F448261

General Info

Members Datasets Scaffolds Average Seq Length
458 265 916 323

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0019034|Ga0496114_0019034_4072_5124
Length 350
Sequence LKKSVLRHRWGSFFAKFLHNKENDMSNSNEKRLAKRRTLGYLSAAAVGALSAGLPNFAGAQNKSVLRIGYQKYGTLVILKGRGTLEKRLAAENIEVKWTEFPAGPVLLEGLNVGSIDFGTVGEAPPIFAQAAGADLVYVGNEPPSPTSEAIIVPKNSTLKTVADLKGKKVALNKGSNVHYLLVKALEKAGLHYKDIETIFLAPADARAAFERGSLDAWVIWDPFLAAAEKQIGARVLADGTGIVANHQFFLASRSYAEKNPKIISILLDELDQVDQWSSKNLAEVSKVLVAQTGLDAPSVELAAKRYSYGVKPVTAEVIAEQQKIADVFSNLKLIPKKITVKDALVSAKR

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
58 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
66 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
85 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
86 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
87 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
88 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
152 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
153 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
156 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
157 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
172 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
173 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
174 2511231007 Pseudomonas sp. GM18 Isolate Nodule
175 2511231011 Pseudomonas sp. GM30 Isolate Nodule
176 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
177 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
178 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
179 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
180 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
181 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
182 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
183 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
184 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
185 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
186 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
187 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
188 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
189 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
190 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
191 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
192 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
193 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
194 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
195 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
196 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
197 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
198 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
199 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
200 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
201 2643221638 Duganella sp. Root336D2 Isolate Unclassified
202 2643221645 Massilia sp. Root351 Isolate Unclassified
203 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
204 2643221664 Massilia sp. Root418 Isolate Unclassified
205 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
206 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
207 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
208 2738541280 Massilia sp. GV090 Isolate Unclassified
209 2738541297 Duganella sp. GV083 Isolate Unclassified
210 2738541300 Massilia sp. GV016 Isolate Unclassified
211 2738541357 Duganella sp. GV053 Isolate Unclassified
212 2738543003 Duganella sp. GV066 Isolate Unclassified
213 2738543018 Massilia sp. GV045 Isolate Unclassified
214 2738543026 Duganella sp. GV089 Isolate Unclassified
215 2738543029 Duganella sp. GV039 Isolate Unclassified
216 2738543030 Massilia sp. GV097 Isolate Unclassified
217 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
218 2773857670 Pseudomonas sp. 478 Isolate Unclassified
219 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
220 2784132072 Pseudomonas sp. 460 Isolate Unclassified
221 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
222 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
223 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
224 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
225 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
226 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
227 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
228 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
229 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
230 2842711865 Duganella sp. R-73148 Isolate Unclassified
231 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
232 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
233 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
234 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
235 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
