F448231

General Info

Members Datasets Scaffolds Average Seq Length
458 211 458 133

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0594981|Ga0373925_0594981_396_872
Length 158
Sequence VQSPERPASARHRGDLGLELIRETEVLKTYQGSCHCGAVRFEADLDLTQPTYRCNCSICRRTRFWPAVAREGGFRLLAGESELTQYLFNTRKNQHYFCKHCGVRAFGIGTETPLGKMYGINIGCLSGLSEEDLSRLPITYVDGLRNGWHGAPEFTSHL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
140 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
195 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 1.53
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_469213 2162886006 Unclassified 1539
2 SwRhRL2b_contig_3572545 2162886007 Unclassified 1395
3 Ga0065704_10003856 3300005289 Bacteria 4394
4 Ga0065704_10120437 3300005289 Bacteria 1783
5 Ga0065704_10511732 3300005289 Bacteria 660
6 Ga0065715_10253234 3300005293 Bacteria 1160
7 Ga0065707_10108869 3300005295 Unclassified 2492
8 Ga0065707_10159312 3300005295 Bacteria 1578
9 Ga0070676_10016942 3300005328 Bacteria 4028
10 Ga0070676_10056182 3300005328 Unclassified 2325
11 Ga0070676_10399287 3300005328 Bacteria 956
12 Ga0070690_100052233 3300005330 Bacteria 2612
13 Ga0070670_101212839 3300005331 Bacteria 690
14 Ga0070670_101889592 3300005331 Bacteria 550
15 Ga0070677_10000682 3300005333 Bacteria 11360
16 Ga0070677_10123249 3300005333 Bacteria 1173
17 Ga0068869_100045700 3300005334 Bacteria 3154
18 Ga0068869_100228510 3300005334 Bacteria 1478
19 Ga0068869_100500070 3300005334 Bacteria 1015
20 Ga0070666_10003663 3300005335 Bacteria 9310
21 Ga0070666_10005985 3300005335 Bacteria 7472
22 Ga0070666_10029774 3300005335 Bacteria 3592
23 Ga0068868_100012860 3300005338 Bacteria 6122
24 Ga0068868_100021735 3300005338 Bacteria 4834
25 Ga0068868_100043337 3300005338 Bacteria 3515
26 Ga0070689_100005149 3300005340 Bacteria 8894
27 Ga0070687_100364741 3300005343 Bacteria 936
28 Ga0070661_101790147 3300005344 Bacteria 521
29 Ga0070668_100010119 3300005347 Bacteria 6991
30 Ga0070668_100034654 3300005347 Bacteria 3848
31 Ga0070668_100069544 3300005347 Unclassified 2739
32 Ga0070668_100083818 3300005347 Bacteria 2503
33 Ga0070669_100055454 3300005353 Bacteria 2904
34 Ga0070669_100137835 3300005353 Bacteria 1878
35 Ga0070669_100369246 3300005353 Bacteria 1168
36 Ga0070669_100420786 3300005353 Bacteria 1096
37 Ga0070669_100619439 3300005353 Bacteria 908
38 Ga0070675_100000542 3300005354 Bacteria 25851
39 Ga0070675_100007481 3300005354 Bacteria 8439
40 Ga0070671_100002385 3300005355 Bacteria 14515
41 Ga0070671_100034247 3300005355 Bacteria 4204
42 Ga0070674_100000170 3300005356 Bacteria 30382
43 Ga0070673_100001056 3300005364 Bacteria 15675
44 Ga0070673_100001911 3300005364 Bacteria 12508
45 Ga0070673_100471215 3300005364 Bacteria 1132
46 Ga0070688_100020576 3300005365 Unclassified 3838
47 Ga0070659_100641210 3300005366 Bacteria 915
48 Ga0070659_100959036 3300005366 Bacteria 749
49 Ga0070659_101063228 3300005366 Bacteria 712
50 Ga0070667_100006290 3300005367 Bacteria 9869
51 Ga0070667_100007642 3300005367 Bacteria 8967
52 Ga0070667_100038120 3300005367 Bacteria 4030
53 Ga0070667_100386958 3300005367 Bacteria 1271
54 Ga0070667_100607343 3300005367 Bacteria 1008
55 Ga0070701_11204628 3300005438 Bacteria 537
56 Ga0070711_101768337 3300005439 Bacteria 542
57 Ga0070705_101048183 3300005440 Bacteria 664
58 Ga0070700_100003425 3300005441 Bacteria 8173
59 Ga0070700_100100109 3300005441 Bacteria 1908
60 Ga0070700_101156199 3300005441 Bacteria 644
61 Ga0070694_100075544 3300005444 Bacteria 2331
62 Ga0070694_100078097 3300005444 Bacteria 2295
63 Ga0070694_100815724 3300005444 Bacteria 766
64 Ga0070663_100015175 3300005455 Bacteria 4964
65 Ga0070663_100573842 3300005455 Bacteria 945
66 Ga0070678_100002121 3300005456 Bacteria 10755
67 Ga0070678_100002670 3300005456 Bacteria 9826
68 Ga0070678_100003677 3300005456 Bacteria 8571
69 Ga0070662_100022897 3300005457 Bacteria 4285
70 Ga0070662_100423343 3300005457 Bacteria 1102
71 Ga0068867_100000607 3300005459 Bacteria 23750
72 Ga0068867_100001463 3300005459 Bacteria 16348
73 Ga0068867_100004392 3300005459 Bacteria 9919
74 Ga0068867_100007003 3300005459 Bacteria 7967
75 Ga0068867_100083029 3300005459 Bacteria 2418
76 Ga0068867_100830732 3300005459 Bacteria 826
77 Ga0070685_10069023 3300005466 Bacteria 2089
78 Ga0070698_100005029 3300005471 Bacteria 14484
79 Ga0068853_100009967 3300005539 Bacteria 7672
80 Ga0068853_100362840 3300005539 Bacteria 1350
81 Ga0068853_101931887 3300005539 Bacteria 572
82 Ga0070672_100005042 3300005543 Bacteria 8705
83 Ga0070672_100007534 3300005543 Bacteria 7394
84 Ga0070672_100007895 3300005543 Bacteria 7265
85 Ga0070672_100030209 3300005543 Bacteria 4069
86 Ga0070672_100140554 3300005543 Bacteria 1991
87 Ga0070672_100899179 3300005543 Bacteria 782
88 Ga0070686_100540332 3300005544 Bacteria 910
89 Ga0070693_100692156 3300005547 Bacteria 745
90 Ga0070665_100015150 3300005548 Bacteria 7740
91 Ga0070665_100086475 3300005548 Plasmid 3140
92 Ga0070665_100360407 3300005548 Bacteria 1460
93 Ga0070665_101300398 3300005548 Bacteria 737
94 Ga0070704_100000613 3300005549 Bacteria 17180
95 Ga0068855_100131150 3300005563 Bacteria 2862
96 Ga0070664_100085497 3300005564 Bacteria 2724
97 Ga0070664_100208187 3300005564 Bacteria 1747
98 Ga0068854_100811039 3300005578 Bacteria 816
99 Ga0068852_100008728 3300005616 Bacteria 7493
100 Ga0068852_100056099 3300005616 Bacteria 3402
101 Ga0068852_101201588 3300005616 Unclassified 779
102 Ga0068859_100004209 3300005617 Bacteria 14681
103 Ga0068859_100045470 3300005617 Bacteria 4410
104 Ga0068859_100888316 3300005617 Bacteria 976
105 Ga0068859_100989922 3300005617 Bacteria 923
106 Ga0068864_100010981 3300005618 Bacteria 7489
107 Ga0068864_100169346 3300005618 Bacteria 1991
108 Ga0068864_100445040 3300005618 Bacteria 1238
109 Ga0068866_10021324 3300005718 Bacteria 2983
110 Ga0068861_100028556 3300005719 Bacteria 4071
111 Ga0068861_100160063 3300005719 Bacteria 1856
112 Ga0068861_100183829 3300005719 Bacteria 1742
113 Ga0068861_100187879 3300005719 Bacteria 1725
114 Ga0068851_10001538 3300005834 Bacteria 10114
115 Ga0068851_10098905 3300005834 Bacteria 1545
116 Ga0068870_10012821 3300005840 Bacteria 3924
117 Ga0068870_10603472 3300005840 Bacteria 746
118 Ga0068863_100006205 3300005841 Bacteria 11726
119 Ga0068863_100012071 3300005841 Bacteria 8346
120 Ga0068863_100023397 3300005841 Bacteria 5902
121 Ga0068863_100416377 3300005841 Bacteria 1316
122 Ga0068858_100021036 3300005842 Bacteria 6095
