F448272

General Info

Members Datasets Scaffolds Average Seq Length
458 195 916 288

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_785290_c1|nmdc:mga05p37_785290_c1_34_1023
Length 316
Sequence MYHWLFGTWLRQKQQSILLQTRTRWKIIFYQLHQTRMLSLLKIELFXXXXRPRTYQIALKFGGEEYVGLMLSGMSGSFEEIPAKDILNGYLVCFIILNLLLIHVPILVALVAGDAIAGEANMGTLRLIAAKPFSRIKLLTVKFIASVFYTLILLVWVAVLALFVSIAVFGVNWLGVPRELQFNVLEADDVMWRYALAFCFAAIGLICVAALAFMLSVFSDNSIGPIVATVCVIIVFTILTQLQIPFYDESVKPYLFTTHMLGWKGFFYVKGIEGETVKGSIENLPAILKSAAILIVYTAVFLGIGFWYFKRKDILS

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
191 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 0
Rhizoplane 0.44
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_785290_c1 3300050507 Unclassified 1044
2 MBSR1b_contig_1361775 2162886012 Bacteria 2805
3 rootH1_10028407 3300003316 Bacteria 7989
4 rootL2_10318608 3300003322 Unclassified 1721
5 rootH1_10332763 3300003323 Bacteria 2038
6 Ga0065704_10178962 3300005289 Bacteria 1248
7 Ga0065712_10000551 3300005290 Bacteria 10759
8 Ga0065715_10002371 3300005293 Bacteria 5496
9 Ga0065715_10019395 3300005293 Bacteria 2460
10 Ga0065707_10094407 3300005295 Unclassified 3503
11 Ga0065707_10127714 3300005295 Bacteria 1978
12 Ga0065707_10146744 3300005295 Bacteria 1705
13 Ga0070658_10473968 3300005327 Unclassified 1080
14 Ga0070676_10018110 3300005328 Bacteria 3900
15 Ga0070683_100000690 3300005329 Bacteria 24470
16 Ga0070683_100008953 3300005329 Bacteria 8531
17 Ga0070683_100142409 3300005329 Bacteria 2272
18 Ga0070683_100397566 3300005329 Bacteria 1314
19 Ga0070690_100083138 3300005330 Bacteria 2097
20 Ga0070670_100019856 3300005331 Bacteria 5769
21 Ga0070670_100027295 3300005331 Bacteria 4911
22 Ga0070670_100072666 3300005331 Bacteria 2954
23 Ga0070670_100087636 3300005331 Bacteria 2675
24 Ga0070670_100196349 3300005331 Bacteria 1753
25 Ga0070677_10074045 3300005333 Bacteria 1440
26 Ga0068869_100012104 3300005334 Bacteria 5687
27 Ga0068869_100057491 3300005334 Bacteria 2840
28 Ga0068869_100063385 3300005334 Bacteria 2716
29 Ga0068869_100070786 3300005334 Bacteria 2581
30 Ga0068869_100077457 3300005334 Unclassified 2474
31 Ga0068869_100214071 3300005334 Unclassified 1525
32 Ga0070666_10000019 3300005335 Bacteria 185877
33 Ga0070666_10014374 3300005335 Bacteria 5039
34 Ga0070666_10049353 3300005335 Bacteria 2828
35 Ga0070666_10064304 3300005335 Bacteria 2488
36 Ga0070666_10430056 3300005335 Bacteria 952
37 Ga0070680_100077668 3300005336 Bacteria 2734
38 Ga0070682_100001035 3300005337 Bacteria 16081
39 Ga0070682_100015346 3300005337 Bacteria 4437
40 Ga0068868_100012971 3300005338 Bacteria 6097
41 Ga0068868_100213197 3300005338 Bacteria 1614
42 Ga0068868_100217111 3300005338 Unclassified 1600
43 Ga0070660_100034424 3300005339 Bacteria 3827
44 Ga0070660_100134682 3300005339 Bacteria 1979
45 Ga0070689_100008203 3300005340 Bacteria 7343
46 Ga0070689_100026726 3300005340 Bacteria 4347
47 Ga0070689_100058863 3300005340 Bacteria 2985
48 Ga0070691_10067959 3300005341 Unclassified 1725
49 Ga0070687_100019693 3300005343 Bacteria 3144
50 Ga0070661_100000615 3300005344 Bacteria 26536
51 Ga0070668_100008223 3300005347 Bacteria 7745
52 Ga0070668_100248923 3300005347 Bacteria 1475
53 Ga0070669_100012757 3300005353 Bacteria 5965
54 Ga0070669_100107857 3300005353 Bacteria 2110
55 Ga0070669_100108453 3300005353 Bacteria 2104
56 Ga0070675_100000570 3300005354 Bacteria 25293
57 Ga0070675_100026342 3300005354 Bacteria 4666
58 Ga0070675_100065034 3300005354 Bacteria 3015
59 Ga0070675_100068384 3300005354 Bacteria 2941
60 Ga0070675_100144610 3300005354 Bacteria 2035
61 Ga0070671_100042666 3300005355 Bacteria 3770
62 Ga0070671_100069493 3300005355 Bacteria 2938
63 Ga0070671_100185383 3300005355 Bacteria 1763
64 Ga0070673_100002308 3300005364 Bacteria 11592
65 Ga0070673_100015161 3300005364 Bacteria 5402
66 Ga0070673_100025247 3300005364 Bacteria 4370
67 Ga0070673_100103543 3300005364 Bacteria 2349
68 Ga0070673_100230159 3300005364 Unclassified 1608
69 Ga0070688_100001242 3300005365 Bacteria 12718
70 Ga0070688_100004531 3300005365 Bacteria 7248
71 Ga0070688_100018463 3300005365 Bacteria 4024
72 Ga0070659_100008665 3300005366 Bacteria 7440
73 Ga0070667_100003997 3300005367 Bacteria 12487
74 Ga0070667_100105235 3300005367 Bacteria 2442
75 Ga0070701_10043427 3300005438 Unclassified 2300
76 Ga0070678_100004844 3300005456 Bacteria 7690
77 Ga0070662_100003664 3300005457 Bacteria 9597