236 2857558681 Duganella sp. R-74565 Isolate Unclassified
237 2857564685 Duganella sp. R-74599 Isolate Unclassified
238 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
239 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
240 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
241 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
242 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
243 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
244 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
245 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
246 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
247 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
248 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
249 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
250 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
251 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
252 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
253 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
254 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
255 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
256 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
257 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
258 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
259 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
260 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
261 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
262 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
263 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
264 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
265 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.04
Metatranscriptomes 0.22
Isolates 20.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 10.7
Nodule 1.31
Rhizoplane 6.33
Rhizosphere 65.28
Stem 0
Stem Tuber 0.22
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0019034 3300048917 Bacteria 5563
2 MRS2a_Contig_6468 2124908027 Bacteria 8027
3 MRS2a_Contig_9077 2124908027 Bacteria 5234
4 SwRhRL2b_contig_137706 2162886007 Bacteria 6987
5 JGI25158J39367_1000214 3300002739 Bacteria 13670
6 JGI25159J45721_1000738 3300002987 Bacteria 14282
7 rootH2_10007909 3300003320 Bacteria 11525
8 rootH1_10074559 3300003323 Bacteria 12963
9 JGI25161J50226_1000166 3300003374 Bacteria 45462
10 Ga0055529_1000032 3300003763 Bacteria 255895
11 Ga0055526_1000070 3300003771 Bacteria 96845
12 Ga0055526_1000875 3300003771 Bacteria 22443
13 Ga0055526_1002131 3300003771 Bacteria 13584
14 Ga0055537_1000936 3300003773 Bacteria 13584
15 Ga0055524_1000003 3300003775 Bacteria 399748
16 Ga0055524_1003259 3300003775 Bacteria 7945
17 Ga0055530_10000262 3300003791 Bacteria 47466
18 Ga0055543_1000063 3300004625 Bacteria 98011
19 Ga0065165_1001834 3300005262 Bacteria 20758
20 Ga0065714_10000518 3300005288 Bacteria 4066
21 Ga0065714_10004172 3300005288 Bacteria 9076
22 Ga0065704_10071355 3300005289 Bacteria 11543
23 Ga0065712_10068105 3300005290 Bacteria 14655
24 Ga0070682_100022667 3300005337 Bacteria 3722
25 Ga0068854_100005297 3300005578 Bacteria 8140
26 Ga0068862_100014075 3300005844 Bacteria 6636
27 Ga0075365_10040816 3300006038 Bacteria 3028
28 Ga0075365_10057124 3300006038 Bacteria 2596
29 Ga0075368_10009861 3300006042 Bacteria 3443
30 Ga0075363_100053126 3300006048 Bacteria 2164
31 Ga0075363_100076610 3300006048 Bacteria 1824
32 Ga0075364_10078143 3300006051 Bacteria 2185
33 Ga0075432_10007968 3300006058 Bacteria 3612
34 Ga0075362_10007882 3300006177 Bacteria 4051
35 Ga0075367_10097102 3300006178 Bacteria 1797
36 Ga0075366_10018118 3300006195 Bacteria 4066
37 Ga0079104_1000424 3300006946 Bacteria 48276
38 Ga0099826_10000002 3300006948 Bacteria 1125830
39 Ga0105251_10044454 3300009011 Bacteria 2146
40 Ga0105244_10004250 3300009036 Bacteria 9938
41 Ga0105244_10005843 3300009036 Bacteria 8084
42 Ga0157373_10004396 3300013100 Bacteria 10624
43 Ga0157373_10025678 3300013100 Bacteria 4259
44 Ga0157371_10030360 3300013102 Bacteria 3899
45 Ga0157370_10026152 3300013104 Bacteria 5765
46 Ga0157370_10262381 3300013104 Bacteria 1596
47 Ga0157369_10006552 3300013105 Bacteria 13479
48 Ga0157369_10051418 3300013105 Bacteria 4459
49 Ga0157372_10162192 3300013307 Bacteria 2584
50 Ga0182008_10007115 3300014497 Bacteria 6196
51 Ga0182008_10015789 3300014497 Bacteria 3934
52 Ga0182006_1000035 3300015261 Bacteria 232349
53 Ga0182006_1001552 3300015261 Bacteria 13711
54 Ga0182006_1002075 3300015261 Bacteria 11207
55 Ga0182006_1009421 3300015261 Bacteria 4374
56 Ga0182006_1022186 3300015261 Bacteria 2641
57 Ga0182007_10000189 3300015262 Bacteria 41407
58 Ga0182007_10043899 3300015262 Bacteria 1484
59 Ga0182005_1000025 3300015265 Bacteria 235532
60 Ga0182005_1001150 3300015265 Bacteria 10975
61 Ga0163161_10017321 3300017792 Bacteria 5041
62 Ga0163161_10024062 3300017792 Bacteria 4299
