F448209

General Info

Members Datasets Scaffolds Average Seq Length
458 278 916 105

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10602161|Ga0207665_106021611
Length 125
Sequence MFINKGRSRAKAAPRRRTLKIRSGDHVRVIGGKDRGKTGRVLRVEPSKDRLFVEGLNMIKRHTRPHQVAGAHTEAQLGGVIEREGPIHISNVMLLDPKGTPTRVRIERHEGRRVRVAKKTGARLE

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
245 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 2643221580 Devosia sp. Root635 Isolate Unclassified
275 2643221629 Devosia sp. Root105 Isolate Unclassified
276 2643221662 Devosia sp. Root413D1 Isolate Unclassified
277 2643221674 Devosia sp. Root436 Isolate Unclassified
278 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.72
Metatranscriptomes 14.19
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.83
Nodule 0
Rhizoplane 1.09
Rhizosphere 84.06
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10602161 3300025939 Unclassified 858
2 JGI24737J22298_10114920 3300001990 Bacteria 796
3 Ga0065704_10271517 3300005289 Bacteria 942
4 Ga0070658_10015385 3300005327 Bacteria 6123
5 Ga0070658_10025403 3300005327 Bacteria 4749
6 Ga0070676_10076894 3300005328 Bacteria 2016
7 Ga0070666_10613025 3300005335 Bacteria 795
8 Ga0068868_100024355 3300005338 Bacteria 4592
9 Ga0070660_100011745 3300005339 Bacteria 6236
10 Ga0070661_100001887 3300005344 Bacteria 14515
11 Ga0070661_100010348 3300005344 Bacteria 6484
12 Ga0070661_100021704 3300005344 Bacteria 4590
13 Ga0070661_100063606 3300005344 Bacteria 2710
14 Ga0070668_100114747 3300005347 Bacteria 2147
15 Ga0070674_100022024 3300005356 Bacteria 4104
16 Ga0070673_100036979 3300005364 Bacteria 3716
17 Ga0070714_101584098 3300005435 Bacteria 640
18 Ga0070713_100102238 3300005436 Bacteria 2485
19 Ga0070705_100800445 3300005440 Bacteria 750
20 Ga0070663_100634967 3300005455 Bacteria 902
21 Ga0070678_100354979 3300005456 Bacteria 1262
22 Ga0070662_100323650 3300005457 Bacteria 1258
23 Ga0070681_11863856 3300005458 Bacteria 529
24 Ga0068853_100000888 3300005539 Bacteria 20812
25 Ga0068853_100142983 3300005539 Bacteria 2148
26 Ga0068853_100533405 3300005539 Bacteria 1110
27 Ga0068853_100695474 3300005539 Bacteria 970
28 Ga0070672_100094968 3300005543 Bacteria 2411
29 Ga0070693_100021714 3300005547 Bacteria 3404
30 Ga0070665_100449839 3300005548 Bacteria 1298
31 Ga0070665_101797087 3300005548 Bacteria 620
32 Ga0068855_100132159 3300005563 Bacteria 2849
33 Ga0068855_100161337 3300005563 Bacteria 2544
34 Ga0068855_100503759 3300005563 Bacteria 1315
35 Ga0068855_101311730 3300005563 Bacteria 749
36 Ga0068855_101448346 3300005563 Bacteria 706
37 Ga0068857_100029814 3300005577 Bacteria 4814
38 Ga0068857_101616735 3300005577 Bacteria 633
39 Ga0068857_101652530 3300005577 Bacteria 626
40 Ga0068854_100008442 3300005578 Bacteria 6621
41 Ga0068854_100033549 3300005578 Bacteria 3579
42 Ga0068854_100440908 3300005578 Bacteria 1085
43 Ga0068854_100935928 3300005578 Bacteria 763
44 Ga0068856_100068108 3300005614 Bacteria 3518
45 Ga0068856_100118173 3300005614 Bacteria 2652
46 Ga0068856_100307358 3300005614 Bacteria 1603
47 Ga0068852_100009612 3300005616 Bacteria 7185
48 Ga0068852_100016813 3300005616 Bacteria 5719
49 Ga0068852_100023465 3300005616 Bacteria 4966
50 Ga0068852_100090574 3300005616 Bacteria 2735
51 Ga0068852_100120070 3300005616 Bacteria 2404
52 Ga0068866_10686791 3300005718 Bacteria 701
53 Ga0068851_10011945 3300005834 Bacteria 4083
54 Ga0068851_10052963 3300005834 Bacteria 2065
55 Ga0068863_102585197 3300005841 Bacteria 517
56 Ga0070717_11251760 3300006028 Bacteria 675
57 Ga0075365_10349108 3300006038 Bacteria 1043
58 Ga0075365_11354646 3300006038 Bacteria 500
59 Ga0075368_10302875 3300006042 Bacteria 690
60 Ga0075363_100004858 3300006048 Bacteria 5938
61 Ga0075363_100073005 3300006048 Bacteria 1866
62 Ga0075363_100091580 3300006048 Bacteria 1674
63 Ga0075364_10035085 3300006051 Bacteria 3240
64 Ga0075364_10151324 3300006051 Bacteria 1564
65 Ga0075364_10201064 3300006051 Bacteria 1350
66 Ga0070716_100507823 3300006173 Bacteria 891
67 Ga0070716_101421133 3300006173 Bacteria 565
68 Ga0070712_100126836 3300006175 Bacteria 1929
69 Ga0070712_100333862 3300006175 Bacteria 1236
70 Ga0075362_10003594 3300006177 Bacteria 5449
71 Ga0075362_10004861 3300006177 Bacteria 4855
72 Ga0075367_10415459 3300006178 Bacteria 851