123 Ga0068858_100132531 3300005842 Bacteria 2338
124 Ga0068858_100192888 3300005842 Bacteria 1925
125 Ga0068858_100196477 3300005842 Bacteria 1906
126 Ga0068858_100388791 3300005842 Bacteria 1339
127 Ga0068860_100000807 3300005843 Bacteria 35154
128 Ga0068860_100098845 3300005843 Bacteria 2783
129 Ga0068860_100108468 3300005843 Bacteria 2653
130 Ga0068860_101229648 3300005843 Bacteria 769
131 Ga0068862_100004909 3300005844 Bacteria 11262
132 Ga0068862_100149398 3300005844 Bacteria 2079
133 Ga0068862_100277096 3300005844 Bacteria 1536
134 Ga0068862_101729805 3300005844 Bacteria 634
135 Ga0068862_102561330 3300005844 Bacteria 522
136 Ga0075366_10003236 3300006195 Bacteria 8558
137 Ga0075366_10050880 3300006195 Bacteria 2461
138 Ga0075366_10061937 3300006195 Bacteria 2224
139 Ga0075366_10086157 3300006195 Bacteria 1879
140 Ga0097621_100002388 3300006237 Bacteria 12869
141 Ga0097621_100047036 3300006237 Bacteria 3494
142 Ga0097621_100063951 3300006237 Bacteria 3025
143 Ga0097621_100083026 3300006237 Bacteria 2669
144 Ga0075370_10064680 3300006353 Bacteria 2086
145 Ga0068871_100005270 3300006358 Bacteria 9052
146 Ga0068871_100006115 3300006358 Bacteria 8478
147 Ga0068871_100036346 3300006358 Bacteria 3921
148 Ga0068871_100518538 3300006358 Bacteria 1076
149 Ga0068871_100706235 3300006358 Unclassified 924
150 Ga0075428_100157797 3300006844 Unclassified 2463
151 Ga0075430_100042509 3300006846 Bacteria 3843
152 Ga0075431_101553930 3300006847 Bacteria 620
153 Ga0068865_100002740 3300006881 Bacteria 10467
154 Ga0068865_100204538 3300006881 Bacteria 1535
155 Ga0068865_100630241 3300006881 Bacteria 909
156 Ga0068865_101293945 3300006881 Bacteria 648
157 Ga0068865_101461857 3300006881 Unclassified 611
158 Ga0097620_100004209 3300006931 Bacteria 14681
159 Ga0097620_100045470 3300006931 Bacteria 4410
160 Ga0097620_100888230 3300006931 Bacteria 976
161 Ga0097620_100989965 3300006931 Bacteria 923
162 Ga0111539_11683855 3300009094 Bacteria 735
163 Ga0105245_10259676 3300009098 Bacteria 1690
164 Ga0105245_11360499 3300009098 Bacteria 759
165 Ga0105247_10838709 3300009101 Unclassified 705
166 Ga0105243_10021886 3300009148 Bacteria 4855
167 Ga0105243_10254419 3300009148 Bacteria 1570
168 Ga0105242_11387770 3300009176 Bacteria 729
169 Ga0105242_11747407 3300009176 Unclassified 659
170 Ga0105248_10034200 3300009177 Bacteria 5682
171 Ga0105248_10126015 3300009177 Plasmid 2889
172 Ga0105248_10797423 3300009177 Bacteria 1066
173 Ga0105237_12428854 3300009545 Bacteria 534
174 Ga0105238_10336502 3300009551 Bacteria 1497
175 Ga0105249_10001772 3300009553 Bacteria 18816
176 Ga0105249_10465232 3300009553 Bacteria 1305
177 Ga0105239_13442292 3300010375 Unclassified 514
178 Ga0105246_10269830 3300011119 Bacteria 1360
179 Ga0157374_10013263 3300013296 Bacteria 7191
180 Ga0157374_10271377 3300013296 Bacteria 1673
181 Ga0157374_12292438 3300013296 Unclassified 567
182 Ga0157378_10002215 3300013297 Bacteria 17236
183 Ga0163162_10003082 3300013306 Bacteria 15919
184 Ga0163162_10117239 3300013306 Plasmid 2764
185 Ga0163162_10125014 3300013306 Bacteria 2677
186 Ga0163162_10312859 3300013306 Bacteria 1703
187 Ga0163162_12374686 3300013306 Unclassified 609
188 Ga0157375_10000362 3300013308 Bacteria 41418
189 Ga0157375_10021851 3300013308 Bacteria 5879
190 Ga0157375_10051075 3300013308 Bacteria 4058
191 Ga0157375_10065923 3300013308 Bacteria 3612
192 Ga0157375_10233511 3300013308 Unclassified 1998
193 Ga0163163_10117578 3300014325 Bacteria 2690
194 Ga0157380_10023884 3300014326 Bacteria 4618
195 Ga0157380_10107066 3300014326 Bacteria 2341
196 Ga0157380_10386883 3300014326 Bacteria 1322
197 Ga0157380_10441608 3300014326 Bacteria 1247
198 Ga0157380_11576280 3300014326 Bacteria 712
199 Ga0157380_11954383 3300014326 Bacteria 648
200 Ga0157377_10138209 3300014745 Bacteria 1495
201 Ga0157379_10040849 3300014968 Bacteria 4141
202 Ga0157376_10004202 3300014969 Bacteria 9991
203 Ga0157376_10724423 3300014969 Bacteria 1002
204 Ga0157376_11453964 3300014969 Bacteria 718
205 Ga0157376_12166133 3300014969 Bacteria 595
206 Ga0163161_10025690 3300017792 Bacteria 4170
207 Ga0163161_10035846 3300017792 Bacteria 3551
208 Ga0163161_10042357 3300017792 Bacteria 3275
209 Ga0207697_10017955 3300025315 Bacteria 2904
210 Ga0207697_10134918 3300025315 Bacteria 1068
211 Ga0207656_10181283 3300025321 Bacteria 1011
212 Ga0207682_10000122 3300025893 Bacteria 35790
213 Ga0207682_10025467 3300025893 Bacteria 2346
214 Ga0207682_10417449 3300025893 Bacteria 635
215 Ga0207642_10241381 3300025899 Bacteria 1020
216 Ga0207642_10283820 3300025899 Bacteria 953
217 Ga0207680_10001023 3300025903 Bacteria 13194
218 Ga0207680_10056398 3300025903 Bacteria 2372
219 Ga0207680_10122359 3300025903 Unclassified 1703
220 Ga0207645_10000063 3300025907 Bacteria 76658
221 Ga0207645_10468557 3300025907 Bacteria 851
222 Ga0207643_10018691 3300025908 Bacteria 3795
223 Ga0207662_10190624 3300025918 Bacteria 1323
224 Ga0207649_11302774 3300025920 Bacteria 575
225 Ga0207694_10365787 3300025924 Bacteria 1196
226 Ga0207694_11850439 3300025924 Bacteria 507
227 Ga0207650_10783241 3300025925 Bacteria 808
228 Ga0207650_11735336 3300025925 Bacteria 529
229 Ga0207659_10001476 3300025926 Bacteria 14019
230 Ga0207659_10053351 3300025926 Bacteria 2883
231 Ga0207687_10801869 3300025927 Bacteria 803
232 Ga0207644_10002580 3300025931 Bacteria 11656
233 Ga0207644_10007250 3300025931 Bacteria 7218
234 Ga0207706_10024397 3300025933 Bacteria 5421
235 Ga0207706_10522603 3300025933 Bacteria 1023
236 Ga0207709_10047035 3300025935 Bacteria 2621
237 Ga0207670_10004795 3300025936 Bacteria 7340
238 Ga0207670_10192417 3300025936 Bacteria 1544
239 Ga0207669_10008578 3300025937 Bacteria 4807
240 Ga0207669_11803221 3300025937 Bacteria 523
241 Ga0207704_10026358 3300025938 Bacteria 3188
242 Ga0207704_10115934 3300025938 Bacteria 1822
243 Ga0207704_10161214 3300025938 Bacteria 1596
244 Ga0207704_10542648 3300025938 Bacteria 944
245 Ga0207665_11667615 3300025939 Bacteria 505
246 Ga0207691_10000050 3300025940 Bacteria 94763
247 Ga0207691_10006281 3300025940 Bacteria 11469
248 Ga0207691_10021339 3300025940 Bacteria 6117
249 Ga0207691_10088117 3300025940 Bacteria 2784
250 Ga0207691_11320380 3300025940 Bacteria 595
251 Ga0207711_10000392 3300025941 Bacteria 46482
252 Ga0207711_10065239 3300025941 Bacteria 3147
253 Ga0207711_10687507 3300025941 Bacteria 954
254 Ga0207711_11203759 3300025941 Bacteria 699
255 Ga0207689_10048750 3300025942 Unclassified 3494