78 Ga0070662_100054538 3300005457 Bacteria 2897
79 Ga0070662_100055167 3300005457 Bacteria 2882
80 Ga0070662_100056771 3300005457 Bacteria 2842
81 Ga0070662_100186431 3300005457 Bacteria 1638
82 Ga0070681_10162716 3300005458 Bacteria 2155
83 Ga0068867_100037534 3300005459 Bacteria 3522
84 Ga0068867_100048238 3300005459 Bacteria 3132
85 Ga0068867_100050207 3300005459 Bacteria 3073
86 Ga0068867_100105614 3300005459 Bacteria 2156
87 Ga0068867_100206463 3300005459 Bacteria 1575
88 Ga0070685_10004817 3300005466 Bacteria 6829
89 Ga0070685_10007675 3300005466 Bacteria 5521
90 Ga0070685_10011838 3300005466 Bacteria 4573
91 Ga0070685_10239303 3300005466 Bacteria 1197
92 Ga0070698_100006625 3300005471 Bacteria 12560
93 Ga0070698_100165567 3300005471 Bacteria 2154
94 Ga0070698_100311866 3300005471 Bacteria 1504
95 Ga0070679_100066554 3300005530 Bacteria 3591
96 Ga0070679_100485976 3300005530 Bacteria 1179
97 Ga0070684_100000986 3300005535 Bacteria 20347
98 Ga0070684_100044373 3300005535 Bacteria 3845
99 Ga0070684_100098263 3300005535 Bacteria 2612
100 Ga0068853_100013072 3300005539 Bacteria 6771
101 Ga0068853_100037485 3300005539 Bacteria 4125
102 Ga0068853_100063734 3300005539 Bacteria 3193
103 Ga0068853_100076208 3300005539 Bacteria 2928
104 Ga0068853_100307974 3300005539 Unclassified 1466
105 Ga0070672_100021870 3300005543 Bacteria 4686
106 Ga0070686_100021601 3300005544 Bacteria 3830
107 Ga0070686_100260102 3300005544 Bacteria 1272
108 Ga0070696_100266038 3300005546 Unclassified 1302
109 Ga0070665_100000018 3300005548 Bacteria 434118
110 Ga0068855_100155875 3300005563 Bacteria 2595
111 Ga0068855_100166222 3300005563 Bacteria 2501
112 Ga0070664_100001066 3300005564 Bacteria 21588
113 Ga0070664_100085866 3300005564 Bacteria 2718
114 Ga0070664_100158746 3300005564 Bacteria 2000
115 Ga0068857_100001057 3300005577 Bacteria 21331
116 Ga0068857_100022395 3300005577 Bacteria 5559
117 Ga0068857_100023982 3300005577 Bacteria 5370
118 Ga0068857_100025645 3300005577 Bacteria 5189
119 Ga0068857_100368143 3300005577 Bacteria 1333
120 Ga0068854_100105695 3300005578 Bacteria 2117
121 Ga0068854_100413881 3300005578 Bacteria 1118
122 Ga0068852_100009554 3300005616 Bacteria 7206
123 Ga0068852_100159366 3300005616 Bacteria 2106
124 Ga0068852_100176706 3300005616 Bacteria 2005
125 Ga0068859_100000013 3300005617 Bacteria 291126
126 Ga0068859_100016151 3300005617 Bacteria 7496
127 Ga0068859_100097112 3300005617 Bacteria 2999
128 Ga0068859_100220681 3300005617 Bacteria 1983
129 Ga0068859_100344535 3300005617 Bacteria 1585
130 Ga0068864_100004091 3300005618 Bacteria 11979
131 Ga0068864_100043410 3300005618 Bacteria 3850
132 Ga0068864_100112929 3300005618 Unclassified 2422
133 Ga0068866_10069488 3300005718 Bacteria 1856
134 Ga0068861_100014667 3300005719 Bacteria 5503
135 Ga0068861_100041153 3300005719 Bacteria 3460
136 Ga0068861_100050381 3300005719 Bacteria 3157
137 Ga0068861_100230344 3300005719 Unclassified 1571
138 Ga0068870_10085570 3300005840 Bacteria 1753
139 Ga0068863_100017465 3300005841 Bacteria 6878
140 Ga0068863_100095693 3300005841 Unclassified 2819
141 Ga0068863_100147933 3300005841 Bacteria 2247
142 Ga0068863_100388354 3300005841 Bacteria 1364
143 Ga0068863_100487270 3300005841 Bacteria 1213
144 Ga0068858_100005907 3300005842 Bacteria 11948
145 Ga0068858_100064670 3300005842 Bacteria 3386
146 Ga0068858_100110180 3300005842 Bacteria 2571
147 Ga0068860_100000983 3300005843 Bacteria 31545
148 Ga0068860_100003160 3300005843 Bacteria 17008
149 Ga0068860_100084921 3300005843 Bacteria 3011
150 Ga0068860_100183562 3300005843 Unclassified 2022
151 Ga0068860_100295745 3300005843 Unclassified 1585
152 Ga0068862_100041057 3300005844 Bacteria 3935
153 Ga0068862_100103452 3300005844 Bacteria 2494
154 Ga0070715_10021239 3300006163 Bacteria 2515
155 Ga0075366_10003142 3300006195 Bacteria 8641
156 Ga0075366_10045288 3300006195 Bacteria 2608
157 Ga0097621_100021201 3300006237 Bacteria 5020
158 Ga0097621_100034636 3300006237 Bacteria 4029
159 Ga0097621_100071274 3300006237 Bacteria 2871
160 Ga0097621_100304743 3300006237 Bacteria 1408
161 Ga0097621_100400083 3300006237 Bacteria 1229
162 Ga0068871_100016275 3300006358 Bacteria 5595
163 Ga0068871_100022431 3300006358 Bacteria 4866
164 Ga0068871_100038051 3300006358 Bacteria 3839
165 Ga0068871_100064884 3300006358 Bacteria 2990
166 Ga0068871_100244047 3300006358 Bacteria 1563
