F448277

General Info

Members Datasets Scaffolds Average Seq Length
458 205 916 187

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0014536|Ga0500644_0014536_1153_1842
Length 229
Sequence VAHCVVGALRFSLTVCQIPLAPIRISASQCIHVEILHKEEFFMYGVTDLKKGVLITLDGKPYRVIDYSQKVMGRGGSIVNVRVKNLLDGSVIPKTFKGAEKVAPASVENRTVQYLYKDGDNYNFMDGATFEQFELSSDTIGDIAPYLKEGNEVSLQSYEGKIINVELPNNLFLEVTYTENVVKGDTTSSVLKDATLETGLVVKVPAFIKLGDVIKVDTRTGEYLERKKD

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
57 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
58 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
59 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
110 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
111 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
179 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
187 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
188 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
193 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
203 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.35
Nodule 0
Rhizoplane 0.44
Rhizosphere 67.47
Stem 0
Stem Tuber 0
Unclassified 16.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0014536 3300053088 Bacteria 2224
2 MBSR1b_contig_5452016 2162886012 Unclassified 1983
3 JGI24741J21665_1003818 3300001915 Bacteria 3490
4 JGI24740J21852_10002100 3300001979 Bacteria 9114
5 JGI24740J21852_10046072 3300001979 Unclassified 1282
6 JGI24740J21852_10073404 3300001979 Bacteria 911
7 JGI24737J22298_10000346 3300001990 Bacteria 15562
8 JGI24735J21928_10000055 3300002067 Bacteria 48760
9 rootH2_10004334 3300003320 Bacteria 85448
10 rootH2_10256068 3300003320 Unclassified 1738
11 rootL2_10034609 3300003322 Bacteria 5154
12 rootL2_10345480 3300003322 Bacteria 2906
13 rootH1_10001727 3300003323 Bacteria 102468
14 Ga0070658_10034525 3300005327 Bacteria 4069
15 Ga0070676_10000131 3300005328 Bacteria 28364
16 Ga0070676_10067529 3300005328 Bacteria 2138
17 Ga0070683_100000239 3300005329 Bacteria 37590
18 Ga0070683_100000380 3300005329 Bacteria 30907
19 Ga0070683_100313539 3300005329 Bacteria 1493
20 Ga0070683_101312503 3300005329 Bacteria 695
21 Ga0070670_100049074 3300005331 Bacteria 3631
22 Ga0070680_100108507 3300005336 Bacteria 2309
23 Ga0070680_100181560 3300005336 Bacteria 1772
24 Ga0070680_100345830 3300005336 Unclassified 1264
25 Ga0068868_100475767 3300005338 Bacteria 1090
26 Ga0068868_100966569 3300005338 Unclassified 777
27 Ga0070660_100000158 3300005339 Bacteria 44096
28 Ga0070660_100000226 3300005339 Bacteria 37370
29 Ga0070671_100000001 3300005355 Bacteria 1228151
30 Ga0070659_100097380 3300005366 Bacteria 2364
31 Ga0070659_100770645 3300005366 Unclassified 835
32 Ga0070667_100000503 3300005367 Bacteria 39598
33 Ga0070708_100592283 3300005445 Bacteria 1045
34 Ga0070678_100058574 3300005456 Bacteria 2828
35 Ga0070681_10060128 3300005458 Unclassified 3778
36 Ga0070681_10126730 3300005458 Bacteria 2485
37 Ga0070681_10258094 3300005458 Unclassified 1655
38 Ga0070681_10593901 3300005458 Unclassified 1021
39 Ga0070679_100004467 3300005530 Bacteria 12923
40 Ga0070679_100006731 3300005530 Bacteria 10719
41 Ga0070679_100207570 3300005530 Unclassified 1923
42 Ga0070679_100214688 3300005530 Unclassified 1887
43 Ga0070679_100219344 3300005530 Bacteria 1863
44 Ga0070679_100341741 3300005530 Bacteria 1445
45 Ga0070684_100000280 3300005535 Bacteria 35451
46 Ga0070684_100003029 3300005535 Bacteria 12528
