471 175
450 3300048921 Ga0496118_0000327 Ga0496118_0000327_26032_26565 175
451 3300048921 Ga0496118_0142492 Ga0496118_0142492_273_812 175
452 3300048924 Ga0496121_0014959 Ga0496121_0014959_7356_7895 175
453 3300048924 Ga0496121_0039648 Ga0496121_0039648_217_756 175
454 3300048929 Ga0496126_0020862 Ga0496126_0020862_106_645 175
455 3300050510 nmdc:mga06r32_10173_c1 nmdc:mga06r32_10173_c1_2069_2599 175
456 3300050511 nmdc:mga08y16_1441416_c1 nmdc:mga08y16_1441416_c1_40_567 175
457 3300053119 Ga0500595_000935 Ga0500595_000935_5519_6046 175
458 3300053730 Ga0500645_002731 Ga0500645_002731_1567_2094 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

83

199

0.91

PF08534

Redoxin

Redoxin

82

216

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9329 39 175
2g0f-assembly1.cif.gz_A crystal structure of p144a mutant of e.coli ccmg protein 0.9134 32 174
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9085 32 174
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.8956 34 174
3k8n-assembly1.cif.gz_A crystal structure of e. coli ccmg 0.8837 27 174
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9329 39 175 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9085 32 174 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8836 39 175 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8702 43 171 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8683 32 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A520JFX6-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9789 70 175 GO:0016491
GO:0017004
AF-A0A2W4YS53-F1-model_v4 deleted 0.9783 41 175
AF-A0A7Y1T832-F1-model_v4 deleted 0.9771 7 175
AF-A0A2W4YS53-F1-model_v4 deleted 0.9712 41 175
AF-F1ZCJ6-F1-model_v4 Periplasmic protein thiol 0.9671 2 174 GO:0015036
GO:0016020
GO:0017004
GO:0030288

Feature Viewer

pLDDT pTM Quality
91.1 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map