73 Ga0075366_10048147 3300006195 Bacteria 2527
74 Ga0075366_10051230 3300006195 Bacteria 2453
75 Ga0075366_10516452 3300006195 Bacteria 739
76 Ga0097621_100176251 3300006237 Bacteria 1845
77 Ga0075370_10003104 3300006353 Bacteria 7840
78 Ga0075370_10008914 3300006353 Bacteria 5184
79 Ga0075370_10358606 3300006353 Bacteria 871
80 Ga0068865_101107943 3300006881 Bacteria 698
81 Ga0105240_10141214 3300009093 Bacteria 2879
82 Ga0105240_10990783 3300009093 Bacteria 899
83 Ga0105245_10465229 3300009098 Bacteria 1275
84 Ga0105247_10534755 3300009101 Bacteria 859
85 Ga0105243_10472050 3300009148 Bacteria 1182
86 Ga0105243_11701523 3300009148 Bacteria 660
87 Ga0105241_10163998 3300009174 Bacteria 1829
88 Ga0105241_11000762 3300009174 Bacteria 782
89 Ga0105242_10089293 3300009176 Bacteria 2590
90 Ga0105237_10192971 3300009545 Bacteria 2036
91 Ga0105238_10060184 3300009551 Bacteria 3803
92 Ga0105238_10399567 3300009551 Bacteria 1367
93 Ga0105238_10987971 3300009551 Bacteria 862
94 Ga0105238_12141498 3300009551 Bacteria 594
95 Ga0105238_12642440 3300009551 Bacteria 538
96 Ga0105239_10039505 3300010375 Bacteria 5170
97 Ga0105239_12991989 3300010375 Bacteria 551
98 Ga0105239_13269863 3300010375 Bacteria 528
99 Ga0157373_10195478 3300013100 Bacteria 1426
100 Ga0157371_11393778 3300013102 Bacteria 544
101 Ga0157370_10071147 3300013104 Bacteria 3282
102 Ga0157370_10089218 3300013104 Bacteria 2896
103 Ga0157370_10201177 3300013104 Bacteria 1848
104 Ga0157370_10819657 3300013104 Bacteria 846
105 Ga0157370_10952139 3300013104 Bacteria 778
106 Ga0157369_10038065 3300013105 Bacteria 5262
107 Ga0157374_12281267 3300013296 Bacteria 568
108 Ga0157378_10453599 3300013297 Bacteria 1273
109 Ga0157378_10740789 3300013297 Bacteria 1005
110 Ga0157372_10064075 3300013307 Bacteria 4123
111 Ga0157372_10219970 3300013307 Bacteria 2201
112 Ga0157375_10285686 3300013308 Bacteria 1813
113 Ga0163163_10895894 3300014325 Bacteria 950
114 Ga0157379_10205407 3300014968 Bacteria 1782
115 Ga0157376_10519059 3300014969 Bacteria 1174
116 Ga0206356_10256739 3300020070 Bacteria 1660
117 Ga0213873_10274385 3300021358 Bacteria 539
118 Ga0213874_10000186 3300021377 Bacteria 11171
119 Ga0213876_10028858 3300021384 Bacteria 2926
120 Ga0213871_10123717 3300021441 Bacteria 773
121 Ga0207656_10000708 3300025321 Bacteria 10913
122 Ga0207645_10051960 3300025907 Bacteria 2619
123 Ga0207705_10011637 3300025909 Bacteria 6358
124 Ga0207705_10012967 3300025909 Bacteria 6016
125 Ga0207707_10620214 3300025912 Bacteria 914
126 Ga0207695_10002347 3300025913 Bacteria 28115
127 Ga0207671_10068868 3300025914 Bacteria 2637
128 Ga0207671_11238336 3300025914 Bacteria 583
129 Ga0207693_10260768 3300025915 Bacteria 1359
130 Ga0207693_10379662 3300025915 Bacteria 1105
131 Ga0207657_10043012 3300025919 Bacteria 3982
132 Ga0207657_10054867 3300025919 Bacteria 3444
133 Ga0207649_10001226 3300025920 Bacteria 15405
134 Ga0207649_10041979 3300025920 Bacteria 2788
135 Ga0207649_10520739 3300025920 Bacteria 907
136 Ga0207649_11500842 3300025920 Bacteria 533
137 Ga0207694_10080451 3300025924 Bacteria 2557
138 Ga0207694_10085496 3300025924 Bacteria 2483
139 Ga0207694_10889167 3300025924 Bacteria 753
140 Ga0207687_10876545 3300025927 Bacteria 767
141 Ga0207700_10080830 3300025928 Bacteria 2536
142 Ga0207690_10348494 3300025932 Bacteria 1170
143 Ga0207706_10017594 3300025933 Bacteria 6440
144 Ga0207686_11294082 3300025934 Bacteria 598
145 Ga0207669_10845247 3300025937 Bacteria 761
146 Ga0207704_10619480 3300025938 Bacteria 888
147 Ga0207691_10003340 3300025940 Bacteria 15620
148 Ga0207661_10871611 3300025944 Bacteria 829
149 Ga0207679_10039615 3300025945 Bacteria 3367
150 Ga0207667_10000877 3300025949 Bacteria 38435
151 Ga0207667_10862904 3300025949 Bacteria 899
152 Ga0207667_11243484 3300025949 Bacteria 723
153 Ga0207668_10077587 3300025972 Bacteria 2396
154 Ga0207668_10094737 3300025972 Bacteria 2202
155 Ga0207640_10021605 3300025981 Bacteria 3839
156 Ga0207640_10023318 3300025981 Bacteria 3717
157 Ga0207639_10002448 3300026041 Bacteria 12454
158 Ga0207639_10262487 3300026041 Bacteria 1511
159 Ga0207678_10668764 3300026067 Bacteria 913
160 Ga0207678_11498157 3300026067 Bacteria 596
161 Ga0207702_10014521 3300026078 Bacteria 6538
162 Ga0207702_10167468 3300026078 Bacteria 2011