47 Ga0070684_100013425 3300005535 Bacteria 6604
48 Ga0070684_101322644 3300005535 Bacteria 678
49 Ga0070665_100917412 3300005548 Unclassified 888
50 Ga0068855_100000002 3300005563 Bacteria 616881
51 Ga0068855_100001316 3300005563 Bacteria 30782
52 Ga0068855_101008636 3300005563 Unclassified 874
53 Ga0070664_100672032 3300005564 Unclassified 963
54 Ga0068857_100144434 3300005577 Bacteria 2152
55 Ga0068857_100308730 3300005577 Bacteria 1459
56 Ga0068857_100363740 3300005577 Bacteria 1341
57 Ga0068854_100326239 3300005578 Bacteria 1249
58 Ga0068856_100000441 3300005614 Bacteria 45741
59 Ga0068856_100002238 3300005614 Bacteria 19969
60 Ga0068856_100171882 3300005614 Bacteria 2179
61 Ga0068856_100418879 3300005614 Bacteria 1359
62 Ga0068852_100000001 3300005616 Bacteria 716526
63 Ga0068852_100000621 3300005616 Bacteria 23231
64 Ga0068852_100066076 3300005616 Unclassified 3157
65 Ga0068852_100114707 3300005616 Bacteria 2455
66 Ga0068861_100430638 3300005719 Bacteria 1177
67 Ga0068863_100180954 3300005841 Unclassified 2023
68 Ga0068858_101034077 3300005842 Unclassified 805
69 Ga0068860_100005087 3300005843 Bacteria 13372
70 Ga0068860_100066863 3300005843 Unclassified 3415
71 Ga0081455_10000006 3300005937 Bacteria 323066
72 Ga0081455_10000020 3300005937 Bacteria 172997
73 Ga0075365_10000005 3300006038 Bacteria 125137
74 Ga0075365_10000011 3300006038 Bacteria 85296
75 Ga0075365_10005061 3300006038 Bacteria 7075
76 Ga0075365_10008982 3300006038 Bacteria 5714
77 Ga0075365_10025194 3300006038 Bacteria 3764
78 Ga0075365_10128664 3300006038 Bacteria 1751
79 Ga0075365_10207579 3300006038 Bacteria 1373
80 Ga0075365_10487839 3300006038 Unclassified 871
81 Ga0075368_10000090 3300006042 Bacteria 22751
82 Ga0075364_10001478 3300006051 Bacteria 12801
83 Ga0075364_10001839 3300006051 Bacteria 11761
84 Ga0075364_10007360 3300006051 Bacteria 6534
85 Ga0075364_10010415 3300006051 Bacteria 5616
86 Ga0075364_10023820 3300006051 Bacteria 3879
87 Ga0075364_10029326 3300006051 Bacteria 3529
88 Ga0075364_10056654 3300006051 Bacteria 2566
89 Ga0075364_10083827 3300006051 Bacteria 2110
90 Ga0075364_10696600 3300006051 Bacteria 693
91 Ga0075362_10005308 3300006177 Bacteria 4706
92 Ga0075362_10093053 3300006177 Bacteria 1401
93 Ga0075367_10041094 3300006178 Bacteria 2702
94 Ga0075367_10114601 3300006178 Bacteria 1657
95 Ga0075367_10282022 3300006178 Bacteria 1044
96 Ga0075369_10000004 3300006186 Bacteria 154675
97 Ga0075369_10001191 3300006186 Bacteria 8804
98 Ga0075369_10003080 3300006186 Bacteria 6039
99 Ga0075369_10018614 3300006186 Unclassified 2829
100 Ga0075369_10073140 3300006186 Bacteria 1511
101 Ga0075366_10000003 3300006195 Bacteria 114017
102 Ga0075366_10000010 3300006195 Bacteria 81131
103 Ga0075366_10000015 3300006195 Bacteria 66498
104 Ga0075366_10060831 3300006195 Bacteria 2244
105 Ga0075366_10132200 3300006195 Unclassified 1506
106 Ga0075366_10286945 3300006195 Bacteria 1006
107 Ga0097621_100000052 3300006237 Bacteria 60152
108 Ga0097621_100017864 3300006237 Bacteria 5401
109 Ga0097621_100259736 3300006237 Bacteria 1523
110 Ga0075370_10025331 3300006353 Bacteria 3281
111 Ga0075370_10037936 3300006353 Bacteria 2711
112 Ga0075370_10043984 3300006353 Bacteria 2524
113 Ga0075370_10054647 3300006353 Bacteria 2268
114 Ga0075370_10088112 3300006353 Bacteria 1789
115 Ga0068871_100000006 3300006358 Bacteria 116822
116 Ga0068871_100108691 3300006358 Bacteria 2331