167 Ga0068871_100581258 3300006358 Bacteria 1017
168 Ga0075428_100001815 3300006844 Bacteria 22850
169 Ga0075428_100002594 3300006844 Bacteria 19646
170 Ga0075430_100007617 3300006846 Bacteria 9147
171 Ga0075430_100097687 3300006846 Bacteria 2454
172 Ga0075431_100024797 3300006847 Bacteria 6149
173 Ga0075431_100035835 3300006847 Bacteria 5108
174 Ga0075434_100137119 3300006871 Bacteria 2466
175 Ga0075429_100001013 3300006880 Bacteria 22376
176 Ga0075429_100028184 3300006880 Bacteria 4875
177 Ga0068865_100012800 3300006881 Bacteria 5288
178 Ga0068865_100049974 3300006881 Bacteria 2886
179 Ga0097620_100000013 3300006931 Bacteria 291126
180 Ga0097620_100016151 3300006931 Bacteria 7496
181 Ga0097620_100087076 3300006931 Bacteria 3171
182 Ga0097620_100097101 3300006931 Bacteria 2999
183 Ga0097620_100220703 3300006931 Bacteria 1983
184 Ga0097620_100344500 3300006931 Bacteria 1585
185 Ga0105251_10076876 3300009011 Bacteria 1548
186 Ga0105240_10111072 3300009093 Bacteria 3317
187 Ga0111539_10009424 3300009094 Bacteria 12319
188 Ga0111539_10233291 3300009094 Bacteria 2142
189 Ga0111539_10247096 3300009094 Bacteria 2077
190 Ga0105247_10001711 3300009101 Bacteria 15470
191 Ga0105247_10010653 3300009101 Bacteria 5551
192 Ga0114129_10038739 3300009147 Bacteria 6720
193 Ga0114129_10099972 3300009147 Bacteria 4013
194 Ga0105241_10002606 3300009174 Bacteria 13525
195 Ga0105241_10023950 3300009174 Bacteria 4532
196 Ga0105242_10032727 3300009176 Bacteria 4159
197 Ga0105248_10534895 3300009177 Bacteria 1322
198 Ga0105237_10000186 3300009545 Bacteria 87958
199 Ga0105237_10008863 3300009545 Bacteria 10846
200 Ga0105237_10126904 3300009545 Bacteria 2545
201 Ga0105237_10343804 3300009545 Bacteria 1496
202 Ga0105238_10313987 3300009551 Bacteria 1553
203 Ga0105238_10435747 3300009551 Bacteria 1307
204 Ga0105249_10001305 3300009553 Bacteria 21857
205 Ga0105249_10002125 3300009553 Bacteria 17191
206 Ga0105249_10004589 3300009553 Bacteria 11938
207 Ga0105249_10017591 3300009553 Bacteria 6346
208 Ga0105249_10066289 3300009553 Bacteria 3324
209 Ga0105249_10136214 3300009553 Bacteria 2350
210 Ga0105249_10153255 3300009553 Bacteria 2221
211 Ga0105249_10328861 3300009553 Bacteria 1542
212 Ga0105249_10520721 3300009553 Bacteria 1236
213 Ga0105249_10742354 3300009553 Bacteria 1043
214 Ga0157370_10058730 3300013104 Bacteria 3656
215 Ga0157370_10275811 3300013104 Unclassified 1554
216 Ga0157374_10045341 3300013296 Bacteria 4069
217 Ga0157374_10053269 3300013296 Bacteria 3771
218 Ga0157374_10112049 3300013296 Bacteria 2625
219 Ga0157378_10008006 3300013297 Bacteria 9228
220 Ga0157378_10111771 3300013297 Bacteria 2505
221 Ga0157378_10170276 3300013297 Bacteria 2042
222 Ga0157378_10290406 3300013297 Unclassified 1579
223 Ga0163162_10008657 3300013306 Bacteria 9907
224 Ga0163162_10009101 3300013306 Bacteria 9655
225 Ga0163162_10026861 3300013306 Bacteria 5692
226 Ga0163162_10083143 3300013306 Bacteria 3275
227 Ga0163162_10121898 3300013306 Bacteria 2712
228 Ga0163162_10360163 3300013306 Bacteria 1587
229 Ga0157372_10286234 3300013307 Unclassified 1917
230 Ga0157372_11025043 3300013307 Unclassified 955
231 Ga0157375_10009353 3300013308 Bacteria 8601
232 Ga0157375_10041368 3300013308 Bacteria 4449
233 Ga0157375_10063960 3300013308 Bacteria 3662
234 Ga0157375_10074839 3300013308 Bacteria 3409
235 Ga0157375_10084502 3300013308 Bacteria 3223
236 Ga0157375_10094282 3300013308 Bacteria 3062
237 Ga0157375_10120369 3300013308 Bacteria 2734
238 Ga0157375_10368231 3300013308 Bacteria 1603
239 Ga0163163_10000057 3300014325 Bacteria 124939
240 Ga0163163_10168240 3300014325 Unclassified 2238
241 Ga0163163_10225243 3300014325 Bacteria 1924
242 Ga0163163_10237635 3300014325 Bacteria 1871
243 Ga0163163_10290436 3300014325 Bacteria 1687
244 Ga0163163_10309748 3300014325 Bacteria 1632
245 Ga0163163_10420332 3300014325 Bacteria 1396
246 Ga0163163_10472161 3300014325 Bacteria 1315
247 Ga0157380_10006905 3300014326 Bacteria 8028
248 Ga0157380_10048001 3300014326 Bacteria 3361
249 Ga0157380_10165884 3300014326 Bacteria 1924
250 Ga0157377_10002222 3300014745 Bacteria 8531
251 Ga0157377_10002409 3300014745 Bacteria 8259
252 Ga0157377_10018966 3300014745 Bacteria 3587
253 Ga0157377_10020120 3300014745 Bacteria 3492
254 Ga0157379_10069223 3300014968 Bacteria 3156
255 Ga0157379_10097793 3300014968 Bacteria 2635
256 Ga0157379_10217547 3300014968 Bacteria 1730