256 Ga0207689_10106258 3300025942 Bacteria 2306
257 Ga0207689_11223784 3300025942 Bacteria 632
258 Ga0207679_10580793 3300025945 Bacteria 1008
259 Ga0207667_10931103 3300025949 Bacteria 859
260 Ga0207651_10001236 3300025960 Bacteria 11477
261 Ga0207651_10122680 3300025960 Bacteria 1973
262 Ga0207712_10170389 3300025961 Bacteria 1701
263 Ga0207712_10305949 3300025961 Bacteria 1306
264 Ga0207668_10069054 3300025972 Bacteria 2515
265 Ga0207668_10083839 3300025972 Bacteria 2320
266 Ga0207668_10245015 3300025972 Bacteria 1452
267 Ga0207668_11038650 3300025972 Bacteria 733
268 Ga0207640_10388988 3300025981 Bacteria 1132
269 Ga0207658_10019357 3300025986 Bacteria 4707
270 Ga0207658_10023557 3300025986 Bacteria 4299
271 Ga0207658_10037237 3300025986 Bacteria 3494
272 Ga0207658_10316645 3300025986 Bacteria 1349
273 Ga0207658_10534662 3300025986 Bacteria 1047
274 Ga0207677_10003193 3300026023 Bacteria 8643
275 Ga0207677_10151563 3300026023 Unclassified 1789
276 Ga0207677_10996611 3300026023 Bacteria 759
277 Ga0207703_10000361 3300026035 Bacteria 48627
278 Ga0207703_10036079 3300026035 Bacteria 3933
279 Ga0207703_10214934 3300026035 Bacteria 1716
280 Ga0207703_10338923 3300026035 Bacteria 1381
281 Ga0207639_10179667 3300026041 Bacteria 1799
282 Ga0207639_10201339 3300026041 Bacteria 1708
283 Ga0207678_10001056 3300026067 Bacteria 25189
284 Ga0207708_10063965 3300026075 Bacteria 2811
285 Ga0207708_10103670 3300026075 Bacteria 2203
286 Ga0207708_11115430 3300026075 Bacteria 688
287 Ga0207641_10006777 3300026088 Bacteria 9599
288 Ga0207641_10143628 3300026088 Bacteria 2156
289 Ga0207641_10599359 3300026088 Bacteria 1078
290 Ga0207648_10000491 3300026089 Bacteria 44111
291 Ga0207648_10017571 3300026089 Bacteria 6500
292 Ga0207648_10072043 3300026089 Bacteria 3011
293 Ga0207648_10125025 3300026089 Bacteria 2262
294 Ga0207648_11223097 3300026089 Bacteria 706
295 Ga0207676_10001945 3300026095 Bacteria 15080
296 Ga0207676_10174018 3300026095 Bacteria 1878
297 Ga0207675_100006130 3300026118 Bacteria 11429
298 Ga0207675_100057147 3300026118 Bacteria 3640
299 Ga0207675_100113833 3300026118 Bacteria 2554
300 Ga0207675_100160881 3300026118 Bacteria 2141
301 Ga0207675_100394314 3300026118 Bacteria 1363
302 Ga0207675_101316192 3300026118 Bacteria 743
303 Ga0207683_10000521 3300026121 Bacteria 35599
304 Ga0207683_10000995 3300026121 Bacteria 25942
305 Ga0207683_10008204 3300026121 Bacteria 8937
306 Ga0207698_10030624 3300026142 Bacteria 3872
307 Ga0207698_10092992 3300026142 Bacteria 2474
308 Ga0209995_1062383 3300027471 Bacteria 635
309 Ga0268266_10079077 3300028379 Bacteria 2862
310 Ga0268266_10372934 3300028379 Unclassified 1344
311 Ga0268265_10004412 3300028380 Bacteria 9776
312 Ga0268265_10162720 3300028380 Bacteria 1898
313 Ga0268265_10225229 3300028380 Bacteria 1644
314 Ga0268264_10005327 3300028381 Bacteria 10897
315 Ga0268264_10091033 3300028381 Unclassified 2630
316 Ga0268264_10471572 3300028381 Bacteria 1219
317 Ga0268264_10491542 3300028381 Bacteria 1195
318 Ga0307515_10012474 3300028794 Bacteria 15981
319 Ga0307515_10198886 3300028794 Bacteria 1887
320 Ga0307515_10219985 3300028794 Bacteria 1720
321 Ga0307512_10224331 3300030522 Bacteria 976
322 Ga0307509_10052108 3300031507 Bacteria 4370
323 Ga0307509_10208405 3300031507 Bacteria 1782
324 Ga0307509_10282076 3300031507 Bacteria 1422
325 Ga0307508_10000466 3300031616 Bacteria 48802
326 Ga0307514_10008972 3300031649 Bacteria 8449
327 Ga0307407_10576658 3300031903 Bacteria 835
328 Ga0307415_101017791 3300032126 Unclassified 771
329 Ga0307507_10096556 3300033179 Bacteria 2499
330 Ga0373948_0074654 3300034817 Unclassified 765
331 Ga0373950_0032418 3300034818 Unclassified 972
332 Ga0373938_0028825 3300034957 Unclassified 1176
333 Ga0373926_0369715 3300035083 Bacteria 564
334 Ga0373928_0211157 3300035084 Bacteria 564
335 Ga0373940_0005964 3300035088 Unclassified 2675
336 Ga0373949_0008073 3300035090 Unclassified 2306
337 Ga0373932_0041366 3300035112 Unclassified 1331
338 Ga0373939_0037046 3300035114 Bacteria 1447
339 Ga0373931_0000241 3300035691 Bacteria 23316
340 Ga0373925_0244521 3300037068 Bacteria 1438
341 Ga0373925_0594981 3300037068 Bacteria 911
342 Ga0451798_0856659 3300041458 Bacteria 735
343 Ga0451807_0288353 3300041486 Bacteria 2507
344 Ga0439437_008187 3300042000 Bacteria 1174
345 Ga0439441_073399 3300042001 Bacteria 737
346 Ga0439450_001216 3300042008 Bacteria 3702
347 Ga0450888_005839 3300042126 Bacteria 1324
348 Ga0439464_0000405 3300042439 Bacteria 8475
349 Ga0439460_0167617 3300042461 Bacteria 738
350 Ga0451576_0017448 3300045051 Bacteria 7891
351 Ga0451576_0051999 3300045051 Bacteria 4293
352 Ga0495580_0684256 3300046472 Bacteria 672
353 Ga0495598_0002335 3300046537 Bacteria 3907
354 Ga0495621_0019494 3300046539 Bacteria 2216
355 Ga0495670_0163315 3300046691 Bacteria 1171
356 Ga0495636_0340032 3300047318 Bacteria 707
357 Ga0495615_0181850 3300048090 Bacteria 641
358 Ga0496104_1435134 3300048907 Unclassified 593
359 Ga0496107_0480966 3300048910 Bacteria 922
360 Ga0496108_0085706 3300048911 Bacteria 2674
361 Ga0496109_0266919 3300048912 Bacteria 1612
362 Ga0496114_0582044 3300048917 Bacteria 988
363 Ga0501031_0009615 3300049568 Bacteria 6295
364 Ga0501032_0007110 3300049569 Bacteria 8195
365 Ga0501032_0061542 3300049569 Bacteria 2516
366 Ga0501033_0000455 3300049570 Bacteria 38949
367 Ga0501034_0003491 3300049571 Bacteria 17856
368 Ga0501034_0104176 3300049571 Bacteria 2830
369 Ga0501034_0149098 3300049571 Bacteria 2315
370 Ga0501036_0014202 3300049572 Bacteria 6625
371 Ga0501036_1378353 3300049572 Bacteria 572
372 Ga0501037_0050179 3300049573 Bacteria 3054
373 Ga0501037_0545024 3300049573 Bacteria 783
374 Ga0501038_0004916 3300049574 Bacteria 12416
375 Ga0501038_0066849 3300049574 Bacteria 3060
376 Ga0501039_0006105 3300049575 Bacteria 9146
377 Ga0501039_0030957 3300049575 Bacteria 4126
378 Ga0501039_0200330 3300049575 Unclassified 1570
379 Ga0501040_0599079 3300049576 Bacteria 796
380 Ga0501042_0238227 3300049578 Bacteria 1313
381 Ga0501042_0481782 3300049578 Bacteria 900
382 Ga0501043_0810854 3300049579 Bacteria 676
383 Ga0501046_0002329 3300049580 Bacteria 17906
384 Ga0501047_0000533 3300049581 Bacteria 41217
385 Ga0501047_0006322 3300049581 Bacteria 11141
386 Ga0501047_0167854 3300049581 Bacteria 2065
387 Ga0501047_0240774 3300049581 Bacteria 1660
388 Ga0501067_0025959 3300049583 Bacteria 3246
389 Ga0501067_0088616 3300049583 Unclassified 1717