117 Ga0075428_100004205 3300006844 Bacteria 15856
118 Ga0105240_10000030 3300009093 Bacteria 321312
119 Ga0105240_10000761 3300009093 Bacteria 58856
120 Ga0105240_10000886 3300009093 Bacteria 53766
121 Ga0105240_10000909 3300009093 Bacteria 52908
122 Ga0105240_10061743 3300009093 Unclassified 4669
123 Ga0105240_10117185 3300009093 Bacteria 3212
124 Ga0105240_10408078 3300009093 Bacteria 1529
125 Ga0105240_10480195 3300009093 Bacteria 1386
126 Ga0105245_10000096 3300009098 Bacteria 84679
127 Ga0105245_10055122 3300009098 Bacteria 3570
128 Ga0105245_10378080 3300009098 Unclassified 1410
129 Ga0105247_10098549 3300009101 Bacteria 1866
130 Ga0105241_10014306 3300009174 Bacteria 5809
131 Ga0105241_10027475 3300009174 Bacteria 4238
132 Ga0105241_10183738 3300009174 Bacteria 1736
133 Ga0105248_10030208 3300009177 Bacteria 6049
134 Ga0105248_10236727 3300009177 Unclassified 2055
135 Ga0105237_10000001 3300009545 Bacteria 1009213
136 Ga0105237_10000159 3300009545 Bacteria 95980
137 Ga0105238_10000480 3300009551 Bacteria 41924
138 Ga0105238_10024039 3300009551 Bacteria 6213
139 Ga0105249_10062105 3300009553 Bacteria 3430
140 Ga0105032_100009 3300009979 Bacteria 86569
141 Ga0105032_100012 3300009979 Bacteria 73994
142 Ga0105032_101092 3300009979 Unclassified 2524
143 Ga0105032_108125 3300009979 Bacteria 866
144 Ga0105029_101151 3300009984 Bacteria 1591
145 Ga0105029_104786 3300009984 Bacteria 939
146 Ga0105033_100211 3300009986 Bacteria 4514
147 Ga0105028_100381 3300009993 Bacteria 4757
148 Ga0105028_100650 3300009993 Bacteria 3670
149 Ga0105028_103669 3300009993 Bacteria 1603
150 Ga0105028_104590 3300009993 Unclassified 1439
151 Ga0105028_120103 3300009993 Unclassified 722
152 Ga0105239_10076298 3300010375 Bacteria 3686
153 Ga0105239_10396144 3300010375 Unclassified 1562
154 Ga0105246_10000177 3300011119 Bacteria 31075
155 Ga0105246_10008863 3300011119 Bacteria 6191
156 Ga0157373_10000092 3300013100 Bacteria 74657
157 Ga0157373_10009954 3300013100 Bacteria 7007
158 Ga0157373_10124690 3300013100 Bacteria 1811
159 Ga0157371_10050249 3300013102 Bacteria 2962
160 Ga0157371_10058404 3300013102 Bacteria 2736
161 Ga0157370_10000232 3300013104 Bacteria 71177
162 Ga0157370_10001387 3300013104 Bacteria 29999
163 Ga0157370_10073049 3300013104 Bacteria 3236
164 Ga0157369_10000826 3300013105 Bacteria 39569
165 Ga0157369_10001538 3300013105 Bacteria 28252
166 Ga0157369_10068429 3300013105 Unclassified 3815
167 Ga0157369_10161422 3300013105 Bacteria 2366
168 Ga0157369_10230604 3300013105 Bacteria 1936
169 Ga0157369_10385922 3300013105 Unclassified 1453
170 Ga0157374_10000014 3300013296 Bacteria 396846
171 Ga0157374_10006886 3300013296 Bacteria 9673
172 Ga0157378_10519427 3300013297 Unclassified 1192
173 Ga0157378_10852738 3300013297 Bacteria 939
174 Ga0157372_10000007 3300013307 Bacteria 340690
175 Ga0157372_10000509 3300013307 Bacteria 42761
176 Ga0157372_10037735 3300013307 Bacteria 5330
177 Ga0157372_10042702 3300013307 Bacteria 5016
178 Ga0157372_10163592 3300013307 Bacteria 2572
179 Ga0157372_10797752 3300013307 Unclassified 1097
180 Ga0157372_10904371 3300013307 Unclassified 1024
181 Ga0157372_11272499 3300013307 Unclassified 849
182 Ga0157376_10000223 3300014969 Bacteria 39568
183 Ga0207680_10053071 3300025903 Bacteria 2432
184 Ga0207647_10000087 3300025904 Bacteria 70424
185 Ga0207645_10014711 3300025907 Bacteria 5224
186 Ga0207645_10168885 3300025907 Bacteria 1433