63 Ga0163161_10200446 3300017792 Bacteria 1538
64 Ga0163161_10408855 3300017792 Unclassified 1090
65 Ga0209436_100056 3300025208 Bacteria 61172
66 Ga0209646_1000051 3300025246 Bacteria 296525
67 Ga0209565_1001000 3300025263 Bacteria 14523
68 Ga0209455_1000043 3300025272 Bacteria 413928
69 Ga0209130_1000128 3300025284 Bacteria 123595
70 Ga0209675_1000620 3300025291 Bacteria 25347
71 Ga0209675_1001372 3300025291 Bacteria 14248
72 Ga0209564_1000011 3300025295 Bacteria 822327
73 Ga0209564_1000109 3300025295 Bacteria 212912
74 Ga0209564_1002510 3300025295 Bacteria 14245
75 Ga0209050_1000074 3300025298 Bacteria 289334
76 Ga0209256_1000007 3300025299 Bacteria 1136599
77 Ga0209256_1001600 3300025299 Bacteria 22175
78 Ga0207696_1010517 3300025711 Bacteria 3387
79 Ga0207655_1001081 3300025728 Bacteria 26963
80 Ga0207655_1002556 3300025728 Bacteria 14563
81 Ga0207655_1018917 3300025728 Bacteria 3629
82 Ga0207655_1024451 3300025728 Bacteria 2960
83 Ga0207713_1045240 3300025735 Bacteria 1800
84 Ga0207709_10177148 3300025935 Bacteria 1502
85 Ga0209281_1000016 3300027111 Bacteria 588107
86 Ga0209371_1000147 3300027312 Bacteria 113313
87 Ga0209282_1000001 3300027666 Bacteria 2450367
88 Ga0209813_10013519 3300027866 Bacteria 2181
89 Ga0207428_10297935 3300027907 Bacteria 1194
90 Ga0268265_10195703 3300028380 Bacteria 1749
91 Ga0268256_1000121 3300030500 Bacteria 113313
92 Ga0307511_10001681 3300030521 Bacteria 23318
93 Ga0314311_1263845 3300030733 Bacteria 6278
94 Ga0316178_1008333 3300030735 Bacteria 44288
95 Ga0316181_1099047 3300030744 Bacteria 5257
96 Ga0265762_1003357 3300030760 Bacteria 2864
97 Ga0307408_100000019 3300031548 Bacteria 344502
98 Ga0307408_100000126 3300031548 Bacteria 84345
99 Ga0307408_100002457 3300031548 Bacteria 13003
100 Ga0307408_100007499 3300031548 Bacteria 7214
101 Ga0265342_10054825 3300031712 Bacteria 2368
102 Ga0307516_10016549 3300031730 Bacteria 7711
103 Ga0307516_10020720 3300031730 Bacteria 6789
104 Ga0307407_10151816 3300031903 Bacteria 1506
105 Ga0307412_10019424 3300031911 Bacteria 4115
106 Ga0395899_0001482 3300037312 Bacteria 19976
107 Ga0395900_0002373 3300037418 Bacteria 20814
108 Ga0395898_0002574 3300037466 Bacteria 21233
109 Ga0395898_0162149 3300037466 Bacteria 2138
110 Ga0395905_0001148 3300037471 Bacteria 33147
111 Ga0395905_0007790 3300037471 Bacteria 10622
112 Ga0395905_0046279 3300037471 Bacteria 4079
113 Ga0395901_0000666 3300038443 Bacteria 39480
114 Ga0436361_0394060 3300039447 Bacteria 3056
115 Ga0439438_003696 3300041405 Bacteria 6087
116 Ga0439438_005243 3300041405 Bacteria 4806
117 Ga0439447_004409 3300041407 Bacteria 4846
118 Ga0451853_0247865 3300041512 Bacteria 2088
119 Ga0439452_000864 3300042010 Bacteria 14004
120 Ga0439452_015952 3300042010 Bacteria 2049
121 Ga0439456_023794 3300042013 Bacteria 1299
122 Ga0450911_000027 3300042115 Bacteria 82476
123 Ga0450911_000515 3300042115 Bacteria 12209
124 Ga0450902_004716 3300042137 Bacteria 2034
125 Ga0450904_000209 3300042139 Bacteria 12729
126 Ga0439464_0014239 3300042439 Bacteria 2137
127 Ga0466959_0006594 3300045049 Bacteria 8060
128 Ga0495617_002148 3300046452 Bacteria 8107
129 Ga0495603_0017024 3300046455 Bacteria 4398
130 Ga0495591_003894 3300046458 Bacteria 7524
131 Ga0495638_0017183 3300046460 Bacteria 4830
132 Ga0495638_0018887 3300046460 Bacteria 4569
133 Ga0495638_0033346 3300046460 Bacteria 3294
134 Ga0495638_0123824 3300046460 Bacteria 1525
135 Ga0495653_0000024 3300046463 Bacteria 160810
136 Ga0495650_0000072 3300046471 Bacteria 257886
137 Ga0495650_0000578 3300046471 Bacteria 51315
138 Ga0495650_0003058 3300046471 Bacteria 12590
139 Ga0495650_0031945 3300046471 Bacteria 2361
140 Ga0495605_0000028 3300046474 Bacteria 218471
141 Ga0495605_0036072 3300046474 Bacteria 2495
142 Ga0495639_0000444 3300046475 Bacteria 19714
143 Ga0495584_0006526 3300046491 Bacteria 6097
144 Ga0495584_0012666 3300046491 Bacteria 4305
145 Ga0495584_0013433 3300046491 Bacteria 4181
146 Ga0495585_0000506 3300046492 Bacteria 36822
147 Ga0495585_0014971 3300046492 Bacteria 4510
148 Ga0495607_0001127 3300046501 Bacteria 24220
149 Ga0495607_0002407 3300046501 Bacteria 15272
150 Ga0495607_0007116 3300046501 Bacteria 7777
151 Ga0495607_0007244 3300046501 Bacteria 7701
152 Ga0495607_0076377 3300046501 Bacteria 1853
153 Ga0495583_0001861 3300046506 Bacteria 19645
154 Ga0495583_0001941 3300046506 Bacteria 19112
155 Ga0495583_0002807 3300046506 Bacteria 14274
156 Ga0495583_0003511 3300046506 Bacteria 11856
157 Ga0495583_0012812 3300046506 Bacteria 4718
158 Ga0495583_0028468 3300046506 Bacteria 2746
159 Ga0495583_0042515 3300046506 Bacteria 2121
160 Ga0495606_0000083 3300046507 Bacteria 159263
161 Ga0495606_0000095 3300046507 Bacteria 151634
162 Ga0495606_0000877 3300046507 Bacteria 45003
163 Ga0495606_0004178 3300046507 Bacteria 14638
164 Ga0495606_0009453 3300046507 Bacteria 8249
165 Ga0495606_0009729 3300046507 Bacteria 8089