390 Ga0501067_0130767 3300049583 Unclassified 1397
391 Ga0501067_0478715 3300049583 Bacteria 696
392 Ga0501068_0026061 3300049584 Bacteria 3442
393 Ga0501068_0138130 3300049584 Bacteria 1527
394 Ga0501068_0220883 3300049584 Bacteria 1204
395 Ga0501069_0037365 3300049585 Bacteria 2680
396 Ga0501069_0865795 3300049585 Bacteria 549
397 Ga0501070_0028722 3300049586 Bacteria 4663
398 Ga0501070_0036617 3300049586 Bacteria 4097
399 Ga0501070_0051190 3300049586 Bacteria 3428
400 Ga0501070_0376620 3300049586 Bacteria 1150
401 Ga0501071_0001799 3300049587 Bacteria 12667
402 Ga0501071_0043138 3300049587 Bacteria 3233
403 Ga0501071_0044748 3300049587 Bacteria 3176
404 Ga0501071_0099385 3300049587 Bacteria 2144
405 Ga0501071_0119042 3300049587 Bacteria 1957
406 Ga0501071_0392080 3300049587 Bacteria 1060
407 Ga0501072_0002457 3300049588 Bacteria 13872
408 Ga0501072_0046143 3300049588 Bacteria 3428
409 Ga0501072_0145457 3300049588 Unclassified 1890
410 Ga0501072_0215764 3300049588 Bacteria 1529
411 Ga0501072_0497606 3300049588 Bacteria 964
412 Ga0501073_0001358 3300049589 Bacteria 18073
413 Ga0501073_0009722 3300049589 Bacteria 7083
414 Ga0501073_0041967 3300049589 Bacteria 3230
415 Ga0501073_0262018 3300049589 Bacteria 1193
416 Ga0501074_0006519 3300049590 Bacteria 8427
417 Ga0501074_0295847 3300049590 Bacteria 1150
418 Ga0501075_0036165 3300049591 Bacteria 3686
419 Ga0501075_0161927 3300049591 Bacteria 1707
420 Ga0501075_0607345 3300049591 Bacteria 834
421 Ga0501076_0087416 3300049592 Bacteria 2506
422 Ga0501077_0624655 3300049593 Unclassified 692
423 Ga0501209_000083 3300049656 Bacteria 9535
424 Ga0501233_220642 3300049668 Unclassified 560
425 Ga0501257_103742 3300049686 Unclassified 749
426 Ga0501079_0073720 3300049741 Bacteria 2639
427 Ga0501079_0103988 3300049741 Bacteria 2203
428 Ga0501079_0311561 3300049741 Bacteria 1232
429 Ga0501079_0318714 3300049741 Bacteria 1217
430 Ga0501079_0400925 3300049741 Bacteria 1076
431 Ga0501080_0003688 3300049742 Bacteria 13514
432 Ga0501080_0008180 3300049742 Bacteria 9474
433 Ga0501080_0021209 3300049742 Bacteria 6012
434 Ga0501080_0056665 3300049742 Bacteria 3649
435 Ga0501080_0074141 3300049742 Bacteria 3166
436 Ga0501080_0120199 3300049742 Bacteria 2435
437 Ga0501080_0168235 3300049742 Bacteria 2023
438 Ga0501083_0194838 3300049744 Bacteria 1322
439 Ga0501083_0630175 3300049744 Unclassified 697
440 Ga0501275_000032 3300049772 Bacteria 14501
441 Ga0501035_0178680 3300049822 Bacteria 1829
442 Ga0501044_0005262 3300049823 Bacteria 14396
443 Ga0501044_0177641 3300049823 Bacteria 2097
444 Ga0501045_0392310 3300049824 Bacteria 1033
445 Ga0501045_0415368 3300049824 Unclassified 1001
446 nmdc:mga0k408_15543_c1 3300050493 Bacteria 4209
447 nmdc:mga0k408_42313_c1 3300050493 Bacteria 2624
448 nmdc:mga0k408_486807_c1 3300050493 Bacteria 732
449 nmdc:mga06z11_926749_c1 3300050494 Bacteria 531
450 nmdc:mga07m45_26651_c1 3300050496 Bacteria 3178
451 nmdc:mga06r32_1320437_c1 3300050510 Bacteria 665
452 nmdc:mga06r32_1434889_c1 3300050510 Bacteria 631
453 nmdc:mga0sz30_31904_c1 3300050516 Bacteria 2182
454 Ga0500651_0495804 3300053093 Bacteria 674
455 Ga0501084_0017533 3300054114 Bacteria 5955
456 Ga0501084_0482159 3300054114 Bacteria 1048
457 Ga0501082_0085812 3300060353 Bacteria 2715
458 Ga0501082_0523054 3300060353 Bacteria 1037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10417449 Ga0207682_104174492 130
2 3300005289 Ga0065704_10511732 Ga0065704_105117322 132
3 3300005295 Ga0065707_10159312 Ga0065707_101593122 132
4 3300005328 Ga0070676_10016942 Ga0070676_100169421 132
5 3300005328 Ga0070676_10056182 Ga0070676_100561823 132
6 3300005331 Ga0070670_101889592 Ga0070670_1018895921 132
7 3300005333 Ga0070677_10000682 Ga0070677_100006828 132
8 3300005334 Ga0068869_100500070 Ga0068869_1005000701 132
9 3300005335 Ga0070666_10005985 Ga0070666_1000598514 132
10 3300005335 Ga0070666_10029774 Ga0070666_100297746 132
11 3300005338 Ga0068868_100012860 Ga0068868_1000128603 132
12 3300005347 Ga0070668_100010119 Ga0070668_10001011914 132
13 3300005347 Ga0070668_100069544 Ga0070668_1000695442 132
14 3300005347 Ga0070668_100083818 Ga0070668_1000838181 132
15 3300005353 Ga0070669_100369246 Ga0070669_1003692462 132
16 3300005354 Ga0070675_100000542 Ga0070675_10000054256 132
17 3300005355 Ga0070671_100034247 Ga0070671_1000342478 132
18 3300005356 Ga0070674_100000170 Ga0070674_10000017019 132
19 3300005364 Ga0070673_100001911 Ga0070673_10000191117 132
20 3300005364 Ga0070673_100471215 Ga0070673_1004712152 132
21 3300005366 Ga0070659_100959036 Ga0070659_1009590361 132
22 3300005367 Ga0070667_100007642 Ga0070667_10000764211 132
23 3300005367 Ga0070667_100386958 Ga0070667_1003869582 132
24 3300005440 Ga0070705_101048183 Ga0070705_1010481832 132
25 3300005444 Ga0070694_100075544 Ga0070694_1000755442 132
26 3300005455 Ga0070663_100015175 Ga0070663_1000151753 132
27 3300005456 Ga0070678_100002121 Ga0070678_1000021212 132
28 3300005456 Ga0070678_100002670 Ga0070678_10000267014 132
29 3300005459 Ga0068867_100004392 Ga0068867_1000043927 132
30 3300005459 Ga0068867_100083029 Ga0068867_1000830293 132
31 3300005471 Ga0070698_100005029 Ga0070698_10000502913 132
32 3300005539 Ga0068853_100009967 Ga0068853_10000996715 132
33 3300005539 Ga0068853_101931887 Ga0068853_1019318871 132
34 3300005543 Ga0070672_100007534 Ga0070672_1000075343 132
35 3300005543 Ga0070672_100030209 Ga0070672_1000302092 132
36 3300005548 Ga0070665_100015150 Ga0070665_10001515015 132
37 3300005548 Ga0070665_100086475 Ga0070665_1000864755 132
38 3300005549 Ga0070704_100000613 Ga0070704_10000061314 132
39 3300005564 Ga0070664_100085497 Ga0070664_1000854975 132
40 3300005616 Ga0068852_100056099 Ga0068852_1000560997 132
41 3300005616 Ga0068852_101201588 Ga0068852_1012015882 132
42 3300005617 Ga0068859_100045470 Ga0068859_1000454703 132
43 3300005617 Ga0068859_100888316 Ga0068859_1008883162 132
44 3300005618 Ga0068864_100169346 Ga0068864_1001693462 132
45 3300005618 Ga0068864_100445040 Ga0068864_1004450402 132
46 3300005719 Ga0068861_100187879 Ga0068861_1001878792 132
47 3300005834 Ga0068851_10001538 Ga0068851_1000153815 132
48 3300005840 Ga0068870_10012821 Ga0068870_100128213 132
49 3300005841 Ga0068863_100006205 Ga0068863_1000062058 132
50 3300005841 Ga0068863_100023397 Ga0068863_1000233975 132
51 3300005842 Ga0068858_100192888 Ga0068858_1001928883 132
52 3300005842 Ga0068858_100196477 Ga0068858_1001964773 132
53 3300005843 Ga0068860_100098845 Ga0068860_1000988455 132