187 Ga0207705_10000019 3300025909 Bacteria 317770
188 Ga0207705_10010500 3300025909 Bacteria 6733
189 Ga0207705_10979731 3300025909 Unclassified 654
190 Ga0207654_10043496 3300025911 Bacteria 2546
191 Ga0207707_10058222 3300025912 Bacteria 3363
192 Ga0207707_11097096 3300025912 Bacteria 649
193 Ga0207695_10000009 3300025913 Bacteria 1034276
194 Ga0207695_10002910 3300025913 Bacteria 24751
195 Ga0207695_10012470 3300025913 Bacteria 10201
196 Ga0207695_10014974 3300025913 Bacteria 9153
197 Ga0207695_10046805 3300025913 Unclassified 4582
198 Ga0207695_10333721 3300025913 Bacteria 1404
199 Ga0207695_10478136 3300025913 Bacteria 1128
200 Ga0207671_10000003 3300025914 Bacteria 1065461
201 Ga0207671_10000008 3300025914 Bacteria 798229
202 Ga0207660_10109391 3300025917 Bacteria 2077
203 Ga0207660_10200943 3300025917 Bacteria 1557
204 Ga0207657_10000226 3300025919 Bacteria 59005
205 Ga0207657_10000547 3300025919 Bacteria 40133
206 Ga0207657_10028548 3300025919 Bacteria 5088
207 Ga0207652_10002428 3300025921 Bacteria 15728
208 Ga0207652_10007281 3300025921 Bacteria 8916
209 Ga0207652_10011441 3300025921 Bacteria 7153
210 Ga0207652_10131974 3300025921 Unclassified 2228
211 Ga0207652_10159167 3300025921 Unclassified 2024
212 Ga0207681_10202398 3300025923 Unclassified 1525
213 Ga0207694_10000785 3300025924 Bacteria 28533
214 Ga0207694_10036569 3300025924 Bacteria 3769
215 Ga0207650_10018353 3300025925 Bacteria 4909
216 Ga0207650_10190464 3300025925 Bacteria 1639
217 Ga0207687_10000008 3300025927 Bacteria 497738
218 Ga0207687_10067931 3300025927 Bacteria 2537
219 Ga0207687_10146123 3300025927 Unclassified 1799
220 Ga0207644_10000001 3300025931 Bacteria 1243214
221 Ga0207690_11014980 3300025932 Unclassified 690
222 Ga0207711_10026148 3300025941 Unclassified 4895
223 Ga0207661_10001467 3300025944 Bacteria 15941
224 Ga0207661_10002072 3300025944 Bacteria 13787
225 Ga0207661_10453416 3300025944 Bacteria 1168
226 Ga0207679_10465567 3300025945 Bacteria 1123
227 Ga0207667_10000005 3300025949 Bacteria 715503
228 Ga0207667_10000048 3300025949 Bacteria 238293
229 Ga0207667_10004009 3300025949 Bacteria 18097
230 Ga0207667_10015416 3300025949 Bacteria 8685
231 Ga0207667_10418804 3300025949 Unclassified 1363
232 Ga0207667_10707950 3300025949 Bacteria 1009
233 Ga0207712_10005969 3300025961 Bacteria 7682
234 Ga0207640_10298215 3300025981 Bacteria 1274
235 Ga0207658_10000003 3300025986 Bacteria 1151934
236 Ga0207658_10015037 3300025986 Bacteria 5306
237 Ga0207677_10930899 3300026023 Unclassified 785
238 Ga0207702_10000079 3300026078 Bacteria 110210
239 Ga0207702_10001968 3300026078 Bacteria 19973
240 Ga0207702_10026125 3300026078 Bacteria 4847
241 Ga0207702_10389376 3300026078 Bacteria 1342
242 Ga0207641_10936179 3300026088 Bacteria 861
243 Ga0207674_10051022 3300026116 Bacteria 4223
244 Ga0207674_10074449 3300026116 Bacteria 3407
245 Ga0207674_10153019 3300026116 Bacteria 2263
246 Ga0207674_10486030 3300026116 Unclassified 1193
247 Ga0207674_10980485 3300026116 Unclassified 814
248 Ga0207675_100448407 3300026118 Unclassified 1278
249 Ga0207683_10023437 3300026121 Bacteria 5311
250 Ga0207698_10000001 3300026142 Bacteria 625389
251 Ga0207698_10000820 3300026142 Bacteria 18049
252 Ga0207698_10013289 3300026142 Bacteria 5426
253 Ga0207698_10100487 3300026142 Bacteria 2396
254 Ga0209813_10000492 3300027866 Bacteria 9316
255 Ga0209813_10199237 3300027866 Unclassified 740