166 Ga0495606_0030176 3300046507 Bacteria 3791
167 Ga0495610_0000003 3300046512 Bacteria 1203910
168 Ga0495610_0007453 3300046512 Bacteria 7278
169 Ga0495610_0010286 3300046512 Bacteria 5827
170 Ga0495610_0017037 3300046512 Bacteria 4156
171 Ga0495610_0023797 3300046512 Bacteria 3321
172 Ga0495616_0001787 3300046513 Bacteria 14615
173 Ga0495616_0004561 3300046513 Bacteria 8720
174 Ga0495616_0023830 3300046513 Bacteria 3289
175 Ga0495616_0056462 3300046513 Bacteria 1939
176 Ga0495631_0001348 3300046518 Bacteria 15022
177 Ga0495631_0004859 3300046518 Bacteria 7073
178 Ga0495631_0026180 3300046518 Bacteria 2681
179 Ga0495631_0052110 3300046518 Bacteria 1787
180 Ga0495632_0002249 3300046519 Bacteria 14865
181 Ga0495632_0003465 3300046519 Bacteria 11167
182 Ga0495632_0016935 3300046519 Bacteria 4038
183 Ga0495637_0000271 3300046520 Bacteria 40891
184 Ga0495637_0002514 3300046520 Bacteria 10123
185 Ga0495637_0012307 3300046520 Bacteria 4096
186 Ga0495637_0019283 3300046520 Bacteria 3155
187 Ga0495637_0020703 3300046520 Bacteria 3021
188 Ga0495637_0021517 3300046520 Bacteria 2955
189 Ga0495637_0034321 3300046520 Bacteria 2222
190 Ga0495643_0000099 3300046522 Bacteria 145425
191 Ga0495643_0000109 3300046522 Bacteria 135859
192 Ga0495643_0000628 3300046522 Bacteria 41878
193 Ga0495643_0003754 3300046522 Bacteria 10991
194 Ga0495643_0017951 3300046522 Bacteria 4123
195 Ga0495643_0019500 3300046522 Bacteria 3922
196 Ga0495643_0054538 3300046522 Bacteria 2139
197 Ga0495643_0071029 3300046522 Bacteria 1828
198 Ga0495643_0145650 3300046522 Bacteria 1177
199 Ga0495644_0002857 3300046523 Bacteria 6845
200 Ga0495648_0000960 3300046524 Bacteria 29754
201 Ga0495648_0002149 3300046524 Bacteria 18569
202 Ga0495648_0043367 3300046524 Bacteria 2821
203 Ga0495648_0089474 3300046524 Bacteria 1727
204 Ga0495648_0090464 3300046524 Bacteria 1715
205 Ga0495642_0001256 3300046528 Bacteria 11580
206 Ga0495642_0011482 3300046528 Bacteria 3403
207 Ga0495642_0081547 3300046528 Bacteria 1363
208 Ga0495654_0000037 3300046530 Bacteria 188218
209 Ga0495654_0003373 3300046530 Bacteria 9838
210 Ga0495654_0005047 3300046530 Bacteria 7736
211 Ga0495654_0008117 3300046530 Bacteria 5819
212 Ga0495654_0009067 3300046530 Bacteria 5459
213 Ga0495654_0025469 3300046530 Bacteria 3046
214 Ga0495654_0066352 3300046530 Bacteria 1720
215 Ga0495586_0007897 3300046535 Bacteria 5671
216 Ga0495609_0000007 3300046538 Bacteria 398812
217 Ga0495609_0000023 3300046538 Bacteria 269702
218 Ga0495609_0001214 3300046538 Bacteria 17758
219 Ga0495609_0019601 3300046538 Bacteria 3127
220 Ga0495597_0000172 3300046542 Bacteria 57536
221 Ga0495597_0000284 3300046542 Bacteria 45727
222 Ga0495597_0006201 3300046542 Bacteria 6207
223 Ga0495597_0011019 3300046542 Bacteria 4394
224 Ga0495597_0024207 3300046542 Bacteria 2803
225 Ga0495597_0097998 3300046542 Bacteria 1238
226 Ga0495597_0114116 3300046542 Bacteria 1131
227 Ga0495645_0105653 3300046543 Bacteria 1997
228 Ga0495645_0162303 3300046543 Bacteria 1544
229 Ga0495622_0002606 3300046557 Bacteria 8698
230 Ga0495622_0013445 3300046557 Bacteria 3796
231 Ga0495622_0056720 3300046557 Bacteria 1816
232 Ga0495633_0000180 3300046558 Bacteria 82176
233 Ga0495633_0007371 3300046558 Bacteria 6337
234 Ga0495633_0012299 3300046558 Bacteria 4562
235 Ga0495668_0000018 3300046616 Bacteria 417480
236 Ga0495668_0000441 3300046616 Bacteria 53224
237 Ga0495668_0001105 3300046616 Bacteria 27912
238 Ga0495668_0007805 3300046616 Bacteria 6782
239 Ga0495668_0118474 3300046616 Bacteria 1448
240 Ga0495625_0000187 3300046660 Bacteria 97797
241 Ga0495625_0001708 3300046660 Bacteria 25534
242 Ga0495625_0003558 3300046660 Bacteria 15362
243 Ga0495625_0009369 3300046660 Bacteria 8198
244 Ga0495625_0012483 3300046660 Bacteria 6882
245 Ga0495625_0017406 3300046660 Bacteria 5627
246 Ga0495625_0088422 3300046660 Bacteria 2146
247 Ga0495659_0000001 3300046664 Bacteria 325846
248 Ga0495659_0004467 3300046664 Bacteria 4405
249 Ga0495661_0000072 3300046665 Bacteria 120743
250 Ga0495661_0000758 3300046665 Bacteria 31237
251 Ga0495661_0002080 3300046665 Bacteria 15698
252 Ga0495661_0003309 3300046665 Bacteria 11945
253 Ga0495661_0011504 3300046665 Bacteria 6003
254 Ga0495661_0091803 3300046665 Bacteria 1726
255 Ga0495669_0001473 3300046684 Bacteria 9707
256 Ga0495670_0007703 3300046691 Bacteria 5295
257 Ga0495671_0000010 3300046692 Bacteria 368641
258 Ga0495671_0000035 3300046692 Bacteria 188543
259 Ga0495671_0074568 3300046692 Bacteria 1664
260 Ga0495671_0092119 3300046692 Bacteria 1483
261 Ga0495649_0004140 3300046694 Bacteria 9522
262 Ga0495649_0004361 3300046694 Bacteria 9265
263 Ga0495649_0134049 3300046694 Bacteria 1306
264 Ga0495589_0000020 3300046794 Bacteria 199645
265 Ga0495660_0000053 3300046810 Bacteria 137479
266 Ga0495660_0000470 3300046810 Bacteria 33476
267 Ga0495660_0002782 3300046810 Bacteria 11033