54 3300005843 Ga0068860_100108468 Ga0068860_1001084684 132
55 3300005844 Ga0068862_101729805 Ga0068862_1017298052 132
56 3300006195 Ga0075366_10050880 Ga0075366_100508803 132
57 3300006237 Ga0097621_100047036 Ga0097621_1000470362 132
58 3300006237 Ga0097621_100063951 Ga0097621_1000639513 132
59 3300006237 Ga0097621_100083026 Ga0097621_1000830264 132
60 3300006358 Ga0068871_100005270 Ga0068871_1000052707 132
61 3300006358 Ga0068871_100706235 Ga0068871_1007062352 132
62 3300006846 Ga0075430_100042509 Ga0075430_1000425095 132
63 3300006847 Ga0075431_101553930 Ga0075431_1015539301 132
64 3300006881 Ga0068865_100630241 Ga0068865_1006302412 132
65 3300006881 Ga0068865_101293945 Ga0068865_1012939451 132
66 3300006881 Ga0068865_101461857 Ga0068865_1014618571 132
67 3300006931 Ga0097620_100045470 Ga0097620_1000454703 132
68 3300006931 Ga0097620_100888230 Ga0097620_1008882302 132
69 3300009177 Ga0105248_10034200 Ga0105248_100342006 132
70 3300009177 Ga0105248_10126015 Ga0105248_101260154 132
71 3300009177 Ga0105248_10797423 Ga0105248_107974232 132
72 3300009551 Ga0105238_10336502 Ga0105238_103365022 132
73 3300013296 Ga0157374_10013263 Ga0157374_100132632 132
74 3300013296 Ga0157374_10271377 Ga0157374_102713771 132
75 3300013306 Ga0163162_10117239 Ga0163162_101172395 132
76 3300013306 Ga0163162_10125014 Ga0163162_101250143 132
77 3300013308 Ga0157375_10000362 Ga0157375_1000036235 132
78 3300013308 Ga0157375_10065923 Ga0157375_100659232 132
79 3300013308 Ga0157375_10233511 Ga0157375_102335111 132
80 3300014326 Ga0157380_10386883 Ga0157380_103868831 132
81 3300014326 Ga0157380_11954383 Ga0157380_119543831 132
82 3300014969 Ga0157376_10004202 Ga0157376_100042028 132
83 3300017792 Ga0163161_10025690 Ga0163161_100256904 132
84 3300025315 Ga0207697_10017955 Ga0207697_100179554 132
85 3300025893 Ga0207682_10000122 Ga0207682_100001224 132
86 3300025899 Ga0207642_10283820 Ga0207642_102838202 132
87 3300025903 Ga0207680_10056398 Ga0207680_100563983 132
88 3300025903 Ga0207680_10122359 Ga0207680_101223593 132
89 3300025907 Ga0207645_10000063 Ga0207645_1000006390 132
90 3300025908 Ga0207643_10018691 Ga0207643_100186913 132
91 3300025924 Ga0207694_10365787 Ga0207694_103657873 132
92 3300025925 Ga0207650_11735336 Ga0207650_117353361 132
93 3300025926 Ga0207659_10053351 Ga0207659_100533512 132
94 3300025931 Ga0207644_10007250 Ga0207644_1000725014 132
95 3300025937 Ga0207669_10008578 Ga0207669_100085782 132
96 3300025938 Ga0207704_10542648 Ga0207704_105426482 132
97 3300025940 Ga0207691_10000050 Ga0207691_10000050129 132
98 3300025940 Ga0207691_10021339 Ga0207691_100213395 132
99 3300025941 Ga0207711_10065239 Ga0207711_100652392 132
100 3300025941 Ga0207711_10687507 Ga0207711_106875072 132
101 3300025941 Ga0207711_11203759 Ga0207711_112037592 132
102 3300025945 Ga0207679_10580793 Ga0207679_105807931 132
103 3300025960 Ga0207651_10122680 Ga0207651_101226802 132
104 3300025972 Ga0207668_10069054 Ga0207668_100690544 132
105 3300025972 Ga0207668_10083839 Ga0207668_100838393 132
106 3300025972 Ga0207668_10245015 Ga0207668_102450151 132
107 3300025986 Ga0207658_10019357 Ga0207658_100193573 132
108 3300025986 Ga0207658_10316645 Ga0207658_103166452 132
109 3300026023 Ga0207677_10996611 Ga0207677_109966112 132
110 3300026035 Ga0207703_10214934 Ga0207703_102149343 132
111 3300026041 Ga0207639_10201339 Ga0207639_102013391 132
112 3300026067 Ga0207678_10001056 Ga0207678_1000105635 132
113 3300026075 Ga0207708_11115430 Ga0207708_111154302 132
114 3300026088 Ga0207641_10599359 Ga0207641_105993592 132
115 3300026089 Ga0207648_10125025 Ga0207648_101250255 132
116 3300026095 Ga0207676_10174018 Ga0207676_101740184 132
117 3300026118 Ga0207675_100113833 Ga0207675_1001138333 132
118 3300026121 Ga0207683_10000521 Ga0207683_1000052168 132
119 3300026121 Ga0207683_10008204 Ga0207683_1000820414 132
120 3300026142 Ga0207698_10092992 Ga0207698_100929921 132
121 3300028379 Ga0268266_10079077 Ga0268266_100790774 132
122 3300028379 Ga0268266_10372934 Ga0268266_103729342 132
123 3300028381 Ga0268264_10471572 Ga0268264_104715721 132
124 3300028381 Ga0268264_10491542 Ga0268264_104915421 132
125 3300031507 Ga0307509_10052108 Ga0307509_100521081 132
126 3300042000 Ga0439437_008187 Ga0439437_008187_128_526 132
127 3300042001 Ga0439441_073399 Ga0439441_073399_253_651 132
128 3300042126 Ga0450888_005839 Ga0450888_005839_469_867 132
129 3300048090 Ga0495615_0181850 Ga0495615_0181850_206_604 132
130 3300049571 Ga0501034_0149098 Ga0501034_0149098_346_744 132
131 3300049575 Ga0501039_0030957 Ga0501039_0030957_1888_2286 132
132 3300049581 Ga0501047_0167854 Ga0501047_0167854_1387_1785 132
133 3300049583 Ga0501067_0088616 Ga0501067_0088616_463_861 132
134 3300049586 Ga0501070_0028722 Ga0501070_0028722_163_561 132
135 3300049587 Ga0501071_0099385 Ga0501071_0099385_1410_1808 132
136 3300049588 Ga0501072_0046143 Ga0501072_0046143_1773_2171 132
137 3300049589 Ga0501073_0009722 Ga0501073_0009722_4583_4981 132
138 3300049591 Ga0501075_0607345 Ga0501075_0607345_307_705 132
139 3300049741 Ga0501079_0318714 Ga0501079_0318714_439_837 132
140 3300049742 Ga0501080_0021209 Ga0501080_0021209_1475_1873 132
141 3300049772 Ga0501275_000032 Ga0501275_000032_9337_9882 132
142 3300050493 nmdc:mga0k408_42313_c1 nmdc:mga0k408_42313_c1_1036_1434 132
143 3300050510 nmdc:mga06r32_1320437_c1 nmdc:mga06r32_1320437_c1_205_603 132
144 3300053093 Ga0500651_0495804 Ga0500651_0495804_55_459 132
145 2162886006 SwRhRL3b_contig_469213 SwRhRL3b_0510.00000430 133
146 2162886007 SwRhRL2b_contig_3572545 SwRhRL2b_0566.00008300 133
147 3300005289 Ga0065704_10003856 Ga0065704_100038563 133
148 3300005289 Ga0065704_10120437 Ga0065704_101204373 133
149 3300005293 Ga0065715_10253234 Ga0065715_102532342 133
150 3300005295 Ga0065707_10108869 Ga0065707_101088694 133
151 3300005328 Ga0070676_10399287 Ga0070676_103992872 133
152 3300005330 Ga0070690_100052233 Ga0070690_1000522331 133
153 3300005331 Ga0070670_101212839 Ga0070670_1012128391 133
154 3300005333 Ga0070677_10123249 Ga0070677_101232492 133
155 3300005334 Ga0068869_100045700 Ga0068869_1000457005 133
156 3300005334 Ga0068869_100228510 Ga0068869_1002285103 133
157 3300005335 Ga0070666_10003663 Ga0070666_1000366311 133
158 3300005338 Ga0068868_100021735 Ga0068868_1000217354 133
159 3300005338 Ga0068868_100043337 Ga0068868_1000433374 133
160 3300005340 Ga0070689_100005149 Ga0070689_1000051494 133
161 3300005343 Ga0070687_100364741 Ga0070687_1003647412 133