163 Ga0207702_10192553 3300026078 Bacteria 1885
164 Ga0207641_12002607 3300026088 Bacteria 580
165 Ga0207648_10105542 3300026089 Bacteria 2472
166 Ga0207674_10054207 3300026116 Bacteria 4083
167 Ga0207674_10659020 3300026116 Bacteria 1011
168 Ga0207674_11376834 3300026116 Bacteria 675
169 Ga0207683_10018852 3300026121 Bacteria 5887
170 Ga0207698_10009953 3300026142 Bacteria 6083
171 Ga0207698_10048987 3300026142 Bacteria 3212
172 Ga0207698_10125298 3300026142 Bacteria 2183
173 Ga0207698_10197038 3300026142 Bacteria 1800
174 Ga0209982_1053906 3300027552 Bacteria 650
175 Ga0209813_10038610 3300027866 Bacteria 1444
176 Ga0209813_10459873 3300027866 Bacteria 522
177 Ga0209974_10021202 3300027876 Bacteria 2152
178 Ga0209974_10241424 3300027876 Bacteria 678
179 Ga0268266_11685016 3300028379 Bacteria 609
180 Ga0268265_11784306 3300028380 Bacteria 622
181 Ga0265337_1000328 3300028556 Bacteria 25426
182 Ga0265326_10012350 3300028558 Bacteria 2513
183 Ga0265319_1000863 3300028563 Bacteria 19261
184 Ga0265318_10000275 3300028577 Bacteria 43186
185 Ga0265318_10009217 3300028577 Bacteria 4353
186 Ga0265318_10033853 3300028577 Bacteria 1971
187 Ga0265322_10027616 3300028654 Bacteria 1622
188 Ga0265322_10170035 3300028654 Bacteria 624
189 Ga0265336_10000043 3300028666 Bacteria 132135
190 Ga0265336_10160499 3300028666 Bacteria 669
191 Ga0265336_10180332 3300028666 Bacteria 628
192 Ga0265338_10000142 3300028800 Bacteria 132135
193 Ga0265338_10007393 3300028800 Bacteria 13651
194 Ga0265338_10813054 3300028800 Bacteria 640
195 Ga0265324_10008340 3300029957 Bacteria 4123
196 Ga0316182_1125441 3300030745 Bacteria 591
197 Ga0265330_10115946 3300031235 Bacteria 1142
198 Ga0265330_10147209 3300031235 Bacteria 1001
199 Ga0265332_10161402 3300031238 Bacteria 936
200 Ga0265328_10375912 3300031239 Bacteria 555
201 Ga0265320_10090219 3300031240 Bacteria 1420
202 Ga0265340_10000006 3300031247 Bacteria 132135
203 Ga0265339_10004598 3300031249 Bacteria 9392
204 Ga0265331_10334578 3300031250 Bacteria 678
205 Ga0265331_10428304 3300031250 Bacteria 594
206 Ga0265327_10051923 3300031251 Bacteria 2137
207 Ga0265316_10105986 3300031344 Bacteria 2132
208 Ga0265316_10172975 3300031344 Bacteria 1610
209 Ga0307509_10589109 3300031507 Bacteria 786
210 Ga0307408_100525455 3300031548 Bacteria 1040
211 Ga0307408_100822130 3300031548 Bacteria 845
212 Ga0265313_10031974 3300031595 Bacteria 2693
213 Ga0265314_10028270 3300031711 Bacteria 4183
214 Ga0265314_10438128 3300031711 Bacteria 698
215 Ga0265314_10452655 3300031711 Bacteria 683
216 Ga0307516_10129798 3300031730 Bacteria 2301
217 Ga0307405_10006207 3300031731 Bacteria 5858
218 Ga0307405_11064592 3300031731 Bacteria 693
219 Ga0316577_10071653 3300031733 Unclassified 1934
220 Ga0307413_10048778 3300031824 Bacteria 2533
221 Ga0307413_10244839 3300031824 Bacteria 1326
222 Ga0307410_10026483 3300031852 Bacteria 3651
223 Ga0307410_10819610 3300031852 Bacteria 793
224 Ga0307406_10212668 3300031901 Bacteria 1432
225 Ga0307406_10775969 3300031901 Bacteria 807
226 Ga0307407_10130360 3300031903 Bacteria 1608
227 Ga0307407_11103852 3300031903 Bacteria 617
228 Ga0307412_10039066 3300031911 Bacteria 3061
229 Ga0307412_11107431 3300031911 Bacteria 705
230 Ga0307409_100091347 3300031995 Bacteria 2495
231 Ga0307409_100121254 3300031995 Bacteria 2215
232 Ga0307409_102011258 3300031995 Bacteria 607
233 Ga0307416_103574695 3300032002 Bacteria 520
234 Ga0307414_10012983 3300032004 Bacteria 4945
235 Ga0307414_10221894 3300032004 Bacteria 1552
236 Ga0307414_10718927 3300032004 Bacteria 905
237 Ga0307414_10865790 3300032004 Bacteria 827
238 Ga0307414_11355699 3300032004 Bacteria 660
239 Ga0307414_11533314 3300032004 Bacteria 620
240 Ga0307411_10081973 3300032005 Bacteria 2223
241 Ga0307415_100194236 3300032126 Bacteria 1604
242 Ga0307415_101085236 3300032126 Bacteria 749
243 Ga0316593_10101709 3300032168 Bacteria 1020
244 Ga0373928_0005729 3300035084 Bacteria 2376
245 Ga0373932_0091616 3300035112 Bacteria 976
246 Ga0373936_0178849 3300035113 Bacteria 930
247 Ga0373939_0185197 3300035114 Bacteria 779
248 Ga0373942_0175942 3300035207 Bacteria 699
249 Ga0373931_0020772 3300035691 Bacteria 3288
250 Ga0373947_0248894 3300035725 Bacteria 1175
251 Ga0316584_0239860 3300036712 Unclassified 1327
252 Ga0373925_0682410 3300037068 Bacteria 847