257 Ga0157379_10257809 3300014968 Bacteria 1584
258 Ga0157379_10281073 3300014968 Bacteria 1515
259 Ga0157376_10004238 3300014969 Bacteria 9956
260 Ga0157376_10004626 3300014969 Bacteria 9586
261 Ga0157376_10119623 3300014969 Bacteria 2332
262 Ga0157376_10142924 3300014969 Bacteria 2149
263 Ga0157376_10219966 3300014969 Unclassified 1758
264 Ga0157376_10221325 3300014969 Bacteria 1753
265 Ga0157376_10282503 3300014969 Bacteria 1564
266 Ga0163161_10003529 3300017792 Bacteria 10949
267 Ga0163161_10049038 3300017792 Bacteria 3050
268 Ga0163161_10139649 3300017792 Bacteria 1834
269 Ga0163161_10199719 3300017792 Unclassified 1541
270 Ga0163161_10260724 3300017792 Bacteria 1354
271 Ga0207656_10023421 3300025321 Unclassified 2487
272 Ga0207710_10000874 3300025900 Bacteria 16147
273 Ga0207710_10016035 3300025900 Bacteria 3170
274 Ga0207680_10000512 3300025903 Bacteria 18520
275 Ga0207680_10048623 3300025903 Bacteria 2521
276 Ga0207680_10269105 3300025903 Bacteria 1181
277 Ga0207647_10128449 3300025904 Bacteria 1491
278 Ga0207645_10038906 3300025907 Bacteria 3048
279 Ga0207643_10014673 3300025908 Bacteria 4259
280 Ga0207643_10146025 3300025908 Bacteria 1415
281 Ga0207705_10368148 3300025909 Unclassified 1109
282 Ga0207654_10006014 3300025911 Bacteria 6102
283 Ga0207654_10390907 3300025911 Bacteria 965
284 Ga0207707_10036687 3300025912 Bacteria 4285
285 Ga0207695_10213222 3300025913 Unclassified 1841
286 Ga0207671_10000521 3300025914 Bacteria 51898
287 Ga0207671_10004556 3300025914 Bacteria 13167
288 Ga0207660_10060856 3300025917 Bacteria 2716
289 Ga0207662_10031042 3300025918 Bacteria 3104
290 Ga0207657_10150392 3300025919 Bacteria 1897
291 Ga0207649_10002980 3300025920 Bacteria 9328
292 Ga0207652_10001622 3300025921 Bacteria 19775
293 Ga0207652_10510404 3300025921 Bacteria 1082
294 Ga0207646_10046301 3300025922 Unclassified 3902
295 Ga0207681_10073501 3300025923 Bacteria 2392
296 Ga0207681_10096833 3300025923 Bacteria 2119
297 Ga0207681_10259912 3300025923 Bacteria 1359
298 Ga0207681_10388886 3300025923 Bacteria 1124
299 Ga0207650_10082799 3300025925 Bacteria 2436
300 Ga0207650_10360583 3300025925 Bacteria 1197
301 Ga0207659_10004312 3300025926 Bacteria 8598
302 Ga0207659_10045925 3300025926 Bacteria 3082
303 Ga0207659_10070582 3300025926 Bacteria 2548
304 Ga0207690_10018793 3300025932 Bacteria 4243
305 Ga0207706_10025516 3300025933 Bacteria 5295
306 Ga0207706_10052951 3300025933 Bacteria 3583
307 Ga0207706_10112733 3300025933 Bacteria 2392
308 Ga0207706_10247474 3300025933 Bacteria 1558
309 Ga0207686_10000554 3300025934 Bacteria 24037
310 Ga0207686_10043302 3300025934 Bacteria 2757
311 Ga0207686_10044875 3300025934 Bacteria 2716
312 Ga0207670_10004053 3300025936 Bacteria 7839
313 Ga0207670_10006674 3300025936 Bacteria 6422
314 Ga0207670_10068385 3300025936 Bacteria 2447
315 Ga0207669_10047401 3300025937 Bacteria 2546
316 Ga0207704_10019507 3300025938 Unclassified 3563
317 Ga0207704_10133653 3300025938 Bacteria 1723
318 Ga0207691_10019542 3300025940 Bacteria 6409
319 Ga0207691_10037004 3300025940 Bacteria 4521
320 Ga0207691_10316030 3300025940 Bacteria 1340
321 Ga0207711_10334938 3300025941 Bacteria 1400
322 Ga0207689_10000782 3300025942 Bacteria 30527
323 Ga0207689_10004002 3300025942 Bacteria 13403
324 Ga0207689_10008139 3300025942 Bacteria 9144
325 Ga0207689_10020924 3300025942 Bacteria 5499
326 Ga0207689_10034466 3300025942 Bacteria 4205
327 Ga0207689_10048636 3300025942 Bacteria 3498
328 Ga0207689_10058454 3300025942 Bacteria 3172
329 Ga0207661_10000589 3300025944 Bacteria 23208
330 Ga0207661_10067379 3300025944 Bacteria 2911
331 Ga0207679_10001213 3300025945 Bacteria 16399
332 Ga0207679_10078585 3300025945 Bacteria 2514
333 Ga0207651_10002163 3300025960 Bacteria 9299
334 Ga0207651_10057594 3300025960 Bacteria 2681
335 Ga0207712_10000635 3300025961 Bacteria 27680
336 Ga0207712_10002164 3300025961 Bacteria 12842
337 Ga0207712_10003522 3300025961 Bacteria 9883
338 Ga0207712_10009863 3300025961 Bacteria 6054
339 Ga0207668_10170930 3300025972 Bacteria 1704
340 Ga0207640_10126585 3300025981 Bacteria 1840
341 Ga0207658_10011195 3300025986 Bacteria 6111
342 Ga0207658_10063087 3300025986 Bacteria 2776
343 Ga0207658_10154737 3300025986 Unclassified 1872
344 Ga0207677_10004870 3300026023 Bacteria 7243
345 Ga0207677_10032091 3300026023 Bacteria 3373
346 Ga0207677_10228498 3300026023 Bacteria 1497