162 3300005344 Ga0070661_101790147 Ga0070661_1017901471 133
163 3300005347 Ga0070668_100034654 Ga0070668_1000346541 133
164 3300005353 Ga0070669_100055454 Ga0070669_1000554544 133
165 3300005353 Ga0070669_100137835 Ga0070669_1001378353 133
166 3300005353 Ga0070669_100420786 Ga0070669_1004207861 133
167 3300005353 Ga0070669_100619439 Ga0070669_1006194392 133
168 3300005354 Ga0070675_100007481 Ga0070675_10000748113 133
169 3300005355 Ga0070671_100002385 Ga0070671_10000238525 133
170 3300005364 Ga0070673_100001056 Ga0070673_1000010568 133
171 3300005365 Ga0070688_100020576 Ga0070688_1000205764 133
172 3300005366 Ga0070659_100641210 Ga0070659_1006412101 133
173 3300005366 Ga0070659_101063228 Ga0070659_1010632282 133
174 3300005367 Ga0070667_100006290 Ga0070667_10000629011 133
175 3300005367 Ga0070667_100038120 Ga0070667_1000381202 133
176 3300005367 Ga0070667_100607343 Ga0070667_1006073432 133
177 3300005438 Ga0070701_11204628 Ga0070701_112046281 133
178 3300005439 Ga0070711_101768337 Ga0070711_1017683371 133
179 3300005441 Ga0070700_100003425 Ga0070700_10000342514 133
180 3300005441 Ga0070700_100100109 Ga0070700_1001001093 133
181 3300005441 Ga0070700_101156199 Ga0070700_1011561991 133
182 3300005444 Ga0070694_100078097 Ga0070694_1000780974 133
183 3300005444 Ga0070694_100815724 Ga0070694_1008157241 133
184 3300005455 Ga0070663_100573842 Ga0070663_1005738421 133
185 3300005456 Ga0070678_100003677 Ga0070678_10000367713 133
186 3300005457 Ga0070662_100022897 Ga0070662_1000228976 133
187 3300005457 Ga0070662_100423343 Ga0070662_1004233432 133
188 3300005459 Ga0068867_100000607 Ga0068867_10000060720 133
189 3300005459 Ga0068867_100001463 Ga0068867_10000146315 133
190 3300005459 Ga0068867_100007003 Ga0068867_10000700310 133
191 3300005459 Ga0068867_100830732 Ga0068867_1008307322 133
192 3300005466 Ga0070685_10069023 Ga0070685_100690233 133
193 3300005539 Ga0068853_100362840 Ga0068853_1003628402 133
194 3300005543 Ga0070672_100005042 Ga0070672_1000050421 133
195 3300005543 Ga0070672_100007895 Ga0070672_1000078957 133
196 3300005543 Ga0070672_100140554 Ga0070672_1001405543 133
197 3300005543 Ga0070672_100899179 Ga0070672_1008991791 133
198 3300005544 Ga0070686_100540332 Ga0070686_1005403321 133
199 3300005547 Ga0070693_100692156 Ga0070693_1006921562 133
200 3300005548 Ga0070665_100360407 Ga0070665_1003604072 133
201 3300005548 Ga0070665_101300398 Ga0070665_1013003982 133
202 3300005563 Ga0068855_100131150 Ga0068855_1001311501 133
203 3300005564 Ga0070664_100208187 Ga0070664_1002081873 133
204 3300005578 Ga0068854_100811039 Ga0068854_1008110392 133
205 3300005616 Ga0068852_100008728 Ga0068852_10000872812 133
206 3300005617 Ga0068859_100004209 Ga0068859_10000420926 133
207 3300005617 Ga0068859_100989922 Ga0068859_1009899222 133
208 3300005618 Ga0068864_100010981 Ga0068864_1000109818 133
209 3300005718 Ga0068866_10021324 Ga0068866_100213246 133
210 3300005719 Ga0068861_100028556 Ga0068861_1000285568 133
211 3300005719 Ga0068861_100160063 Ga0068861_1001600634 133
212 3300005719 Ga0068861_100183829 Ga0068861_1001838293 133
213 3300005834 Ga0068851_10098905 Ga0068851_100989053 133
214 3300005840 Ga0068870_10603472 Ga0068870_106034722 133
215 3300005841 Ga0068863_100012071 Ga0068863_10001207112 133
216 3300005841 Ga0068863_100416377 Ga0068863_1004163771 133
217 3300005842 Ga0068858_100021036 Ga0068858_1000210365 133
218 3300005842 Ga0068858_100132531 Ga0068858_1001325315 133
219 3300005842 Ga0068858_100388791 Ga0068858_1003887912 133
220 3300005843 Ga0068860_100000807 Ga0068860_10000080736 133
221 3300005843 Ga0068860_101229648 Ga0068860_1012296482 133
222 3300005844 Ga0068862_100004909 Ga0068862_10000490918 133
223 3300005844 Ga0068862_100149398 Ga0068862_1001493984 133
224 3300005844 Ga0068862_100277096 Ga0068862_1002770963 133
225 3300005844 Ga0068862_102561330 Ga0068862_1025613301 133
226 3300006195 Ga0075366_10003236 Ga0075366_1000323613 133
227 3300006195 Ga0075366_10061937 Ga0075366_100619372 133
228 3300006195 Ga0075366_10086157 Ga0075366_100861573 133
229 3300006237 Ga0097621_100002388 Ga0097621_1000023883 133
230 3300006353 Ga0075370_10064680 Ga0075370_100646802 133
231 3300006358 Ga0068871_100006115 Ga0068871_10000611515 133
232 3300006358 Ga0068871_100036346 Ga0068871_1000363465 133
233 3300006358 Ga0068871_100518538 Ga0068871_1005185382 133
234 3300006844 Ga0075428_100157797 Ga0075428_1001577972 133
235 3300006881 Ga0068865_100002740 Ga0068865_10000274011 133
236 3300006881 Ga0068865_100204538 Ga0068865_1002045382 133
237 3300006931 Ga0097620_100004209 Ga0097620_10000420926 133
238 3300006931 Ga0097620_100989965 Ga0097620_1009899652 133
239 3300009094 Ga0111539_11683855 Ga0111539_116838552 133
240 3300009098 Ga0105245_10259676 Ga0105245_102596762 133
241 3300009098 Ga0105245_11360499 Ga0105245_113604991 133
242 3300009101 Ga0105247_10838709 Ga0105247_108387092 133
243 3300009148 Ga0105243_10021886 Ga0105243_100218868 133
244 3300009148 Ga0105243_10254419 Ga0105243_102544192 133
245 3300009176 Ga0105242_11387770 Ga0105242_113877701 133
246 3300009176 Ga0105242_11747407 Ga0105242_117474071 133
247 3300009545 Ga0105237_12428854 Ga0105237_124288541 133
248 3300009553 Ga0105249_10001772 Ga0105249_100017724 133
249 3300009553 Ga0105249_10465232 Ga0105249_104652322 133
250 3300010375 Ga0105239_13442292 Ga0105239_134422921 133
251 3300011119 Ga0105246_10269830 Ga0105246_102698302 133
252 3300013296 Ga0157374_12292438 Ga0157374_122924382 133
253 3300013297 Ga0157378_10002215 Ga0157378_1000221515 133
254 3300013306 Ga0163162_10003082 Ga0163162_100030825 133
255 3300013306 Ga0163162_10312859 Ga0163162_103128594 133
256 3300013306 Ga0163162_12374686 Ga0163162_123746861 133
257 3300013308 Ga0157375_10021851 Ga0157375_1002185111 133
258 3300013308 Ga0157375_10051075 Ga0157375_100510755 133
259 3300014325 Ga0163163_10117578 Ga0163163_101175781 133
260 3300014326 Ga0157380_10023884 Ga0157380_100238846 133
261 3300014326 Ga0157380_10107066 Ga0157380_101070664 133
262 3300014326 Ga0157380_10441608 Ga0157380_104416082 133
263 3300014326 Ga0157380_11576280 Ga0157380_115762801 133
264 3300014745 Ga0157377_10138209 Ga0157377_101382093 133
265 3300014968 Ga0157379_10040849 Ga0157379_100408492 133
266 3300014969 Ga0157376_10724423 Ga0157376_107244232 133
267 3300014969 Ga0157376_11453964 Ga0157376_114539641 133
268 3300014969 Ga0157376_12166133 Ga0157376_121661331 133
269 3300017792 Ga0163161_10035846 Ga0163161_100358465 133
270 3300017792 Ga0163161_10042357 Ga0163161_100423576 133