253 Ga0373925_0707761 3300037068 Bacteria 830
254 Ga0395899_0019478 3300037312 Bacteria 5153
255 Ga0395900_0147149 3300037418 Bacteria 2408
256 Ga0395898_0131941 3300037466 Bacteria 2392
257 Ga0395905_0118136 3300037471 Bacteria 2493
258 Ga0436364_0894349 3300037853 Bacteria 1735
259 Ga0436364_1385224 3300037853 Bacteria 525
260 Ga0395901_0464662 3300038443 Bacteria 1292
261 Ga0436365_0682782 3300039437 Bacteria 2975
262 Ga0436365_0770493 3300039437 Bacteria 788
263 Ga0436365_1116996 3300039437 Bacteria 883
264 Ga0436365_1185860 3300039437 Bacteria 1887
265 Ga0436360_0549397 3300039438 Bacteria 2012
266 Ga0436363_0136874 3300039450 Bacteria 50367
267 Ga0436362_0204771 3300039453 Bacteria 917
268 Ga0436362_0908844 3300039453 Bacteria 992
269 Ga0436362_1083294 3300039453 Bacteria 2425
270 Ga0439465_0038162 3300041413 Bacteria 1547
271 Ga0439465_0055731 3300041413 Bacteria 1302
272 Ga0439465_0382932 3300041413 Bacteria 534
273 Ga0451791_0200295 3300041451 Bacteria 629
274 Ga0451791_0502140 3300041451 Bacteria 636
275 Ga0451802_1020572 3300041460 Bacteria 607
276 Ga0451807_2452178 3300041486 Bacteria 520
277 Ga0451837_0083364 3300041494 Bacteria 1407
278 Ga0451837_0200497 3300041494 Bacteria 606
279 Ga0439445_0124271 3300042004 Bacteria 742
280 Ga0439445_0246738 3300042004 Bacteria 533
281 Ga0466964_0279684 3300044706 Bacteria 834
282 Ga0466960_0464397 3300044901 Bacteria 737
283 Ga0466960_0732481 3300044901 Bacteria 595
284 Ga0466958_0059500 3300045836 Bacteria 2324
285 Ga0466958_0467128 3300045836 Bacteria 818
286 Ga0466967_1697036 3300045976 Bacteria 629
287 Ga0495629_0415049 3300046459 Bacteria 914
288 Ga0495641_0334643 3300046461 Bacteria 684
289 Ga0495653_0038646 3300046463 Bacteria 3745
290 Ga0495650_0319940 3300046471 Bacteria 517
291 Ga0495618_0000035 3300046514 Bacteria 102739
292 Ga0495665_0262487 3300046531 Bacteria 888
293 Ga0495645_0000033 3300046543 Bacteria 105930
294 Ga0495647_0232360 3300046681 Bacteria 817
295 Ga0495581_0405846 3300047315 Bacteria 795
296 Ga0495581_0664737 3300047315 Bacteria 602
297 Ga0495676_0121282 3300047321 Bacteria 1901
298 Ga0495686_0075327 3300047472 Bacteria 2069
299 Ga0496100_0912575 3300048903 Bacteria 690
300 Ga0496118_0367151 3300048921 Bacteria 761
301 Ga0496119_0100080 3300048922 Bacteria 1629
302 Ga0496121_0057685 3300048924 Bacteria 3216
303 Ga0496121_0374339 3300048924 Bacteria 941
304 Ga0496125_0053349 3300048928 Bacteria 3315
305 Ga0496126_0059869 3300048929 Bacteria 3428
306 Ga0501306_047087 3300049127 Bacteria 683
307 Ga0501310_040490 3300049130 Bacteria 648
308 Ga0501305_005381 3300049161 Bacteria 1549
309 Ga0501305_012977 3300049161 Bacteria 1146
310 Ga0501307_007805 3300049162 Bacteria 1188
311 Ga0501311_019096 3300049527 Bacteria 916
312 Ga0501311_053674 3300049527 Bacteria 637
313 Ga0501312_022832 3300049528 Bacteria 939
314 Ga0501312_063230 3300049528 Bacteria 644
315 Ga0501313_009340 3300049529 Bacteria 1104
316 Ga0501314_000441 3300049530 Bacteria 2577
317 Ga0501316_006752 3300049532 Bacteria 1229
318 Ga0501316_029912 3300049532 Bacteria 725
319 Ga0501319_030886 3300049535 Bacteria 515
320 Ga0501320_020005 3300049536 Bacteria 767
321 Ga0501321_011326 3300049537 Bacteria 993
322 Ga0501323_017656 3300049539 Bacteria 918
323 Ga0501323_067625 3300049539 Bacteria 567
324 Ga0501323_079975 3300049539 Bacteria 533
325 Ga0501324_011449 3300049540 Bacteria 820
326 Ga0501325_013864 3300049541 Bacteria 777
327 Ga0501326_05329 3300049542 Bacteria 698
328 Ga0501329_03765 3300049545 Bacteria 784
329 Ga0501031_0003843 3300049568 Bacteria 9657
330 Ga0501031_0259064 3300049568 Bacteria 1130
331 Ga0501031_0645831 3300049568 Bacteria 680
332 Ga0501032_0012326 3300049569 Bacteria 6112
333 Ga0501032_0205665 3300049569 Bacteria 1284
334 Ga0501032_0442751 3300049569 Bacteria 833
335 Ga0501033_0037361 3300049570 Bacteria 3635
336 Ga0501034_0009019 3300049571 Bacteria 10475
337 Ga0501034_0023047 3300049571 Bacteria 6345
338 Ga0501034_0030186 3300049571 Bacteria 5509
339 Ga0501034_0038767 3300049571 Bacteria 4826
340 Ga0501034_0050055 3300049571 Bacteria 4214
341 Ga0501034_0071741 3300049571 Bacteria 3472
342 Ga0501034_0078356 3300049571 Bacteria 3309
343 Ga0501034_0116556 3300049571 Bacteria 2659
344 Ga0501034_0137874 3300049571 Bacteria 2420
345 Ga0501034_1049302 3300049571 Bacteria 697