256 Ga0268266_10761769 3300028379 Unclassified 934
257 Ga0268264_10004228 3300028381 Bacteria 12257
258 Ga0265319_1062597 3300028563 Bacteria 1205
259 Ga0265334_10012087 3300028573 Bacteria 3628
260 Ga0265334_10150191 3300028573 Bacteria 822
261 Ga0265318_10072980 3300028577 Unclassified 1271
262 Ga0265322_10002967 3300028654 Bacteria 5167
263 Ga0265338_10000268 3300028800 Bacteria 95143
264 Ga0265338_10001797 3300028800 Bacteria 33738
265 Ga0265338_10006376 3300028800 Bacteria 15057
266 Ga0265338_10043034 3300028800 Unclassified 4195
267 Ga0265338_10063294 3300028800 Bacteria 3226
268 Ga0265338_10161152 3300028800 Bacteria 1732
269 Ga0265338_10266925 3300028800 Bacteria 1256
270 Ga0265324_10015610 3300029957 Bacteria 2789
271 Ga0314311_1002612 3300030733 Unclassified 1306
272 Ga0316179_1056598 3300030734 Bacteria 39107
273 Ga0316180_1008004 3300030736 Bacteria 4429
274 Ga0316183_1065354 3300030742 Bacteria 25518
275 Ga0316183_1102601 3300030742 Bacteria 6583
276 Ga0316183_1172979 3300030742 Bacteria 6723
277 Ga0316181_1123581 3300030744 Bacteria 76132
278 Ga0316181_1158685 3300030744 Bacteria 1721
279 Ga0316182_1014140 3300030745 Bacteria 16354
280 Ga0316182_1032588 3300030745 Bacteria 3634
281 Ga0316182_1088046 3300030745 Bacteria 1758
282 Ga0316182_1149236 3300030745 Bacteria 905
283 Ga0316182_1188782 3300030745 Bacteria 15742
284 Ga0265320_10003120 3300031240 Bacteria 11250
285 Ga0265325_10029613 3300031241 Bacteria 2941
286 Ga0265340_10062474 3300031247 Bacteria 1779
287 Ga0265339_10043579 3300031249 Unclassified 2480
288 Ga0265327_10000260 3300031251 Bacteria 104663
289 Ga0265327_10059694 3300031251 Bacteria 1952
290 Ga0265327_10167225 3300031251 Unclassified 1012
291 Ga0265316_10441927 3300031344 Unclassified 933
292 Ga0307509_10059742 3300031507 Bacteria 4033
293 Ga0307516_10037585 3300031730 Bacteria 4838
294 Ga0307516_10372819 3300031730 Bacteria 1090
295 Ga0307405_10060733 3300031731 Unclassified 2386
296 Ga0307406_10000001 3300031901 Bacteria 638191
297 Ga0307406_10001261 3300031901 Bacteria 14175
298 Ga0307412_10111240 3300031911 Unclassified 1956
299 Ga0373959_0000080 3300034820 Bacteria 21114
300 Ga0395899_0047068 3300037312 Bacteria 3211
301 Ga0395900_0009510 3300037418 Bacteria 9967
302 Ga0395900_0016132 3300037418 Bacteria 7609
303 Ga0395900_0051070 3300037418 Bacteria 4259
304 Ga0395900_0121346 3300037418 Bacteria 2681
305 Ga0395900_0231673 3300037418 Bacteria 1857
306 Ga0395898_0023510 3300037466 Bacteria 6226
307 Ga0395898_0084532 3300037466 Bacteria 3059
308 Ga0395898_0088014 3300037466 Unclassified 2991
309 Ga0395905_0050956 3300037471 Bacteria 3877
310 Ga0395905_0284093 3300037471 Unclassified 1541
311 Ga0395901_0004063 3300038443 Bacteria 14738
312 Ga0395901_0016381 3300038443 Bacteria 7547
313 Ga0395901_0157687 3300038443 Unclassified 2383
314 Ga0395901_1235742 3300038443 Unclassified 711
315 Ga0439447_005581 3300041407 Bacteria 4166
316 Ga0439466_0020707 3300041411 Bacteria 2342
317 Ga0439431_0006269 3300041997 Bacteria 2626
318 Ga0439431_0028749 3300041997 Bacteria 1370
319 Ga0439445_0003506 3300042004 Bacteria 3521
320 Ga0439432_000342 3300042006 Bacteria 16999
321 Ga0450920_002185 3300042122 Bacteria 3309
322 Ga0450906_000764 3300042145 Bacteria 6997
323 Ga0439446_0000002 3300042156 Bacteria 177065
324 Ga0439446_0024084 3300042156 Unclassified 1735
325 Ga0439434_0000935 3300042435 Bacteria 8411
326 Ga0439464_0045836 3300042439 Bacteria 1256