347 Ga0207677_10260114 3300026023 Bacteria 1414
348 Ga0207703_10006469 3300026035 Bacteria 9355
349 Ga0207703_10058717 3300026035 Bacteria 3141
350 Ga0207703_10095467 3300026035 Bacteria 2508
351 Ga0207639_10007559 3300026041 Bacteria 7412
352 Ga0207639_10012272 3300026041 Bacteria 5966
353 Ga0207639_10054223 3300026041 Bacteria 3064
354 Ga0207639_10225606 3300026041 Bacteria 1621
355 Ga0207639_10374791 3300026041 Bacteria 1277
356 Ga0207708_10158070 3300026075 Bacteria 1788
357 Ga0207708_10165313 3300026075 Bacteria 1749
358 Ga0207708_10203389 3300026075 Bacteria 1581
359 Ga0207641_10002898 3300026088 Bacteria 15523
360 Ga0207641_10003127 3300026088 Bacteria 14880
361 Ga0207641_10135234 3300026088 Bacteria 2218
362 Ga0207641_10200213 3300026088 Bacteria 1841
363 Ga0207641_10780457 3300026088 Bacteria 944
364 Ga0207648_10001661 3300026089 Bacteria 24363
365 Ga0207648_10028165 3300026089 Bacteria 4983
366 Ga0207648_10043485 3300026089 Bacteria 3943
367 Ga0207648_10080831 3300026089 Bacteria 2835
368 Ga0207648_10334084 3300026089 Bacteria 1363
369 Ga0207676_10003002 3300026095 Bacteria 12032
370 Ga0207676_10042407 3300026095 Bacteria 3500
371 Ga0207676_10060511 3300026095 Bacteria 2996
372 Ga0207676_10154183 3300026095 Unclassified 1982
373 Ga0207676_10155082 3300026095 Bacteria 1977
374 Ga0207676_10193277 3300026095 Bacteria 1792
375 Ga0207676_10256693 3300026095 Bacteria 1576
376 Ga0207674_10007723 3300026116 Bacteria 12519
377 Ga0207674_10012956 3300026116 Bacteria 9300
378 Ga0207674_10079536 3300026116 Bacteria 3282
379 Ga0207674_10081002 3300026116 Bacteria 3249
380 Ga0207674_10378000 3300026116 Bacteria 1369
381 Ga0207675_100000272 3300026118 Bacteria 49071
382 Ga0207675_100052041 3300026118 Bacteria 3821
383 Ga0207675_100068327 3300026118 Bacteria 3321
384 Ga0207675_100116029 3300026118 Bacteria 2530
385 Ga0207675_100130503 3300026118 Bacteria 2383
386 Ga0207675_100165313 3300026118 Bacteria 2113
387 Ga0207675_100172420 3300026118 Bacteria 2068
388 Ga0207675_100173161 3300026118 Bacteria 2064
389 Ga0207675_100318400 3300026118 Bacteria 1518
390 Ga0207683_10009661 3300026121 Bacteria 8221
391 Ga0207698_10033631 3300026142 Bacteria 3728
392 Ga0207698_10040878 3300026142 Bacteria 3451
393 Ga0207698_10057018 3300026142 Bacteria 3019
394 Ga0207428_10207881 3300027907 Bacteria 1471
395 Ga0268266_10132102 3300028379 Bacteria 2234
396 Ga0268266_10214224 3300028379 Bacteria 1768
397 Ga0268265_10013806 3300028380 Bacteria 5497
398 Ga0268264_10001326 3300028381 Bacteria 23282
399 Ga0268264_10002002 3300028381 Bacteria 18301
400 Ga0268264_10136741 3300028381 Bacteria 2180
401 Ga0268264_10209641 3300028381 Unclassified 1788
402 Ga0268264_10354518 3300028381 Bacteria 1397
403 Ga0307517_10009936 3300028786 Bacteria 13404
404 Ga0307515_10000021 3300028794 Bacteria 406008
405 Ga0307511_10000104 3300030521 Bacteria 75069
406 Ga0307513_10054961 3300031456 Bacteria 4264
407 Ga0307509_10260494 3300031507 Bacteria 1510
408 Ga0307508_10000981 3300031616 Bacteria 33137
409 Ga0307508_10185726 3300031616 Bacteria 1681
410 Ga0307516_10000496 3300031730 Bacteria 52327
411 Ga0307409_100784745 3300031995 Unclassified 959
412 Ga0307510_10000165 3300033180 Bacteria 55957
413 Ga0373944_0023675 3300035089 Unclassified 1794
414 Ga0373925_0467481 3300037068 Bacteria 1034
415 Ga0451849_0799415 3300041505 Bacteria 1898
416 Ga0451577_0005807 3300042876 Bacteria 12503
417 Ga0451577_0419516 3300042876 Bacteria 1215
418 Ga0451576_0611163 3300045051 Bacteria 1146
419 Ga0495629_0094116 3300046459 Bacteria 2091
420 Ga0495638_0043082 3300046460 Bacteria 2848
421 Ga0495582_0208141 3300046473 Bacteria 1118
422 Ga0495630_0162375 3300046517 Bacteria 1701
423 Ga0495643_0040273 3300046522 Unclassified 2552
424 Ga0495648_0003175 3300046524 Bacteria 14631
425 Ga0495640_0260512 3300046533 Bacteria 1084
426 Ga0495587_0064904 3300046536 Bacteria 2133
427 Ga0495633_0115541 3300046558 Bacteria 1244
428 Ga0495668_0000099 3300046616 Bacteria 137915
429 Ga0495625_0048268 3300046660 Bacteria 3067
430 Ga0495599_0167239 3300046678 Bacteria 1358
431 Ga0495672_0009389 3300047320 Bacteria 7094
432 Ga0495672_0074698 3300047320 Bacteria 1908
433 Ga0495684_0301353 3300047471 Bacteria 1151
434 Ga0495686_0036477 3300047472 Bacteria 3155
435 Ga0496115_0180175 3300048918 Bacteria 1747
436 Ga0496115_0260654 3300048918 Bacteria 1426
437 Ga0501032_0319798 3300049569 Unclassified 1002