271 3300025315 Ga0207697_10134918 Ga0207697_101349181 133
272 3300025321 Ga0207656_10181283 Ga0207656_101812831 133
273 3300025893 Ga0207682_10025467 Ga0207682_100254674 133
274 3300025899 Ga0207642_10241381 Ga0207642_102413812 133
275 3300025903 Ga0207680_10001023 Ga0207680_100010236 133
276 3300025907 Ga0207645_10468557 Ga0207645_104685572 133
277 3300025918 Ga0207662_10190624 Ga0207662_101906242 133
278 3300025920 Ga0207649_11302774 Ga0207649_113027742 133
279 3300025924 Ga0207694_11850439 Ga0207694_118504391 133
280 3300025925 Ga0207650_10783241 Ga0207650_107832412 133
281 3300025926 Ga0207659_10001476 Ga0207659_1000147621 133
282 3300025927 Ga0207687_10801869 Ga0207687_108018691 133
283 3300025931 Ga0207644_10002580 Ga0207644_1000258012 133
284 3300025933 Ga0207706_10024397 Ga0207706_100243973 133
285 3300025933 Ga0207706_10522603 Ga0207706_105226032 133
286 3300025935 Ga0207709_10047035 Ga0207709_100470352 133
287 3300025936 Ga0207670_10004795 Ga0207670_1000479511 133
288 3300025936 Ga0207670_10192417 Ga0207670_101924172 133
289 3300025937 Ga0207669_11803221 Ga0207669_118032211 133
290 3300025938 Ga0207704_10026358 Ga0207704_100263582 133
291 3300025938 Ga0207704_10115934 Ga0207704_101159344 133
292 3300025938 Ga0207704_10161214 Ga0207704_101612143 133
293 3300025939 Ga0207665_11667615 Ga0207665_116676151 133
294 3300025940 Ga0207691_10006281 Ga0207691_1000628122 133
295 3300025940 Ga0207691_10088117 Ga0207691_100881174 133
296 3300025940 Ga0207691_11320380 Ga0207691_113203801 133
297 3300025941 Ga0207711_10000392 Ga0207711_1000039251 133
298 3300025942 Ga0207689_10048750 Ga0207689_100487504 133
299 3300025942 Ga0207689_10106258 Ga0207689_101062583 133
300 3300025942 Ga0207689_11223784 Ga0207689_112237841 133
301 3300025949 Ga0207667_10931103 Ga0207667_109311032 133
302 3300025960 Ga0207651_10001236 Ga0207651_1000123616 133
303 3300025961 Ga0207712_10170389 Ga0207712_101703892 133
304 3300025961 Ga0207712_10305949 Ga0207712_103059492 133
305 3300025972 Ga0207668_11038650 Ga0207668_110386502 133
306 3300025981 Ga0207640_10388988 Ga0207640_103889882 133
307 3300025986 Ga0207658_10023557 Ga0207658_100235576 133
308 3300025986 Ga0207658_10037237 Ga0207658_100372375 133
309 3300025986 Ga0207658_10534662 Ga0207658_105346622 133
310 3300026023 Ga0207677_10003193 Ga0207677_100031937 133
311 3300026023 Ga0207677_10151563 Ga0207677_101515631 133
312 3300026035 Ga0207703_10000361 Ga0207703_1000036126 133
313 3300026035 Ga0207703_10036079 Ga0207703_100360796 133
314 3300026035 Ga0207703_10338923 Ga0207703_103389232 133
315 3300026041 Ga0207639_10179667 Ga0207639_101796671 133
316 3300026075 Ga0207708_10063965 Ga0207708_100639654 133
317 3300026075 Ga0207708_10103670 Ga0207708_101036703 133
318 3300026088 Ga0207641_10006777 Ga0207641_1000677713 133
319 3300026088 Ga0207641_10143628 Ga0207641_101436281 133
320 3300026089 Ga0207648_10000491 Ga0207648_1000049156 133
321 3300026089 Ga0207648_10017571 Ga0207648_100175714 133
322 3300026089 Ga0207648_10072043 Ga0207648_100720435 133
323 3300026089 Ga0207648_11223097 Ga0207648_112230972 133
324 3300026095 Ga0207676_10001945 Ga0207676_100019456 133
325 3300026118 Ga0207675_100006130 Ga0207675_10000613021 133
326 3300026118 Ga0207675_100057147 Ga0207675_1000571472 133
327 3300026118 Ga0207675_100160881 Ga0207675_1001608812 133
328 3300026118 Ga0207675_100394314 Ga0207675_1003943143 133
329 3300026118 Ga0207675_101316192 Ga0207675_1013161922 133
330 3300026121 Ga0207683_10000995 Ga0207683_1000099534 133
331 3300026142 Ga0207698_10030624 Ga0207698_100306247 133
332 3300027471 Ga0209995_1062383 Ga0209995_10623831 133
333 3300028380 Ga0268265_10004412 Ga0268265_1000441216 133
334 3300028380 Ga0268265_10162720 Ga0268265_101627204 133
335 3300028380 Ga0268265_10225229 Ga0268265_102252293 133
336 3300028381 Ga0268264_10005327 Ga0268264_1000532718 133
337 3300028381 Ga0268264_10091033 Ga0268264_100910334 133
338 3300028794 Ga0307515_10012474 Ga0307515_100124744 133
339 3300028794 Ga0307515_10198886 Ga0307515_101988862 133
340 3300028794 Ga0307515_10219985 Ga0307515_102199852 133
341 3300030522 Ga0307512_10224331 Ga0307512_102243312 133
342 3300031507 Ga0307509_10208405 Ga0307509_102084052 133
343 3300031507 Ga0307509_10282076 Ga0307509_102820762 133
344 3300031616 Ga0307508_10000466 Ga0307508_1000046612 133
345 3300031649 Ga0307514_10008972 Ga0307514_100089725 133
346 3300031903 Ga0307407_10576658 Ga0307407_105766582 133
347 3300032126 Ga0307415_101017791 Ga0307415_1010177912 133
348 3300033179 Ga0307507_10096556 Ga0307507_100965561 133
349 3300034817 Ga0373948_0074654 Ga0373948_0074654_203_604 133
350 3300034818 Ga0373950_0032418 Ga0373950_0032418_343_744 133
351 3300034957 Ga0373938_0028825 Ga0373938_0028825_68_469 133
352 3300035083 Ga0373926_0369715 Ga0373926_0369715_87_488 133
353 3300035084 Ga0373928_0211157 Ga0373928_0211157_28_429 133
354 3300035088 Ga0373940_0005964 Ga0373940_0005964_1908_2309 133
355 3300035090 Ga0373949_0008073 Ga0373949_0008073_1677_2078 133
356 3300035112 Ga0373932_0041366 Ga0373932_0041366_288_689 133
357 3300035114 Ga0373939_0037046 Ga0373939_0037046_99_500 133
358 3300035691 Ga0373931_0000241 Ga0373931_0000241_465_866 133
359 3300037068 Ga0373925_0244521 Ga0373925_0244521_554_955 133
360 3300037068 Ga0373925_0594981 Ga0373925_0594981_396_872 133
361 3300041458 Ga0451798_0856659 Ga0451798_0856659_321_722 133
362 3300041486 Ga0451807_0288353 Ga0451807_0288353_1177_1578 133
363 3300042008 Ga0439450_001216 Ga0439450_001216_1125_1526 133
364 3300042439 Ga0439464_0000405 Ga0439464_0000405_983_1384 133
365 3300042461 Ga0439460_0167617 Ga0439460_0167617_36_437 133
366 3300045051 Ga0451576_0017448 Ga0451576_0017448_2100_2501 133
367 3300045051 Ga0451576_0051999 Ga0451576_0051999_349_750 133
368 3300046472 Ga0495580_0684256 Ga0495580_0684256_134_535 133
369 3300046537 Ga0495598_0002335 Ga0495598_0002335_1942_2343 133
370 3300046539 Ga0495621_0019494 Ga0495621_0019494_419_820 133
371 3300046691 Ga0495670_0163315 Ga0495670_0163315_347_748 133
372 3300047318 Ga0495636_0340032 Ga0495636_0340032_226_627 133
373 3300048907 Ga0496104_1435134 Ga0496104_1435134_132_533 133
374 3300048910 Ga0496107_0480966 Ga0496107_0480966_371_772 133
375 3300048911 Ga0496108_0085706 Ga0496108_0085706_2205_2606 133
376 3300048912 Ga0496109_0266919 Ga0496109_0266919_257_658 133
377 3300048917 Ga0496114_0582044 Ga0496114_0582044_468_869 133
378 3300049568 Ga0501031_0009615 Ga0501031_0009615_3684_4085 133