346 Ga0501036_0014004 3300049572 Bacteria 6665
347 Ga0501036_0027081 3300049572 Bacteria 4844
348 Ga0501036_1077761 3300049572 Bacteria 657
349 Ga0501036_1205627 3300049572 Bacteria 617
350 Ga0501037_0014952 3300049573 Bacteria 5708
351 Ga0501037_0123771 3300049573 Bacteria 1858
352 Ga0501037_0477381 3300049573 Bacteria 848
353 Ga0501037_0797991 3300049573 Bacteria 623
354 Ga0501038_0029459 3300049574 Bacteria 4863
355 Ga0501038_0128396 3300049574 Bacteria 2084
356 Ga0501038_0720922 3300049574 Bacteria 746
357 Ga0501039_0031110 3300049575 Bacteria 4114
358 Ga0501039_0040464 3300049575 Bacteria 3599
359 Ga0501039_0345112 3300049575 Bacteria 1170
360 Ga0501043_0055891 3300049579 Bacteria 3100
361 Ga0501043_0089103 3300049579 Bacteria 2425
362 Ga0501043_1022654 3300049579 Bacteria 587
363 Ga0501046_0944244 3300049580 Bacteria 600
364 Ga0501047_0260624 3300049581 Bacteria 1581
365 Ga0501067_0828016 3300049583 Bacteria 521
366 Ga0501068_0103502 3300049584 Bacteria 1766
367 Ga0501070_0006284 3300049586 Bacteria 10111
368 Ga0501070_0051620 3300049586 Bacteria 3413
369 Ga0501070_0599518 3300049586 Bacteria 878
370 Ga0501071_0263616 3300049587 Bacteria 1302
371 Ga0501071_0930924 3300049587 Bacteria 671
372 Ga0501071_1211282 3300049587 Bacteria 583
373 Ga0501072_0512402 3300049588 Bacteria 949
374 Ga0501073_0116123 3300049589 Bacteria 1855
375 Ga0501074_0299110 3300049590 Bacteria 1143
376 Ga0501075_1385238 3300049591 Bacteria 533
377 Ga0501225_0092486 3300049705 Bacteria 877
378 Ga0501081_1231171 3300049743 Bacteria 567
379 Ga0501035_0040260 3300049822 Bacteria 4224
380 Ga0501044_0024732 3300049823 Bacteria 6370
381 Ga0501044_0696690 3300049823 Bacteria 901
382 Ga0501044_0883743 3300049823 Bacteria 769
383 Ga0501044_1030480 3300049823 Bacteria 694
384 Ga0501045_0366480 3300049824 Bacteria 1072
385 nmdc:mga03683_16831_c1 3300050489 Bacteria 2756
386 nmdc:mga03683_224857_c1 3300050489 Bacteria 867
387 nmdc:mga03n38_253906_c1 3300050490 Bacteria 930
388 nmdc:mga03n38_525388_c1 3300050490 Bacteria 667
389 nmdc:mga00v17_164769_c1 3300050491 Bacteria 1428
390 nmdc:mga00v17_20896_c1 3300050491 Bacteria 3756
391 nmdc:mga00v17_378683_c1 3300050491 Bacteria 920
392 nmdc:mga00v17_812918_c1 3300050491 Bacteria 595
393 nmdc:mga0yw44_715897_c1 3300050492 Bacteria 680
394 nmdc:mga0k408_158811_c1 3300050493 Bacteria 1347
395 nmdc:mga0k408_319429_c1 3300050493 Bacteria 926
396 nmdc:mga06z11_99408_c1 3300050494 Bacteria 1594
397 nmdc:mga04h51_315398_c1 3300050495 Bacteria 640
398 nmdc:mga04h51_46089_c1 3300050495 Bacteria 1444
399 nmdc:mga07m45_3384_c1 3300050496 Bacteria 7687
400 nmdc:mga07m45_80903_c1 3300050496 Bacteria 887
401 Ga0495612_0000369 3300053078 Bacteria 18070
402 Ga0495619_0202949 3300053085 Bacteria 1373
403 Ga0495619_1187650 3300053085 Bacteria 505
404 Ga0500595_034087 3300053119 Bacteria 1686
405 Ga0500559_0249775 3300053136 Bacteria 836
406 Ga0500568_0080860 3300053139 Bacteria 1234
407 Ga0500573_0346150 3300053140 Bacteria 724
408 Ga0500604_0000294 3300053151 Bacteria 13881
409 Ga0500604_0116169 3300053151 Bacteria 892
410 Ga0500624_031807 3300053157 Bacteria 910
411 Ga0500634_0000031 3300053161 Bacteria 75547
412 Ga0500636_0210821 3300053177 Bacteria 1020
413 Ga0501084_0546031 3300054114 Bacteria 979
414 Ga0587070_012120 3300059491 Bacteria 1303
415 Ga0587070_119407 3300059491 Bacteria 629
416 Ga0587073_0027192 3300059492 Bacteria 1152
417 Ga0587073_0197974 3300059492 Bacteria 600
418 Ga0587077_018051 3300059493 Bacteria 1210
419 Ga0587083_0015116 3300059505 Bacteria 1341
420 Ga0587083_0194849 3300059505 Bacteria 575
421 Ga0587085_015791 3300059506 Bacteria 1084
422 Ga0587085_094409 3300059506 Bacteria 623
423 Ga0587085_117688 3300059506 Bacteria 580
424 Ga0587088_029157 3300059508 Bacteria 975
425 Ga0587088_062630 3300059508 Bacteria 757
426 Ga0587089_044458 3300059509 Bacteria 697
427 Ga0587090_038280 3300059510 Bacteria 833
428 Ga0587091_010909 3300059511 Bacteria 1403
429 Ga0587098_010441 3300059604 Bacteria 1027
430 Ga0587106_022797 3300059605 Bacteria 944
431 Ga0587101_000452 3300059623 Bacteria 2906
432 Ga0587101_015931 3300059623 Bacteria 1024
433 Ga0587109_086880 3300059624 Bacteria 700
434 Ga0587109_144251 3300059624 Bacteria 584
435 Ga0587128_057141 3300059630 Bacteria 728