438 Ga0501043_0457755 3300049579 Unclassified 958
439 Ga0501068_0162512 3300049584 Bacteria 1408
440 Ga0501069_0033356 3300049585 Bacteria 2836
441 Ga0501070_0019099 3300049586 Bacteria 5749
442 Ga0501073_0106314 3300049589 Bacteria 1947
443 nmdc:mga0k408_141112_c1 3300050493 Unclassified 1433
444 nmdc:mga0k408_296013_c1 3300050493 Bacteria 966
445 nmdc:mga05p37_43835_c1 3300050507 Bacteria 5504
446 nmdc:mga09592_13482_c1 3300050508 Bacteria 6675
447 nmdc:mga0qj67_214216_c1 3300050509 Bacteria 1564
448 nmdc:mga06r32_27334_c1 3300050510 Bacteria 5328
449 nmdc:mga06r32_9504_c1 3300050510 Bacteria 8778
450 nmdc:mga08y16_389898_c1 3300050511 Bacteria 1427
451 nmdc:mga0n895_133211_c1 3300050512 Bacteria 2511
452 Ga0500641_0055063 3300053096 Unclassified 1646
453 Ga0500628_036045 3300053129 Bacteria 1104
454 Ga0500588_0002638 3300053146 Bacteria 3684
455 Ga0500622_0002308 3300053156 Bacteria 13946
456 Ga0500611_000052 3300053727 Bacteria 50936
457 Ga0501084_0053118 3300054114 Bacteria 3389
458 Ga0501082_0005308 3300060353 Bacteria 11201
459 nmdc:mga05p37_785290_c1
460 MBSR1b_contig_1361775
461 rootH1_10028407
462 rootL2_10318608
463 rootH1_10332763
464 Ga0065704_10178962
465 Ga0065712_10000551
466 Ga0065715_10002371
467 Ga0065715_10019395
468 Ga0065707_10094407
469 Ga0065707_10127714
470 Ga0065707_10146744
471 Ga0070658_10473968
472 Ga0070676_10018110
473 Ga0070683_100000690
474 Ga0070683_100008953
475 Ga0070683_100142409
476 Ga0070683_100397566
477 Ga0070690_100083138
478 Ga0070670_100019856
479 Ga0070670_100027295
480 Ga0070670_100072666
481 Ga0070670_100087636
482 Ga0070670_100196349
483 Ga0070677_10074045
484 Ga0068869_100012104
485 Ga0068869_100057491
486 Ga0068869_100063385
487 Ga0068869_100070786
488 Ga0068869_100077457
489 Ga0068869_100214071
490 Ga0070666_10000019
491 Ga0070666_10014374
492 Ga0070666_10049353
493 Ga0070666_10064304
494 Ga0070666_10430056
495 Ga0070680_100077668
496 Ga0070682_100001035
497 Ga0070682_100015346
498 Ga0068868_100012971
499 Ga0068868_100213197
500 Ga0068868_100217111
501 Ga0070660_100034424
502 Ga0070660_100134682
503 Ga0070689_100008203
504 Ga0070689_100026726
505 Ga0070689_100058863
506 Ga0070691_10067959
507 Ga0070687_100019693
508 Ga0070661_100000615
509 Ga0070668_100008223
510 Ga0070668_100248923
511 Ga0070669_100012757
512 Ga0070669_100107857
513 Ga0070669_100108453
514 Ga0070675_100000570
515 Ga0070675_100026342
516 Ga0070675_100065034
517 Ga0070675_100068384
518 Ga0070675_100144610
519 Ga0070671_100042666
520 Ga0070671_100069493
521 Ga0070671_100185383
522 Ga0070673_100002308
523 Ga0070673_100015161
524 Ga0070673_100025247
525 Ga0070673_100103543
526 Ga0070673_100230159
527 Ga0070688_100001242
528 Ga0070688_100004531
529 Ga0070688_100018463
530 Ga0070659_100008665
531 Ga0070667_100003997
532 Ga0070667_100105235
533 Ga0070701_10043427
534 Ga0070678_100004844
535 Ga0070662_100003664
536 Ga0070662_100054538
537 Ga0070662_100055167
538 Ga0070662_100056771
539 Ga0070662_100186431
540 Ga0070681_10162716
541 Ga0068867_100037534
542 Ga0068867_100048238
543 Ga0068867_100050207
544 Ga0068867_100105614
545 Ga0068867_100206463
546 Ga0070685_10004817
547 Ga0070685_10007675
548 Ga0070685_10011838
549 Ga0070685_10239303
550 Ga0070698_100006625
551 Ga0070698_100165567
552 Ga0070698_100311866
553 Ga0070679_100066554
554 Ga0070679_100485976
555 Ga0070684_100000986
556 Ga0070684_100044373
557 Ga0070684_100098263
558 Ga0068853_100013072
559 Ga0068853_100037485
560 Ga0068853_100063734
561 Ga0068853_100076208
562 Ga0068853_100307974
563 Ga0070672_100021870
564 Ga0070686_100021601
565 Ga0070686_100260102
566 Ga0070696_100266038
567 Ga0070665_100000018
568 Ga0068855_100155875
569 Ga0068855_100166222
570 Ga0070664_100001066
571 Ga0070664_100085866
572 Ga0070664_100158746
573 Ga0068857_100001057
574 Ga0068857_100022395
575 Ga0068857_100023982
576 Ga0068857_100025645
577 Ga0068857_100368143
578 Ga0068854_100105695
579 Ga0068854_100413881
580 Ga0068852_100009554
581 Ga0068852_100159366
582 Ga0068852_100176706
583 Ga0068859_100000013
584 Ga0068859_100016151
585 Ga0068859_100097112
586 Ga0068859_100220681
587 Ga0068859_100344535
588 Ga0068864_100004091
589 Ga0068864_100043410
590 Ga0068864_100112929
591 Ga0068866_10069488
592 Ga0068861_100014667
593 Ga0068861_100041153
594 Ga0068861_100050381
595 Ga0068861_100230344
596 Ga0068870_10085570
597 Ga0068863_100017465
598 Ga0068863_100095693
599 Ga0068863_100147933