268 Ga0495660_0006381 3300046810 Bacteria 6981
269 Ga0495660_0008155 3300046810 Bacteria 6147
270 Ga0495660_0052832 3300046810 Bacteria 2207
271 Ga0495660_0068400 3300046810 Bacteria 1889
272 Ga0495672_0000066 3300047320 Bacteria 193318
273 Ga0495672_0000127 3300047320 Bacteria 117475
274 Ga0495672_0005242 3300047320 Bacteria 10328
275 Ga0495672_0009356 3300047320 Bacteria 7108
276 Ga0495672_0017204 3300047320 Bacteria 4840
277 Ga0495672_0071176 3300047320 Bacteria 1969
278 Ga0495676_0000011 3300047321 Bacteria 242612
279 Ga0495676_0008681 3300047321 Bacteria 9302
280 Ga0495683_0016953 3300047323 Bacteria 3778
281 Ga0495687_000120 3300047443 Bacteria 120987
282 Ga0495687_002872 3300047443 Bacteria 13188
283 Ga0495687_004837 3300047443 Bacteria 8861
284 Ga0495687_018403 3300047443 Bacteria 3453
285 Ga0495677_0000045 3300047445 Bacteria 73995
286 Ga0495677_0002868 3300047445 Bacteria 6717
287 Ga0495679_011017 3300047446 Bacteria 3515
288 Ga0495685_004233 3300047447 Bacteria 4619
289 Ga0495673_0000016 3300047469 Bacteria 580643
290 Ga0495673_0000035 3300047469 Bacteria 316861
291 Ga0495673_0001968 3300047469 Bacteria 15201
292 Ga0495673_0024778 3300047469 Bacteria 2892
293 Ga0495681_0001391 3300047470 Bacteria 18252
294 Ga0495681_0004726 3300047470 Bacteria 9231
295 Ga0495681_0004730 3300047470 Bacteria 9227
296 Ga0495681_0025761 3300047470 Bacteria 3073
297 Ga0495681_0064776 3300047470 Bacteria 1673
298 Ga0495686_0001386 3300047472 Bacteria 26897
299 Ga0495686_0014790 3300047472 Bacteria 5360
300 Ga0495686_0017804 3300047472 Bacteria 4781
301 Ga0495686_0040925 3300047472 Bacteria 2952
302 Ga0495626_0001540 3300048091 Bacteria 18097
303 Ga0495626_0001950 3300048091 Bacteria 15324
304 Ga0495626_0002030 3300048091 Bacteria 14860
305 Ga0495626_0003052 3300048091 Bacteria 10994
306 Ga0495626_0007632 3300048091 Bacteria 5999
307 Ga0495626_0011902 3300048091 Bacteria 4580
308 Ga0495626_0012025 3300048091 Bacteria 4554
309 Ga0495626_0014645 3300048091 Bacteria 4036
310 Ga0495626_0023641 3300048091 Bacteria 3022
311 Ga0496102_0017861 3300048905 Bacteria 6220
312 Ga0496102_0021863 3300048905 Bacteria 5662
313 Ga0496103_0002995 3300048906 Bacteria 10442
314 Ga0496104_0072427 3300048907 Bacteria 3277
315 Ga0496106_0184816 3300048909 Bacteria 1656
316 Ga0496108_0412550 3300048911 Bacteria 1179
317 Ga0496110_0055556 3300048913 Bacteria 3484
318 Ga0496111_0026140 3300048914 Bacteria 4121
319 Ga0496116_0024819 3300048919 Bacteria 4421
320 Ga0496116_0047524 3300048919 Bacteria 2888
321 Ga0496117_0000045 3300048920 Bacteria 301047
322 Ga0496118_0000041 3300048921 Bacteria 301047
323 Ga0496118_0115268 3300048921 Bacteria 1769
324 Ga0496121_0002653 3300048924 Bacteria 26844
325 Ga0496121_0003488 3300048924 Bacteria 22392
326 Ga0496121_0058960 3300048924 Bacteria 3169
327 Ga0496121_0065212 3300048924 Bacteria 2964
328 Ga0496121_0135356 3300048924 Bacteria 1837
329 Ga0496121_0168281 3300048924 Bacteria 1595
330 Ga0496121_0263853 3300048924 Bacteria 1187
331 Ga0496122_0000818 3300048925 Bacteria 59567
332 Ga0496122_0034662 3300048925 Bacteria 4126
333 Ga0496122_0052721 3300048925 Bacteria 3076
334 Ga0496123_0001701 3300048926 Bacteria 29394
335 Ga0496123_0003612 3300048926 Bacteria 17139
336 Ga0496124_0087967 3300048927 Bacteria 2540
337 Ga0496124_0097698 3300048927 Bacteria 2384
338 Ga0496124_0236604 3300048927 Bacteria 1361
339 Ga0496124_0384039 3300048927 Bacteria 981
340 Ga0496125_0002065 3300048928 Bacteria 27123
341 Ga0496125_0017268 3300048928 Bacteria 6891
342 Ga0495678_000236 3300049459 Bacteria 62303
343 Ga0495678_000262 3300049459 Bacteria 58570
344 Ga0495678_005739 3300049459 Bacteria 6745
345 Ga0495678_029390 3300049459 Bacteria 2308
346 Ga0495678_092321 3300049459 Bacteria 1063
347 Ga0495682_0000124 3300049460 Bacteria 67600
348 Ga0495682_0007852 3300049460 Bacteria 4220
349 Ga0501269_000010 3300049766 Bacteria 70454
350 nmdc:mga03683_66517_c1 3300050489 Bacteria 1533
351 nmdc:mga00v17_55948_c1 3300050491 Bacteria 2411
352 nmdc:mga0yw44_41608_c2 3300050492 Bacteria 2351
353 nmdc:mga06z11_26851_c1 3300050494 Bacteria 2746
354 nmdc:mga07m45_140097_c1 3300050496 Bacteria 1401
355 Ga0500583_0016255 3300053092 Bacteria 2967
356 Ga0500618_000980 3300053125 Bacteria 14451
357 Ga0500618_002135 3300053125 Bacteria 7802
358 Ga0500642_0095333 3300053130 Bacteria 1379
359 Ga0500655_012172 3300053133 Bacteria 1562
360 Ga0500568_0048939 3300053139 Bacteria 1669
361 Ga0500586_009118 3300053145 Bacteria 2737
362 Ga0500604_0001051 3300053151 Bacteria 7725
363 Ga0500645_031070 3300053730 Bacteria 1606
364 2510280868 2510065053 Bacteria 5005518
365 2510295002 2510065055 Bacteria 5037935
366 2510309015 2510065058 Bacteria 5005894
367 2511272433 2511231007 Bacteria 6306603
368 2511297753 2511231011 Bacteria 6149768
369 2511827633 2511231156 Bacteria 6845832
370 2538428084 2537561728 Bacteria 5149301