436 Ga0587062_000348 3300059639 Bacteria 3089
437 Ga0587062_029642 3300059639 Bacteria 831
438 Ga0587067_084830 3300059640 Bacteria 707
439 Ga0587068_040451 3300059641 Bacteria 842
440 Ga0587068_078726 3300059641 Bacteria 662
441 Ga0587068_124859 3300059641 Bacteria 562
442 Ga0587069_025357 3300059642 Bacteria 922
443 Ga0587075_004358 3300059644 Bacteria 1639
444 Ga0587076_021623 3300059645 Bacteria 1067
445 Ga0587076_035056 3300059645 Bacteria 910
446 Ga0587076_117507 3300059645 Bacteria 612
447 Ga0587078_022754 3300059646 Bacteria 802
448 Ga0587079_249958 3300059647 Bacteria 504
449 Ga0587102_012079 3300059649 Bacteria 877
450 Ga0587107_002599 3300059652 Bacteria 1655
451 Ga0587071_067435 3300060344 Bacteria 772
452 Ga0587111_0115983 3300060346 Bacteria 684
453 Ga0587111_0208723 3300060346 Bacteria 558
454 2643911591 2643221580 Bacteria 3816678
455 2644165892 2643221629 Bacteria 5850260
456 2644347098 2643221662 Bacteria 5851492
457 2644410383 2643221674 Bacteria 3919126
458 2932403073 2932401849 Bacteria 4262978
459 Ga0207665_10602161
460 JGI24737J22298_10114920
461 Ga0065704_10271517
462 Ga0070658_10015385
463 Ga0070658_10025403
464 Ga0070676_10076894
465 Ga0070666_10613025
466 Ga0068868_100024355
467 Ga0070660_100011745
468 Ga0070661_100001887
469 Ga0070661_100010348
470 Ga0070661_100021704
471 Ga0070661_100063606
472 Ga0070668_100114747
473 Ga0070674_100022024
474 Ga0070673_100036979
475 Ga0070714_101584098
476 Ga0070713_100102238
477 Ga0070705_100800445
478 Ga0070663_100634967
479 Ga0070678_100354979
480 Ga0070662_100323650
481 Ga0070681_11863856
482 Ga0068853_100000888
483 Ga0068853_100142983
484 Ga0068853_100533405
485 Ga0068853_100695474
486 Ga0070672_100094968
487 Ga0070693_100021714
488 Ga0070665_100449839
489 Ga0070665_101797087
490 Ga0068855_100132159
491 Ga0068855_100161337
492 Ga0068855_100503759
493 Ga0068855_101311730
494 Ga0068855_101448346
495 Ga0068857_100029814
496 Ga0068857_101616735
497 Ga0068857_101652530
498 Ga0068854_100008442
499 Ga0068854_100033549
500 Ga0068854_100440908
501 Ga0068854_100935928
502 Ga0068856_100068108
503 Ga0068856_100118173
504 Ga0068856_100307358
505 Ga0068852_100009612
506 Ga0068852_100016813
507 Ga0068852_100023465
508 Ga0068852_100090574
509 Ga0068852_100120070
510 Ga0068866_10686791
511 Ga0068851_10011945
512 Ga0068851_10052963
513 Ga0068863_102585197
514 Ga0070717_11251760
515 Ga0075365_10349108
516 Ga0075365_11354646
517 Ga0075368_10302875
518 Ga0075363_100004858
519 Ga0075363_100073005
520 Ga0075363_100091580
521 Ga0075364_10035085
522 Ga0075364_10151324
523 Ga0075364_10201064
524 Ga0070716_100507823
525 Ga0070716_101421133
526 Ga0070712_100126836
527 Ga0070712_100333862
528 Ga0075362_10003594
529 Ga0075362_10004861
530 Ga0075367_10415459
531 Ga0075366_10048147
532 Ga0075366_10051230
533 Ga0075366_10516452
534 Ga0097621_100176251
535 Ga0075370_10003104
536 Ga0075370_10008914
537 Ga0075370_10358606
538 Ga0068865_101107943
539 Ga0105240_10141214
540 Ga0105240_10990783
541 Ga0105245_10465229
542 Ga0105247_10534755
543 Ga0105243_10472050
544 Ga0105243_11701523
545 Ga0105241_10163998
546 Ga0105241_11000762
547 Ga0105242_10089293
548 Ga0105237_10192971
549 Ga0105238_10060184
550 Ga0105238_10399567
551 Ga0105238_10987971
552 Ga0105238_12141498
553 Ga0105238_12642440
554 Ga0105239_10039505
555 Ga0105239_12991989
556 Ga0105239_13269863
557 Ga0157373_10195478
558 Ga0157371_11393778
559 Ga0157370_10071147
560 Ga0157370_10089218
561 Ga0157370_10201177
562 Ga0157370_10819657
563 Ga0157370_10952139
564 Ga0157369_10038065
565 Ga0157374_12281267
566 Ga0157378_10453599
567 Ga0157378_10740789
568 Ga0157372_10064075
569 Ga0157372_10219970
570 Ga0157375_10285686
571 Ga0163163_10895894
572 Ga0157379_10205407
573 Ga0157376_10519059
574 Ga0206356_10256739
575 Ga0213873_10274385
576 Ga0213874_10000186
577 Ga0213876_10028858
578 Ga0213871_10123717
579 Ga0207656_10000708
580 Ga0207645_10051960
581 Ga0207705_10011637
582 Ga0207705_10012967
583 Ga0207707_10620214
584 Ga0207695_10002347
585 Ga0207671_10068868
586 Ga0207671_11238336
587 Ga0207693_10260768
588 Ga0207693_10379662
589 Ga0207657_10043012
590 Ga0207657_10054867
591 Ga0207649_10001226
592 Ga0207649_10041979
593 Ga0207649_10520739
594 Ga0207649_11500842
595 Ga0207694_10080451
596 Ga0207694_10085496
597 Ga0207694_10889167