379 3300049569 Ga0501032_0007110 Ga0501032_0007110_3181_3582 133
380 3300049569 Ga0501032_0061542 Ga0501032_0061542_1895_2296 133
381 3300049570 Ga0501033_0000455 Ga0501033_0000455_22430_22831 133
382 3300049571 Ga0501034_0003491 Ga0501034_0003491_764_1165 133
383 3300049571 Ga0501034_0104176 Ga0501034_0104176_361_762 133
384 3300049572 Ga0501036_0014202 Ga0501036_0014202_1841_2242 133
385 3300049572 Ga0501036_1378353 Ga0501036_1378353_97_498 133
386 3300049573 Ga0501037_0050179 Ga0501037_0050179_738_1139 133
387 3300049573 Ga0501037_0545024 Ga0501037_0545024_249_650 133
388 3300049574 Ga0501038_0004916 Ga0501038_0004916_10156_10557 133
389 3300049574 Ga0501038_0066849 Ga0501038_0066849_712_1113 133
390 3300049575 Ga0501039_0006105 Ga0501039_0006105_3145_3546 133
391 3300049575 Ga0501039_0200330 Ga0501039_0200330_793_1194 133
392 3300049576 Ga0501040_0599079 Ga0501040_0599079_25_426 133
393 3300049578 Ga0501042_0238227 Ga0501042_0238227_21_422 133
394 3300049578 Ga0501042_0481782 Ga0501042_0481782_215_616 133
395 3300049579 Ga0501043_0810854 Ga0501043_0810854_182_583 133
396 3300049580 Ga0501046_0002329 Ga0501046_0002329_11706_12107 133
397 3300049581 Ga0501047_0000533 Ga0501047_0000533_14570_14971 133
398 3300049581 Ga0501047_0006322 Ga0501047_0006322_10682_11083 133
399 3300049581 Ga0501047_0240774 Ga0501047_0240774_1240_1641 133
400 3300049583 Ga0501067_0025959 Ga0501067_0025959_396_797 133
401 3300049583 Ga0501067_0130767 Ga0501067_0130767_245_646 133
402 3300049583 Ga0501067_0478715 Ga0501067_0478715_215_616 133
403 3300049584 Ga0501068_0026061 Ga0501068_0026061_737_1138 133
404 3300049584 Ga0501068_0138130 Ga0501068_0138130_369_770 133
405 3300049584 Ga0501068_0220883 Ga0501068_0220883_187_588 133
406 3300049585 Ga0501069_0037365 Ga0501069_0037365_187_588 133
407 3300049585 Ga0501069_0865795 Ga0501069_0865795_26_427 133
408 3300049586 Ga0501070_0036617 Ga0501070_0036617_2424_2825 133
409 3300049586 Ga0501070_0051190 Ga0501070_0051190_1370_1771 133
410 3300049586 Ga0501070_0376620 Ga0501070_0376620_480_881 133
411 3300049587 Ga0501071_0001799 Ga0501071_0001799_5819_6220 133
412 3300049587 Ga0501071_0043138 Ga0501071_0043138_1639_2040 133
413 3300049587 Ga0501071_0044748 Ga0501071_0044748_2598_2999 133
414 3300049587 Ga0501071_0119042 Ga0501071_0119042_296_697 133
415 3300049587 Ga0501071_0392080 Ga0501071_0392080_322_723 133
416 3300049588 Ga0501072_0002457 Ga0501072_0002457_13278_13679 133
417 3300049588 Ga0501072_0145457 Ga0501072_0145457_735_1136 133
418 3300049588 Ga0501072_0215764 Ga0501072_0215764_289_690 133
419 3300049588 Ga0501072_0497606 Ga0501072_0497606_272_673 133
420 3300049589 Ga0501073_0001358 Ga0501073_0001358_12516_12917 133
421 3300049589 Ga0501073_0041967 Ga0501073_0041967_875_1276 133
422 3300049589 Ga0501073_0262018 Ga0501073_0262018_108_509 133
423 3300049590 Ga0501074_0006519 Ga0501074_0006519_5098_5499 133
424 3300049590 Ga0501074_0295847 Ga0501074_0295847_472_873 133
425 3300049591 Ga0501075_0036165 Ga0501075_0036165_946_1347 133
426 3300049591 Ga0501075_0161927 Ga0501075_0161927_785_1186 133
427 3300049592 Ga0501076_0087416 Ga0501076_0087416_1388_1789 133
428 3300049593 Ga0501077_0624655 Ga0501077_0624655_253_654 133
429 3300049656 Ga0501209_000083 Ga0501209_000083_8405_8812 133
430 3300049668 Ga0501233_220642 Ga0501233_220642_49_450 133
431 3300049686 Ga0501257_103742 Ga0501257_103742_44_445 133
432 3300049741 Ga0501079_0073720 Ga0501079_0073720_197_598 133
433 3300049741 Ga0501079_0103988 Ga0501079_0103988_830_1231 133
434 3300049741 Ga0501079_0311561 Ga0501079_0311561_123_524 133
435 3300049741 Ga0501079_0400925 Ga0501079_0400925_434_835 133
436 3300049742 Ga0501080_0003688 Ga0501080_0003688_6306_6707 133
437 3300049742 Ga0501080_0008180 Ga0501080_0008180_3851_4252 133
438 3300049742 Ga0501080_0056665 Ga0501080_0056665_2705_3106 133
439 3300049742 Ga0501080_0074141 Ga0501080_0074141_718_1119 133
440 3300049742 Ga0501080_0120199 Ga0501080_0120199_1272_1673 133
441 3300049742 Ga0501080_0168235 Ga0501080_0168235_413_814 133
442 3300049744 Ga0501083_0194838 Ga0501083_0194838_192_593 133
443 3300049744 Ga0501083_0630175 Ga0501083_0630175_67_468 133
444 3300049822 Ga0501035_0178680 Ga0501035_0178680_1370_1771 133
445 3300049823 Ga0501044_0005262 Ga0501044_0005262_1260_1661 133
446 3300049823 Ga0501044_0177641 Ga0501044_0177641_59_460 133
447 3300049824 Ga0501045_0392310 Ga0501045_0392310_250_651 133
448 3300049824 Ga0501045_0415368 Ga0501045_0415368_274_675 133
449 3300050493 nmdc:mga0k408_15543_c1 nmdc:mga0k408_15543_c1_2732_3133 133
450 3300050493 nmdc:mga0k408_486807_c1 nmdc:mga0k408_486807_c1_59_460 133
451 3300050494 nmdc:mga06z11_926749_c1 nmdc:mga06z11_926749_c1_102_503 133
452 3300050496 nmdc:mga07m45_26651_c1 nmdc:mga07m45_26651_c1_1679_2080 133
453 3300050510 nmdc:mga06r32_1434889_c1 nmdc:mga06r32_1434889_c1_151_552 133
454 3300050516 nmdc:mga0sz30_31904_c1 nmdc:mga0sz30_31904_c1_1714_2115 133
455 3300054114 Ga0501084_0017533 Ga0501084_0017533_1226_1627 133
456 3300054114 Ga0501084_0482159 Ga0501084_0482159_462_863 133
457 3300060353 Ga0501082_0085812 Ga0501082_0085812_806_1207 133
458 3300060353 Ga0501082_0523054 Ga0501082_0523054_170_571 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

52

137

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8607 6 112
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8388 6 112
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7323 1 105
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7181 2 102
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.6814 55 86
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9533 7 118 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.9178 6 118 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8639 7 118 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8552 6 114 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.841 6 114 2.170.150.70
ID Description Score Start End GO Terms
AF-L7ULH9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9698 2 118 GO:0016846
GO:0046872
AF-A0A536XBG2-F1-model_v4 GFA family protein 0.9574 1 82 GO:0016846
GO:0046872
AF-Q1CZR1-F1-model_v4 CENP-V/GFA domain-containing protein 0.9539 1 118 GO:0016846
GO:0046872
AF-A0A1G2SMQ7-F1-model_v4 Aldehyde-activating protein 0.9513 3 118 GO:0016846
GO:0046872
AF-A0A534TAZ7-F1-model_v4 GFA family protein 0.9491 2 118 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map