371 2554813855 2554235132 Bacteria 6772433
372 2599331146 2599185155 Bacteria 5827168
373 2599614429 2599185212 Bacteria 6765997
374 2599965937 2599185306 Bacteria 6637356
375 2599980900 2599185308 Bacteria 6621546
376 2599993990 2599185311 Bacteria 6354990
377 2600014776 2599185314 Bacteria 6621749
378 2600026340 2599185316 Bacteria 6320029
379 2600032087 2599185317 Bacteria 6435722
380 2600035973 2599185318 Bacteria 6961590
381 2600042337 2599185319 Bacteria 6637840
382 2600046655 2599185320 Bacteria 5963263
383 2600061047 2599185322 Bacteria 6763055
384 2600066369 2599185323 Bacteria 6688755
385 2600076539 2599185325 Bacteria 6324919
386 2600358990 2600254930 Bacteria 6431253
387 2600442703 2600254954 Bacteria 5100516
388 2601669955 2600255292 Bacteria 6300551
389 2608380993 2606217733 Bacteria 6360972
390 2624494931 2623620446 Bacteria 6500345
391 2643790755 2643221554 Bacteria 6603920
392 2643955636 2643221589 Bacteria 6250934
393 2644020430 2643221602 Bacteria 6249926
394 2644211677 2643221638 Bacteria 6579467
395 2644251540 2643221645 Bacteria 7207331
396 2644283229 2643221650 Bacteria 7029547
397 2644357409 2643221664 Bacteria 7272945
398 2671128585 2667528176 Bacteria 6724917
399 2678266147 2675903515 Bacteria 6580491
400 2715749833 2713897148 Bacteria 5883533
401 2738740001 2738541280 Bacteria 6630198
402 2738829970 2738541297 Bacteria 6549566
403 2738844244 2738541300 Bacteria 6675882
404 2739153766 2738541357 Bacteria 6549408
405 2739195686 2738543003 Bacteria 6549560
406 2739274196 2738543018 Bacteria 6718814
407 2739322162 2738543026 Bacteria 6549408
408 2739340403 2738543029 Bacteria 6549249
409 2739343240 2738543030 Bacteria 6719714
410 2745007379 2744054620 Bacteria 6551379
411 2774118379 2773857670 Bacteria 6407454
412 2774132182 2773857672 Bacteria 4993178
413 2784313573 2784132072 Bacteria 6596533
414 2808855695 2808606361 Bacteria 6136259
415 2808926510 2808606376 Bacteria 6248667
416 2808935468 2808606378 Bacteria 6177535
417 2808948671 2808606380 Bacteria 6248705
418 2808964076 2808606383 Bacteria 6138645
419 2808999088 2808606389 Bacteria 6138126
420 2809145754 2808606418 Bacteria 6724496
421 2825655096 2825651385 Bacteria 6715909
422 2826582963 2826581358 Bacteria 5963467
423 2842715616 2842711865 Bacteria 7155354
424 2842807762 2842805378 Bacteria 5385175
425 2842820025 2842815866 Bacteria 5947510
426 2842833458 2842832357 Bacteria 5959113
427 2842851503 2842849001 Bacteria 5924277
428 2857550979 2857547612 Bacteria 6179999
429 2857561741 2857558681 Bacteria 6617694
430 2857566858 2857564685 Bacteria 6290584
431 2871284526 2871282230 Bacteria 4917173
432 2885082268 2885080285 Bacteria 6355622
433 2913042528 2913036834 Bacteria 6704877
434 2919485657 2919481497 Bacteria 6907839
435 2919488168 2919487758 Bacteria 5929766
436 2919505868 2919501602 Bacteria 5286340
437 2919700577 2919697872 Bacteria 6553725
438 2926067855 2926063275 Bacteria 5285848
439 2929149919 2929144301 Bacteria 6622272
440 2932413441 2932410948 Bacteria 6312192
441 2932417501 2932416698 Bacteria 6315112
442 2974301214 2974298342 Bacteria 4840922
443 2984503692 2984499530 Bacteria 5020881
444 2984507733 2984504281 Bacteria 5262371
445 3007254570 3007252601 Bacteria 4559114
446 3007316642 3007315729 Bacteria 5076637
447 3007859191 3007855910 Bacteria 5637581
448 3007865103 3007861166 Bacteria 6045338
449 3007866780 3007866637 Bacteria 5899198
450 3007873998 3007872151 Bacteria 5268868
451 8011356697 8011350971 Bacteria 6158957
452 8016730120 8016728285 Bacteria 5263933
453 8019769770 8019769354 Bacteria 6924660
454 8019777684 8019775933 Bacteria 6858656
455 8029995506 8029995093 Bacteria 5990776
456 8034964327 8034962539 Bacteria 4884839
457 8056171309 8056166840 Bacteria 5820959
458 8056570463 8056569372 Bacteria 5997322
459 Ga0496114_0019034
460 MRS2a_Contig_6468
461 MRS2a_Contig_9077
462 SwRhRL2b_contig_137706
463 JGI25158J39367_1000214
464 JGI25159J45721_1000738
465 rootH2_10007909
466 rootH1_10074559
467 JGI25161J50226_1000166
468 Ga0055529_1000032
469 Ga0055526_1000070
470 Ga0055526_1000875
471 Ga0055526_1002131
472 Ga0055537_1000936
473 Ga0055524_1000003
474 Ga0055524_1003259
475 Ga0055530_10000262
476 Ga0055543_1000063
477 Ga0065165_1001834
478 Ga0065714_10000518
479 Ga0065714_10004172
480 Ga0065704_10071355
481 Ga0065712_10068105
482 Ga0070682_100022667
483 Ga0068854_100005297
484 Ga0068862_100014075
485 Ga0075365_10040816
486 Ga0075365_10057124
487 Ga0075368_10009861
488 Ga0075363_100053126
489 Ga0075363_100076610
490 Ga0075364_10078143
491 Ga0075432_10007968
492 Ga0075362_10007882
493 Ga0075367_10097102
494 Ga0075366_10018118
495 Ga0079104_1000424
496 Ga0099826_10000002
497 Ga0105251_10044454
498 Ga0105244_10004250
499 Ga0105244_10005843
500 Ga0157373_10004396
501 Ga0157373_10025678
502 Ga0157371_10030360
503 Ga0157370_10026152
504 Ga0157370_10262381
505 Ga0157369_10006552