598 Ga0207687_10876545
599 Ga0207700_10080830
600 Ga0207690_10348494
601 Ga0207706_10017594
602 Ga0207686_11294082
603 Ga0207669_10845247
604 Ga0207704_10619480
605 Ga0207691_10003340
606 Ga0207661_10871611
607 Ga0207679_10039615
608 Ga0207667_10000877
609 Ga0207667_10862904
610 Ga0207667_11243484
611 Ga0207668_10077587
612 Ga0207668_10094737
613 Ga0207640_10021605
614 Ga0207640_10023318
615 Ga0207639_10002448
616 Ga0207639_10262487
617 Ga0207678_10668764
618 Ga0207678_11498157
619 Ga0207702_10014521
620 Ga0207702_10167468
621 Ga0207702_10192553
622 Ga0207641_12002607
623 Ga0207648_10105542
624 Ga0207674_10054207
625 Ga0207674_10659020
626 Ga0207674_11376834
627 Ga0207683_10018852
628 Ga0207698_10009953
629 Ga0207698_10048987
630 Ga0207698_10125298
631 Ga0207698_10197038
632 Ga0209982_1053906
633 Ga0209813_10038610
634 Ga0209813_10459873
635 Ga0209974_10021202
636 Ga0209974_10241424
637 Ga0268266_11685016
638 Ga0268265_11784306
639 Ga0265337_1000328
640 Ga0265326_10012350
641 Ga0265319_1000863
642 Ga0265318_10000275
643 Ga0265318_10009217
644 Ga0265318_10033853
645 Ga0265322_10027616
646 Ga0265322_10170035
647 Ga0265336_10000043
648 Ga0265336_10160499
649 Ga0265336_10180332
650 Ga0265338_10000142
651 Ga0265338_10007393
652 Ga0265338_10813054
653 Ga0265324_10008340
654 Ga0316182_1125441
655 Ga0265330_10115946
656 Ga0265330_10147209
657 Ga0265332_10161402
658 Ga0265328_10375912
659 Ga0265320_10090219
660 Ga0265340_10000006
661 Ga0265339_10004598
662 Ga0265331_10334578
663 Ga0265331_10428304
664 Ga0265327_10051923
665 Ga0265316_10105986
666 Ga0265316_10172975
667 Ga0307509_10589109
668 Ga0307408_100525455
669 Ga0307408_100822130
670 Ga0265313_10031974
671 Ga0265314_10028270
672 Ga0265314_10438128
673 Ga0265314_10452655
674 Ga0307516_10129798
675 Ga0307405_10006207
676 Ga0307405_11064592
677 Ga0316577_10071653
678 Ga0307413_10048778
679 Ga0307413_10244839
680 Ga0307410_10026483
681 Ga0307410_10819610
682 Ga0307406_10212668
683 Ga0307406_10775969
684 Ga0307407_10130360
685 Ga0307407_11103852
686 Ga0307412_10039066
687 Ga0307412_11107431
688 Ga0307409_100091347
689 Ga0307409_100121254
690 Ga0307409_102011258
691 Ga0307416_103574695
692 Ga0307414_10012983
693 Ga0307414_10221894
694 Ga0307414_10718927
695 Ga0307414_10865790
696 Ga0307414_11355699
697 Ga0307414_11533314
698 Ga0307411_10081973
699 Ga0307415_100194236
700 Ga0307415_101085236
701 Ga0316593_10101709
702 Ga0373928_0005729
703 Ga0373932_0091616
704 Ga0373936_0178849
705 Ga0373939_0185197
706 Ga0373942_0175942
707 Ga0373931_0020772
708 Ga0373947_0248894
709 Ga0316584_0239860
710 Ga0373925_0682410
711 Ga0373925_0707761
712 Ga0395899_0019478
713 Ga0395900_0147149
714 Ga0395898_0131941
715 Ga0395905_0118136
716 Ga0436364_0894349
717 Ga0436364_1385224
718 Ga0395901_0464662
719 Ga0436365_0682782
720 Ga0436365_0770493
721 Ga0436365_1116996
722 Ga0436365_1185860
723 Ga0436360_0549397
724 Ga0436363_0136874
725 Ga0436362_0204771
726 Ga0436362_0908844
727 Ga0436362_1083294
728 Ga0439465_0038162
729 Ga0439465_0055731
730 Ga0439465_0382932
731 Ga0451791_0200295
732 Ga0451791_0502140
733 Ga0451802_1020572
734 Ga0451807_2452178
735 Ga0451837_0083364
736 Ga0451837_0200497
737 Ga0439445_0124271
738 Ga0439445_0246738
739 Ga0466964_0279684
740 Ga0466960_0464397
741 Ga0466960_0732481
742 Ga0466958_0059500
743 Ga0466958_0467128
744 Ga0466967_1697036
745 Ga0495629_0415049
746 Ga0495641_0334643
747 Ga0495653_0038646
748 Ga0495650_0319940
749 Ga0495618_0000035
750 Ga0495665_0262487
751 Ga0495645_0000033
752 Ga0495647_0232360
753 Ga0495581_0405846
754 Ga0495581_0664737
755 Ga0495676_0121282
756 Ga0495686_0075327
757 Ga0496100_0912575
758 Ga0496118_0367151
759 Ga0496119_0100080
760 Ga0496121_0057685
761 Ga0496121_0374339
762 Ga0496125_0053349
763 Ga0496126_0059869
764 Ga0501306_047087
765 Ga0501310_040490
766 Ga0501305_005381
767 Ga0501305_012977
768 Ga0501307_007805
769 Ga0501311_019096
770 Ga0501311_053674
771 Ga0501312_022832
772 Ga0501312_063230
773 Ga0501313_009340
774 Ga0501314_000441
775 Ga0501316_006752
776 Ga0501316_029912
777 Ga0501319_030886
778 Ga0501320_020005
779 Ga0501321_011326
780 Ga0501323_017656
781 Ga0501323_067625
782 Ga0501323_079975
783 Ga0501324_011449
784 Ga0501325_013864
785 Ga0501326_05329
786 Ga0501329_03765
787 Ga0501031_0003843
788 Ga0501031_0259064