600 Ga0068863_100388354
601 Ga0068863_100487270
602 Ga0068858_100005907
603 Ga0068858_100064670
604 Ga0068858_100110180
605 Ga0068860_100000983
606 Ga0068860_100003160
607 Ga0068860_100084921
608 Ga0068860_100183562
609 Ga0068860_100295745
610 Ga0068862_100041057
611 Ga0068862_100103452
612 Ga0070715_10021239
613 Ga0075366_10003142
614 Ga0075366_10045288
615 Ga0097621_100021201
616 Ga0097621_100034636
617 Ga0097621_100071274
618 Ga0097621_100304743
619 Ga0097621_100400083
620 Ga0068871_100016275
621 Ga0068871_100022431
622 Ga0068871_100038051
623 Ga0068871_100064884
624 Ga0068871_100244047
625 Ga0068871_100581258
626 Ga0075428_100001815
627 Ga0075428_100002594
628 Ga0075430_100007617
629 Ga0075430_100097687
630 Ga0075431_100024797
631 Ga0075431_100035835
632 Ga0075434_100137119
633 Ga0075429_100001013
634 Ga0075429_100028184
635 Ga0068865_100012800
636 Ga0068865_100049974
637 Ga0097620_100000013
638 Ga0097620_100016151
639 Ga0097620_100087076
640 Ga0097620_100097101
641 Ga0097620_100220703
642 Ga0097620_100344500
643 Ga0105251_10076876
644 Ga0105240_10111072
645 Ga0111539_10009424
646 Ga0111539_10233291
647 Ga0111539_10247096
648 Ga0105247_10001711
649 Ga0105247_10010653
650 Ga0114129_10038739
651 Ga0114129_10099972
652 Ga0105241_10002606
653 Ga0105241_10023950
654 Ga0105242_10032727
655 Ga0105248_10534895
656 Ga0105237_10000186
657 Ga0105237_10008863
658 Ga0105237_10126904
659 Ga0105237_10343804
660 Ga0105238_10313987
661 Ga0105238_10435747
662 Ga0105249_10001305
663 Ga0105249_10002125
664 Ga0105249_10004589
665 Ga0105249_10017591
666 Ga0105249_10066289
667 Ga0105249_10136214
668 Ga0105249_10153255
669 Ga0105249_10328861
670 Ga0105249_10520721
671 Ga0105249_10742354
672 Ga0157370_10058730
673 Ga0157370_10275811
674 Ga0157374_10045341
675 Ga0157374_10053269
676 Ga0157374_10112049
677 Ga0157378_10008006
678 Ga0157378_10111771
679 Ga0157378_10170276
680 Ga0157378_10290406
681 Ga0163162_10008657
682 Ga0163162_10009101
683 Ga0163162_10026861
684 Ga0163162_10083143
685 Ga0163162_10121898
686 Ga0163162_10360163
687 Ga0157372_10286234
688 Ga0157372_11025043
689 Ga0157375_10009353
690 Ga0157375_10041368
691 Ga0157375_10063960
692 Ga0157375_10074839
693 Ga0157375_10084502
694 Ga0157375_10094282
695 Ga0157375_10120369
696 Ga0157375_10368231
697 Ga0163163_10000057
698 Ga0163163_10168240
699 Ga0163163_10225243
700 Ga0163163_10237635
701 Ga0163163_10290436
702 Ga0163163_10309748
703 Ga0163163_10420332
704 Ga0163163_10472161
705 Ga0157380_10006905
706 Ga0157380_10048001
707 Ga0157380_10165884
708 Ga0157377_10002222
709 Ga0157377_10002409
710 Ga0157377_10018966
711 Ga0157377_10020120
712 Ga0157379_10069223
713 Ga0157379_10097793
714 Ga0157379_10217547
715 Ga0157379_10257809
716 Ga0157379_10281073
717 Ga0157376_10004238
718 Ga0157376_10004626
719 Ga0157376_10119623
720 Ga0157376_10142924
721 Ga0157376_10219966
722 Ga0157376_10221325
723 Ga0157376_10282503
724 Ga0163161_10003529
725 Ga0163161_10049038
726 Ga0163161_10139649
727 Ga0163161_10199719
728 Ga0163161_10260724
729 Ga0207656_10023421
730 Ga0207710_10000874
731 Ga0207710_10016035
732 Ga0207680_10000512
733 Ga0207680_10048623
734 Ga0207680_10269105
735 Ga0207647_10128449
736 Ga0207645_10038906
737 Ga0207643_10014673
738 Ga0207643_10146025
739 Ga0207705_10368148
740 Ga0207654_10006014
741 Ga0207654_10390907
742 Ga0207707_10036687
743 Ga0207695_10213222
744 Ga0207671_10000521
745 Ga0207671_10004556
746 Ga0207660_10060856
747 Ga0207662_10031042
748 Ga0207657_10150392
749 Ga0207649_10002980
750 Ga0207652_10001622
751 Ga0207652_10510404
752 Ga0207646_10046301
753 Ga0207681_10073501
754 Ga0207681_10096833
755 Ga0207681_10259912
756 Ga0207681_10388886
757 Ga0207650_10082799
758 Ga0207650_10360583
759 Ga0207659_10004312
760 Ga0207659_10045925
761 Ga0207659_10070582
762 Ga0207690_10018793
763 Ga0207706_10025516
764 Ga0207706_10052951
765 Ga0207706_10112733
766 Ga0207706_10247474
767 Ga0207686_10000554
768 Ga0207686_10043302
769 Ga0207686_10044875
770 Ga0207670_10004053
771 Ga0207670_10006674
772 Ga0207670_10068385
773 Ga0207669_10047401
774 Ga0207704_10019507
775 Ga0207704_10133653
776 Ga0207691_10019542
777 Ga0207691_10037004
778 Ga0207691_10316030
779 Ga0207711_10334938
780 Ga0207689_10000782
781 Ga0207689_10004002
782 Ga0207689_10008139
783 Ga0207689_10020924
784 Ga0207689_10034466
785 Ga0207689_10048636
786 Ga0207689_10058454
787 Ga0207661_10000589