327 Ga0466965_0002723 3300044683 Bacteria 7575
328 Ga0466963_0082876 3300044694 Bacteria 2175
329 Ga0453684_0802059 3300044712 Unclassified 1015
330 Ga0453684_0808789 3300044712 Bacteria 1010
331 Ga0466970_0032787 3300044765 Bacteria 2745
332 Ga0466970_0219438 3300044765 Unclassified 1061
333 Ga0451576_0088196 3300045051 Bacteria 3227
334 Ga0451576_0349133 3300045051 Bacteria 1549
335 Ga0466967_0554269 3300045976 Bacteria 1131
336 Ga0495638_0000119 3300046460 Bacteria 127603
337 Ga0495638_0000256 3300046460 Bacteria 71804
338 Ga0495583_0021506 3300046506 Unclassified 3317
339 Ga0495587_0250263 3300046536 Unclassified 996
340 Ga0495609_0132008 3300046538 Unclassified 1069
341 Ga0495597_0008521 3300046542 Bacteria 5133
342 Ga0495622_0000231 3300046557 Bacteria 43928
343 Ga0495588_0000594 3300046674 Bacteria 17175
344 Ga0495658_0001166 3300046683 Bacteria 13871
345 Ga0495671_0174319 3300046692 Bacteria 1045
346 Ga0495600_0003400 3300046809 Bacteria 9369
347 Ga0495660_0000114 3300046810 Bacteria 86218
348 Ga0495660_0009713 3300046810 Bacteria 5606
349 Ga0495672_0000284 3300047320 Bacteria 70468
350 Ga0495672_0048276 3300047320 Bacteria 2525
351 Ga0496100_0444601 3300048903 Unclassified 993
352 Ga0496115_0000001 3300048918 Bacteria 367230
353 Ga0501034_0000187 3300049571 Bacteria 116046
354 Ga0501034_0001207 3300049571 Bacteria 35479
355 Ga0501034_0089672 3300049571 Bacteria 3073
356 Ga0501037_0000001 3300049573 Bacteria 753276
357 Ga0501037_0309086 3300049573 Unclassified 1096
358 Ga0501073_0787334 3300049589 Unclassified 656
359 Ga0501080_0000007 3300049742 Bacteria 135749
360 Ga0501083_0235397 3300049744 Unclassified 1192
361 Ga0501044_0394083 3300049823 Bacteria 1298
362 nmdc:mga03683_4298_c1 3300050489 Bacteria 4706
363 nmdc:mga03n38_110106_c1 3300050490 Bacteria 1340
364 nmdc:mga00v17_12587_c1 3300050491 Bacteria 4671
365 nmdc:mga00v17_1326_c1 3300050491 Bacteria 12961
366 nmdc:mga00v17_136982_c1 3300050491 Bacteria 1568
367 nmdc:mga00v17_235739_c1 3300050491 Bacteria 1186
368 nmdc:mga00v17_301_c1 3300050491 Bacteria 28737
369 nmdc:mga00v17_3682_c1 3300050491 Bacteria 7918
370 nmdc:mga00v17_6979_c1 3300050491 Bacteria 6009
371 nmdc:mga00v17_9270_c1 3300050491 Bacteria 5321
372 nmdc:mga00v17_9643_c1 3300050491 Bacteria 2568
373 nmdc:mga0yw44_103269_c1 3300050492 Bacteria 1818
374 nmdc:mga0yw44_114_c1 3300050492 Bacteria 28261
375 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
376 nmdc:mga0yw44_180600_c1 3300050492 Bacteria 1389
377 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
378 nmdc:mga0yw44_5740_c1 3300050492 Bacteria 5914
379 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
380 nmdc:mga0yw44_619814_c1 3300050492 Unclassified 735
381 nmdc:mga0yw44_6867_c1 3300050492 Bacteria 5540
382 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
383 nmdc:mga0yw44_94354_c1 3300050492 Bacteria 1896
384 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
385 nmdc:mga0k408_204018_c1 3300050493 Bacteria 1180
386 nmdc:mga0k408_27102_c1 3300050493 Bacteria 3252
387 nmdc:mga0k408_4338_c1 3300050493 Bacteria 7533
388 nmdc:mga0k408_54_c1 3300050493 Bacteria 57640
389 nmdc:mga0k408_691_c1 3300050493 Bacteria 15167
390 nmdc:mga06z11_131901_c1 3300050494 Bacteria 1404
391 nmdc:mga06z11_2968_c1 3300050494 Bacteria 6535
392 nmdc:mga04h51_12588_c1 3300050495 Bacteria 2378
393 nmdc:mga04h51_228573_c1 3300050495 Unclassified 739