789 Ga0501031_0645831
790 Ga0501032_0012326
791 Ga0501032_0205665
792 Ga0501032_0442751
793 Ga0501033_0037361
794 Ga0501034_0009019
795 Ga0501034_0023047
796 Ga0501034_0030186
797 Ga0501034_0038767
798 Ga0501034_0050055
799 Ga0501034_0071741
800 Ga0501034_0078356
801 Ga0501034_0116556
802 Ga0501034_0137874
803 Ga0501034_1049302
804 Ga0501036_0014004
805 Ga0501036_0027081
806 Ga0501036_1077761
807 Ga0501036_1205627
808 Ga0501037_0014952
809 Ga0501037_0123771
810 Ga0501037_0477381
811 Ga0501037_0797991
812 Ga0501038_0029459
813 Ga0501038_0128396
814 Ga0501038_0720922
815 Ga0501039_0031110
816 Ga0501039_0040464
817 Ga0501039_0345112
818 Ga0501043_0055891
819 Ga0501043_0089103
820 Ga0501043_1022654
821 Ga0501046_0944244
822 Ga0501047_0260624
823 Ga0501067_0828016
824 Ga0501068_0103502
825 Ga0501070_0006284
826 Ga0501070_0051620
827 Ga0501070_0599518
828 Ga0501071_0263616
829 Ga0501071_0930924
830 Ga0501071_1211282
831 Ga0501072_0512402
832 Ga0501073_0116123
833 Ga0501074_0299110
834 Ga0501075_1385238
835 Ga0501225_0092486
836 Ga0501081_1231171
837 Ga0501035_0040260
838 Ga0501044_0024732
839 Ga0501044_0696690
840 Ga0501044_0883743
841 Ga0501044_1030480
842 Ga0501045_0366480
843 nmdc:mga03683_16831_c1
844 nmdc:mga03683_224857_c1
845 nmdc:mga03n38_253906_c1
846 nmdc:mga03n38_525388_c1
847 nmdc:mga00v17_164769_c1
848 nmdc:mga00v17_20896_c1
849 nmdc:mga00v17_378683_c1
850 nmdc:mga00v17_812918_c1
851 nmdc:mga0yw44_715897_c1
852 nmdc:mga0k408_158811_c1
853 nmdc:mga0k408_319429_c1
854 nmdc:mga06z11_99408_c1
855 nmdc:mga04h51_315398_c1
856 nmdc:mga04h51_46089_c1
857 nmdc:mga07m45_3384_c1
858 nmdc:mga07m45_80903_c1
859 Ga0495612_0000369
860 Ga0495619_0202949
861 Ga0495619_1187650
862 Ga0500595_034087
863 Ga0500559_0249775
864 Ga0500568_0080860
865 Ga0500573_0346150
866 Ga0500604_0000294
867 Ga0500604_0116169
868 Ga0500624_031807
869 Ga0500634_0000031
870 Ga0500636_0210821
871 Ga0501084_0546031
872 Ga0587070_012120
873 Ga0587070_119407
874 Ga0587073_0027192
875 Ga0587073_0197974
876 Ga0587077_018051
877 Ga0587083_0015116
878 Ga0587083_0194849
879 Ga0587085_015791
880 Ga0587085_094409
881 Ga0587085_117688
882 Ga0587088_029157
883 Ga0587088_062630
884 Ga0587089_044458
885 Ga0587090_038280
886 Ga0587091_010909
887 Ga0587098_010441
888 Ga0587106_022797
889 Ga0587101_000452
890 Ga0587101_015931
891 Ga0587109_086880
892 Ga0587109_144251
893 Ga0587128_057141
894 Ga0587062_000348
895 Ga0587062_029642
896 Ga0587067_084830
897 Ga0587068_040451
898 Ga0587068_078726
899 Ga0587068_124859
900 Ga0587069_025357
901 Ga0587075_004358
902 Ga0587076_021623
903 Ga0587076_035056
904 Ga0587076_117507
905 Ga0587078_022754
906 Ga0587079_249958
907 Ga0587102_012079
908 Ga0587107_002599
909 Ga0587071_067435
910 Ga0587111_0115983
911 Ga0587111_0208723
912 2643911591
913 2644165892
914 2644347098
915 2644410383
916 2932403073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

23

54

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

56

124

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9305 5 71
3cc2-assembly1.cif.gz_T the refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins 0.9171 5 71
7xam-assembly1.cif.gz_V mycobacterium smegmatis 50s ribosomal subunit from stationary phase of growth 0.9144 3 102
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9113 2 102
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9098 5 102
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9139 3 99 2.30.30.30
1jj2S00 Mainly Beta;Roll;SH3 type barrels.; 0.898 5 71 2.30.30.30
af_P54038_1_120_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.891 5 69 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8825 5 101 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.881 3 100 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A163DAD6-F1-model_v4 KOW domain-containing protein 0.9281 5 74 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A6DEY5-F1-model_v4 deleted 0.9243 2 74
AF-G2LHH3-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9216 5 71 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4P5SKN7-F1-model_v4 Large ribosomal subunit protein uL24 0.9187 3 74 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6G8Q2H0-F1-model_v4 Large ribosomal subunit protein uL24 0.9175 3 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map