788 Ga0207661_10067379
789 Ga0207679_10001213
790 Ga0207679_10078585
791 Ga0207651_10002163
792 Ga0207651_10057594
793 Ga0207712_10000635
794 Ga0207712_10002164
795 Ga0207712_10003522
796 Ga0207712_10009863
797 Ga0207668_10170930
798 Ga0207640_10126585
799 Ga0207658_10011195
800 Ga0207658_10063087
801 Ga0207658_10154737
802 Ga0207677_10004870
803 Ga0207677_10032091
804 Ga0207677_10228498
805 Ga0207677_10260114
806 Ga0207703_10006469
807 Ga0207703_10058717
808 Ga0207703_10095467
809 Ga0207639_10007559
810 Ga0207639_10012272
811 Ga0207639_10054223
812 Ga0207639_10225606
813 Ga0207639_10374791
814 Ga0207708_10158070
815 Ga0207708_10165313
816 Ga0207708_10203389
817 Ga0207641_10002898
818 Ga0207641_10003127
819 Ga0207641_10135234
820 Ga0207641_10200213
821 Ga0207641_10780457
822 Ga0207648_10001661
823 Ga0207648_10028165
824 Ga0207648_10043485
825 Ga0207648_10080831
826 Ga0207648_10334084
827 Ga0207676_10003002
828 Ga0207676_10042407
829 Ga0207676_10060511
830 Ga0207676_10154183
831 Ga0207676_10155082
832 Ga0207676_10193277
833 Ga0207676_10256693
834 Ga0207674_10007723
835 Ga0207674_10012956
836 Ga0207674_10079536
837 Ga0207674_10081002
838 Ga0207674_10378000
839 Ga0207675_100000272
840 Ga0207675_100052041
841 Ga0207675_100068327
842 Ga0207675_100116029
843 Ga0207675_100130503
844 Ga0207675_100165313
845 Ga0207675_100172420
846 Ga0207675_100173161
847 Ga0207675_100318400
848 Ga0207683_10009661
849 Ga0207698_10033631
850 Ga0207698_10040878
851 Ga0207698_10057018
852 Ga0207428_10207881
853 Ga0268266_10132102
854 Ga0268266_10214224
855 Ga0268265_10013806
856 Ga0268264_10001326
857 Ga0268264_10002002
858 Ga0268264_10136741
859 Ga0268264_10209641
860 Ga0268264_10354518
861 Ga0307517_10009936
862 Ga0307515_10000021
863 Ga0307511_10000104
864 Ga0307513_10054961
865 Ga0307509_10260494
866 Ga0307508_10000981
867 Ga0307508_10185726
868 Ga0307516_10000496
869 Ga0307409_100784745
870 Ga0307510_10000165
871 Ga0373944_0023675
872 Ga0373925_0467481
873 Ga0451849_0799415
874 Ga0451577_0005807
875 Ga0451577_0419516
876 Ga0451576_0611163
877 Ga0495629_0094116
878 Ga0495638_0043082
879 Ga0495582_0208141
880 Ga0495630_0162375
881 Ga0495643_0040273
882 Ga0495648_0003175
883 Ga0495640_0260512
884 Ga0495587_0064904
885 Ga0495633_0115541
886 Ga0495668_0000099
887 Ga0495625_0048268
888 Ga0495599_0167239
889 Ga0495672_0009389
890 Ga0495672_0074698
891 Ga0495684_0301353
892 Ga0495686_0036477
893 Ga0496115_0180175
894 Ga0496115_0260654
895 Ga0501032_0319798
896 Ga0501043_0457755
897 Ga0501068_0162512
898 Ga0501069_0033356
899 Ga0501070_0019099
900 Ga0501073_0106314
901 nmdc:mga0k408_141112_c1
902 nmdc:mga0k408_296013_c1
903 nmdc:mga05p37_43835_c1
904 nmdc:mga09592_13482_c1
905 nmdc:mga0qj67_214216_c1
906 nmdc:mga06r32_27334_c1
907 nmdc:mga06r32_9504_c1
908 nmdc:mga08y16_389898_c1
909 nmdc:mga0n895_133211_c1
910 Ga0500641_0055063
911 Ga0500628_036045
912 Ga0500588_0002638
913 Ga0500622_0002308
914 Ga0500611_000052
915 Ga0501084_0053118
916 Ga0501082_0005308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

30

314

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i3a-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in outward conformation 0.6934 133 253
8i3b-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in nanodisc 0.6811 133 253
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.6794 133 254
5do7-assembly1.cif.gz_A crystal structure of the human sterol transporter abcg5/abcg8 0.5873 137 258
5do7-assembly2.cif.gz_C crystal structure of the human sterol transporter abcg5/abcg8 0.5834 137 258
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4696 32 248 3.40.1710.10
af_Q9VSE7_222_481_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4511 139 253 1.20.1070.10
af_Q9UPN3_4415_4574_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4325 130 253 1.20.58.60
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.43 22 251 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4218 29 250 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2H0YZ92-F1-model_v4 ABC transporter permease 0.8794 112 258 GO:0016020
AF-A0A2H0YZ92-F1-model_v4 ABC transporter permease 0.8733 112 258 GO:0016020
AF-A0A6B3HHE6-F1-model_v4 ABC transporter permease 0.8447 127 258 GO:0016020
AF-A0A520EBT3-F1-model_v4 ABC transporter permease 0.8411 125 258 GO:0016020
AF-A0A357Z6T5-F1-model_v4 ABC transporter permease 0.8269 2 258 GO:0005886
GO:0140359

Map