506 Ga0157369_10051418
507 Ga0157372_10162192
508 Ga0182008_10007115
509 Ga0182008_10015789
510 Ga0182006_1000035
511 Ga0182006_1001552
512 Ga0182006_1002075
513 Ga0182006_1009421
514 Ga0182006_1022186
515 Ga0182007_10000189
516 Ga0182007_10043899
517 Ga0182005_1000025
518 Ga0182005_1001150
519 Ga0163161_10017321
520 Ga0163161_10024062
521 Ga0163161_10200446
522 Ga0163161_10408855
523 Ga0209436_100056
524 Ga0209646_1000051
525 Ga0209565_1001000
526 Ga0209455_1000043
527 Ga0209130_1000128
528 Ga0209675_1000620
529 Ga0209675_1001372
530 Ga0209564_1000011
531 Ga0209564_1000109
532 Ga0209564_1002510
533 Ga0209050_1000074
534 Ga0209256_1000007
535 Ga0209256_1001600
536 Ga0207696_1010517
537 Ga0207655_1001081
538 Ga0207655_1002556
539 Ga0207655_1018917
540 Ga0207655_1024451
541 Ga0207713_1045240
542 Ga0207709_10177148
543 Ga0209281_1000016
544 Ga0209371_1000147
545 Ga0209282_1000001
546 Ga0209813_10013519
547 Ga0207428_10297935
548 Ga0268265_10195703
549 Ga0268256_1000121
550 Ga0307511_10001681
551 Ga0314311_1263845
552 Ga0316178_1008333
553 Ga0316181_1099047
554 Ga0265762_1003357
555 Ga0307408_100000019
556 Ga0307408_100000126
557 Ga0307408_100002457
558 Ga0307408_100007499
559 Ga0265342_10054825
560 Ga0307516_10016549
561 Ga0307516_10020720
562 Ga0307407_10151816
563 Ga0307412_10019424
564 Ga0395899_0001482
565 Ga0395900_0002373
566 Ga0395898_0002574
567 Ga0395898_0162149
568 Ga0395905_0001148
569 Ga0395905_0007790
570 Ga0395905_0046279
571 Ga0395901_0000666
572 Ga0436361_0394060
573 Ga0439438_003696
574 Ga0439438_005243
575 Ga0439447_004409
576 Ga0451853_0247865
577 Ga0439452_000864
578 Ga0439452_015952
579 Ga0439456_023794
580 Ga0450911_000027
581 Ga0450911_000515
582 Ga0450902_004716
583 Ga0450904_000209
584 Ga0439464_0014239
585 Ga0466959_0006594
586 Ga0495617_002148
587 Ga0495603_0017024
588 Ga0495591_003894
589 Ga0495638_0017183
590 Ga0495638_0018887
591 Ga0495638_0033346
592 Ga0495638_0123824
593 Ga0495653_0000024
594 Ga0495650_0000072
595 Ga0495650_0000578
596 Ga0495650_0003058
597 Ga0495650_0031945
598 Ga0495605_0000028
599 Ga0495605_0036072
600 Ga0495639_0000444
601 Ga0495584_0006526
602 Ga0495584_0012666
603 Ga0495584_0013433
604 Ga0495585_0000506
605 Ga0495585_0014971
606 Ga0495607_0001127
607 Ga0495607_0002407
608 Ga0495607_0007116
609 Ga0495607_0007244
610 Ga0495607_0076377
611 Ga0495583_0001861
612 Ga0495583_0001941
613 Ga0495583_0002807
614 Ga0495583_0003511
615 Ga0495583_0012812
616 Ga0495583_0028468
617 Ga0495583_0042515
618 Ga0495606_0000083
619 Ga0495606_0000095
620 Ga0495606_0000877
621 Ga0495606_0004178
622 Ga0495606_0009453
623 Ga0495606_0009729
624 Ga0495606_0030176
625 Ga0495610_0000003
626 Ga0495610_0007453
627 Ga0495610_0010286
628 Ga0495610_0017037
629 Ga0495610_0023797
630 Ga0495616_0001787
631 Ga0495616_0004561
632 Ga0495616_0023830
633 Ga0495616_0056462
634 Ga0495631_0001348
635 Ga0495631_0004859
636 Ga0495631_0026180
637 Ga0495631_0052110
638 Ga0495632_0002249
639 Ga0495632_0003465
640 Ga0495632_0016935
641 Ga0495637_0000271
642 Ga0495637_0002514
643 Ga0495637_0012307
644 Ga0495637_0019283
645 Ga0495637_0020703
646 Ga0495637_0021517
647 Ga0495637_0034321
648 Ga0495643_0000099
649 Ga0495643_0000109
650 Ga0495643_0000628
651 Ga0495643_0003754
652 Ga0495643_0017951
653 Ga0495643_0019500
654 Ga0495643_0054538
655 Ga0495643_0071029
656 Ga0495643_0145650
657 Ga0495644_0002857
658 Ga0495648_0000960
659 Ga0495648_0002149
660 Ga0495648_0043367
661 Ga0495648_0089474
662 Ga0495648_0090464
663 Ga0495642_0001256
664 Ga0495642_0011482
665 Ga0495642_0081547
666 Ga0495654_0000037
667 Ga0495654_0003373
668 Ga0495654_0005047
669 Ga0495654_0008117
670 Ga0495654_0009067
671 Ga0495654_0025469
672 Ga0495654_0066352
673 Ga0495586_0007897
674 Ga0495609_0000007
675 Ga0495609_0000023
676 Ga0495609_0001214
677 Ga0495609_0019601
678 Ga0495597_0000172
679 Ga0495597_0000284
680 Ga0495597_0006201
681 Ga0495597_0011019
682 Ga0495597_0024207
683 Ga0495597_0097998
684 Ga0495597_0114116
685 Ga0495645_0105653
686 Ga0495645_0162303
687 Ga0495622_0002606
688 Ga0495622_0013445
689 Ga0495622_0056720
690 Ga0495633_0000180
691 Ga0495633_0007371
692 Ga0495633_0012299
693 Ga0495668_0000018
694 Ga0495668_0000441
695 Ga0495668_0001105
696 Ga0495668_0007805
697 Ga0495668_0118474
698 Ga0495625_0000187
699 Ga0495625_0001708
700 Ga0495625_0003558
701 Ga0495625_0009369
702 Ga0495625_0012483
703 Ga0495625_0017406
704 Ga0495625_0088422
705 Ga0495659_0000001
706 Ga0495659_0004467
707 Ga0495661_0000072
708 Ga0495661_0000758
709 Ga0495661_0002080
710 Ga0495661_0003309
711 Ga0495661_0011504
712 Ga0495661_0091803
713 Ga0495669_0001473
714 Ga0495670_0007703
715 Ga0495671_0000010
716 Ga0495671_0000035
717 Ga0495671_0074568
718 Ga0495671_0092119
719 Ga0495649_0004140
720 Ga0495649_0004361
721 Ga0495649_0134049
722 Ga0495589_0000020
723 Ga0495660_0000053
724 Ga0495660_0000470
725 Ga0495660_0002782