394 nmdc:mga07m45_219151_c1 3300050496 Bacteria 1107
395 nmdc:mga07m45_25242_c2 3300050496 Bacteria 2654
396 nmdc:mga07m45_254352_c1 3300050496 Unclassified 1022
397 nmdc:mga07m45_3028_c1 3300050496 Bacteria 8017
398 nmdc:mga07m45_37210_c1 3300050496 Bacteria 2714
399 nmdc:mga07m45_3765_c1 3300050496 Bacteria 7337
400 nmdc:mga0sz30_10_c2 3300050516 Bacteria 32861
401 nmdc:mga0sz30_145736_c1 3300050516 Unclassified 1046
402 nmdc:mga0sz30_28338_c1 3300050516 Bacteria 1429
403 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
404 nmdc:mga0sz30_301571_c1 3300050516 Bacteria 714
405 nmdc:mga0sz30_5229_c1 3300050516 Bacteria 4749
406 Ga0500643_000061 3300053087 Bacteria 127538
407 Ga0500643_000157 3300053087 Bacteria 68258
408 Ga0500643_002224 3300053087 Bacteria 10249
409 Ga0500643_002762 3300053087 Bacteria 8787
410 Ga0500644_0001390 3300053088 Bacteria 6453
411 Ga0500644_0010070 3300053088 Unclassified 2549
412 Ga0500646_0000010 3300053090 Bacteria 91525
413 Ga0500646_0022151 3300053090 Bacteria 1698
414 Ga0500583_0000199 3300053092 Bacteria 22979
415 Ga0500583_0008417 3300053092 Bacteria 3701
416 Ga0500583_0312728 3300053092 Bacteria 767
417 Ga0500651_0000043 3300053093 Bacteria 86502
418 Ga0500651_0000319 3300053093 Bacteria 27588
419 Ga0500651_0440938 3300053093 Bacteria 726
420 Ga0500566_0000001 3300053094 Bacteria 1101031
421 Ga0500641_0000001 3300053096 Bacteria 1115973
422 Ga0500650_0001096 3300053098 Bacteria 7820
423 Ga0500555_000001 3300053103 Bacteria 1353713
424 Ga0500555_000002 3300053103 Bacteria 1314346
425 Ga0500555_000045 3300053103 Bacteria 63148
426 Ga0500562_000001 3300053108 Bacteria 1178987
427 Ga0500562_000002 3300053108 Bacteria 977234
428 Ga0500569_000002 3300053109 Bacteria 127605
429 Ga0500593_000001 3300053117 Bacteria 784404
430 Ga0500594_0000019 3300053118 Bacteria 56688
431 Ga0500594_0000028 3300053118 Bacteria 50845
432 Ga0500614_000001 3300053123 Bacteria 1274484
433 Ga0500628_000005 3300053129 Bacteria 201423
434 Ga0500652_000001 3300053131 Bacteria 946868
435 Ga0500652_000012 3300053131 Bacteria 155076
436 Ga0500652_055206 3300053131 Bacteria 1627
437 Ga0500655_001360 3300053133 Bacteria 4626
438 Ga0500559_0010084 3300053136 Bacteria 4066
439 Ga0500561_0000002 3300053137 Bacteria 394147
440 Ga0500568_0006413 3300053139 Bacteria 5905
441 Ga0500568_0014578 3300053139 Bacteria 3545
442 Ga0500577_0000143 3300053142 Bacteria 17463
443 Ga0500577_0014452 3300053142 Unclassified 2441
444 Ga0500577_0027143 3300053142 Bacteria 1957
445 Ga0500577_0100037 3300053142 Bacteria 1184
446 Ga0500588_0001636 3300053146 Bacteria 4329
447 Ga0500589_021455 3300053147 Bacteria 2960
448 Ga0500616_0000005 3300053153 Bacteria 961725
449 Ga0500616_0000067 3300053153 Bacteria 236311
450 Ga0500616_0024645 3300053153 Bacteria 3341
451 Ga0500620_015172 3300053155 Bacteria 2172
452 Ga0500649_000006 3300053722 Bacteria 116211
453 Ga0500570_000001 3300053724 Bacteria 243552
454 Ga0500570_027611 3300053724 Bacteria 3099
455 Ga0500570_033704 3300053724 Bacteria 2746
456 Ga0500611_001283 3300053727 Bacteria 2718
457 Ga0500611_018595 3300053727 Bacteria 1284
458 Ga0500613_000093 3300053738 Bacteria 3984
459 Ga0500644_0014536
460 MBSR1b_contig_5452016
461 JGI24741J21665_1003818
462 JGI24740J21852_10002100
463 JGI24740J21852_10046072
464 JGI24740J21852_10073404
465 JGI24737J22298_10000346
466 JGI24735J21928_10000055
467 rootH2_10004334
468 rootH2_10256068
469 rootL2_10034609