726 Ga0495660_0006381
727 Ga0495660_0008155
728 Ga0495660_0052832
729 Ga0495660_0068400
730 Ga0495672_0000066
731 Ga0495672_0000127
732 Ga0495672_0005242
733 Ga0495672_0009356
734 Ga0495672_0017204
735 Ga0495672_0071176
736 Ga0495676_0000011
737 Ga0495676_0008681
738 Ga0495683_0016953
739 Ga0495687_000120
740 Ga0495687_002872
741 Ga0495687_004837
742 Ga0495687_018403
743 Ga0495677_0000045
744 Ga0495677_0002868
745 Ga0495679_011017
746 Ga0495685_004233
747 Ga0495673_0000016
748 Ga0495673_0000035
749 Ga0495673_0001968
750 Ga0495673_0024778
751 Ga0495681_0001391
752 Ga0495681_0004726
753 Ga0495681_0004730
754 Ga0495681_0025761
755 Ga0495681_0064776
756 Ga0495686_0001386
757 Ga0495686_0014790
758 Ga0495686_0017804
759 Ga0495686_0040925
760 Ga0495626_0001540
761 Ga0495626_0001950
762 Ga0495626_0002030
763 Ga0495626_0003052
764 Ga0495626_0007632
765 Ga0495626_0011902
766 Ga0495626_0012025
767 Ga0495626_0014645
768 Ga0495626_0023641
769 Ga0496102_0017861
770 Ga0496102_0021863
771 Ga0496103_0002995
772 Ga0496104_0072427
773 Ga0496106_0184816
774 Ga0496108_0412550
775 Ga0496110_0055556
776 Ga0496111_0026140
777 Ga0496116_0024819
778 Ga0496116_0047524
779 Ga0496117_0000045
780 Ga0496118_0000041
781 Ga0496118_0115268
782 Ga0496121_0002653
783 Ga0496121_0003488
784 Ga0496121_0058960
785 Ga0496121_0065212
786 Ga0496121_0135356
787 Ga0496121_0168281
788 Ga0496121_0263853
789 Ga0496122_0000818
790 Ga0496122_0034662
791 Ga0496122_0052721
792 Ga0496123_0001701
793 Ga0496123_0003612
794 Ga0496124_0087967
795 Ga0496124_0097698
796 Ga0496124_0236604
797 Ga0496124_0384039
798 Ga0496125_0002065
799 Ga0496125_0017268
800 Ga0495678_000236
801 Ga0495678_000262
802 Ga0495678_005739
803 Ga0495678_029390
804 Ga0495678_092321
805 Ga0495682_0000124
806 Ga0495682_0007852
807 Ga0501269_000010
808 nmdc:mga03683_66517_c1
809 nmdc:mga00v17_55948_c1
810 nmdc:mga0yw44_41608_c2
811 nmdc:mga06z11_26851_c1
812 nmdc:mga07m45_140097_c1
813 Ga0500583_0016255
814 Ga0500618_000980
815 Ga0500618_002135
816 Ga0500642_0095333
817 Ga0500655_012172
818 Ga0500568_0048939
819 Ga0500586_009118
820 Ga0500604_0001051
821 Ga0500645_031070
822 2510280868
823 2510295002
824 2510309015
825 2511272433
826 2511297753
827 2511827633
828 2538428084
829 2554813855
830 2599331146
831 2599614429
832 2599965937
833 2599980900
834 2599993990
835 2600014776
836 2600026340
837 2600032087
838 2600035973
839 2600042337
840 2600046655
841 2600061047
842 2600066369
843 2600076539
844 2600358990
845 2600442703
846 2601669955
847 2608380993
848 2624494931
849 2643790755
850 2643955636
851 2644020430
852 2644211677
853 2644251540
854 2644283229
855 2644357409
856 2671128585
857 2678266147
858 2715749833
859 2738740001
860 2738829970
861 2738844244
862 2739153766
863 2739195686
864 2739274196
865 2739322162
866 2739340403
867 2739343240
868 2745007379
869 2774118379
870 2774132182
871 2784313573
872 2808855695
873 2808926510
874 2808935468
875 2808948671
876 2808964076
877 2808999088
878 2809145754
879 2825655096
880 2826582963
881 2842715616
882 2842807762
883 2842820025
884 2842833458
885 2842851503
886 2857550979
887 2857561741
888 2857566858
889 2871284526
890 2885082268
891 2913042528
892 2919485657
893 2919488168
894 2919505868
895 2919700577
896 2926067855
897 2929149919
898 2932413441
899 2932417501
900 2974301214
901 2984503692
902 2984507733
903 3007254570
904 3007316642
905 3007859191
906 3007865103
907 3007866780
908 3007873998
909 8011356697
910 8016730120
911 8019769770
912 8019777684
913 8029995506
914 8034964327
915 8056171309
916 8056570463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

89

281

0.85

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

66

307

0.83

PF13379

NMT1_2

NMT1-like family

59

291

0.8

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

84

292

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9281 29 305
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9261 29 307
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.9132 30 305
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8823 29 305
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8714 30 305
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9378 106 201 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8929 106 201 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8814 29 305 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8676 29 305 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8527 111 198 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4R9WJY7-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9751 105 180
AF-A0A4V2AA36-F1-model_v4 deleted 0.9705 151 303
AF-A0A3S1ZSK7-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9662 111 290
AF-X1F4P9-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9639 111 199
AF-A0A6B3TU84-F1-model_v4 ABC transporter substrate-binding protein 0.9549 91 232

Map