470 rootL2_10345480
471 rootH1_10001727
472 Ga0070658_10034525
473 Ga0070676_10000131
474 Ga0070676_10067529
475 Ga0070683_100000239
476 Ga0070683_100000380
477 Ga0070683_100313539
478 Ga0070683_101312503
479 Ga0070670_100049074
480 Ga0070680_100108507
481 Ga0070680_100181560
482 Ga0070680_100345830
483 Ga0068868_100475767
484 Ga0068868_100966569
485 Ga0070660_100000158
486 Ga0070660_100000226
487 Ga0070671_100000001
488 Ga0070659_100097380
489 Ga0070659_100770645
490 Ga0070667_100000503
491 Ga0070708_100592283
492 Ga0070678_100058574
493 Ga0070681_10060128
494 Ga0070681_10126730
495 Ga0070681_10258094
496 Ga0070681_10593901
497 Ga0070679_100004467
498 Ga0070679_100006731
499 Ga0070679_100207570
500 Ga0070679_100214688
501 Ga0070679_100219344
502 Ga0070679_100341741
503 Ga0070684_100000280
504 Ga0070684_100003029
505 Ga0070684_100013425
506 Ga0070684_101322644
507 Ga0070665_100917412
508 Ga0068855_100000002
509 Ga0068855_100001316
510 Ga0068855_101008636
511 Ga0070664_100672032
512 Ga0068857_100144434
513 Ga0068857_100308730
514 Ga0068857_100363740
515 Ga0068854_100326239
516 Ga0068856_100000441
517 Ga0068856_100002238
518 Ga0068856_100171882
519 Ga0068856_100418879
520 Ga0068852_100000001
521 Ga0068852_100000621
522 Ga0068852_100066076
523 Ga0068852_100114707
524 Ga0068861_100430638
525 Ga0068863_100180954
526 Ga0068858_101034077
527 Ga0068860_100005087
528 Ga0068860_100066863
529 Ga0081455_10000006
530 Ga0081455_10000020
531 Ga0075365_10000005
532 Ga0075365_10000011
533 Ga0075365_10005061
534 Ga0075365_10008982
535 Ga0075365_10025194
536 Ga0075365_10128664
537 Ga0075365_10207579
538 Ga0075365_10487839
539 Ga0075368_10000090
540 Ga0075364_10001478
541 Ga0075364_10001839
542 Ga0075364_10007360
543 Ga0075364_10010415
544 Ga0075364_10023820
545 Ga0075364_10029326
546 Ga0075364_10056654
547 Ga0075364_10083827
548 Ga0075364_10696600
549 Ga0075362_10005308
550 Ga0075362_10093053
551 Ga0075367_10041094
552 Ga0075367_10114601
553 Ga0075367_10282022
554 Ga0075369_10000004
555 Ga0075369_10001191
556 Ga0075369_10003080
557 Ga0075369_10018614
558 Ga0075369_10073140
559 Ga0075366_10000003
560 Ga0075366_10000010
561 Ga0075366_10000015
562 Ga0075366_10060831
563 Ga0075366_10132200
564 Ga0075366_10286945
565 Ga0097621_100000052
566 Ga0097621_100017864
567 Ga0097621_100259736
568 Ga0075370_10025331
569 Ga0075370_10037936
570 Ga0075370_10043984
571 Ga0075370_10054647
572 Ga0075370_10088112
573 Ga0068871_100000006
574 Ga0068871_100108691
575 Ga0075428_100004205
576 Ga0105240_10000030
577 Ga0105240_10000761
578 Ga0105240_10000886
579 Ga0105240_10000909
580 Ga0105240_10061743
581 Ga0105240_10117185
582 Ga0105240_10408078
583 Ga0105240_10480195
584 Ga0105245_10000096
585 Ga0105245_10055122
586 Ga0105245_10378080
587 Ga0105247_10098549
588 Ga0105241_10014306
589 Ga0105241_10027475
590 Ga0105241_10183738
591 Ga0105248_10030208
592 Ga0105248_10236727
593 Ga0105237_10000001
594 Ga0105237_10000159
595 Ga0105238_10000480
596 Ga0105238_10024039
597 Ga0105249_10062105
598 Ga0105032_100009
599 Ga0105032_100012
600 Ga0105032_101092
601 Ga0105032_108125
602 Ga0105029_101151
603 Ga0105029_104786
604 Ga0105033_100211
605 Ga0105028_100381
606 Ga0105028_100650
607 Ga0105028_103669
608 Ga0105028_104590
609 Ga0105028_120103
610 Ga0105239_10076298
611 Ga0105239_10396144
612 Ga0105246_10000177
613 Ga0105246_10008863
614 Ga0157373_10000092
615 Ga0157373_10009954
616 Ga0157373_10124690
617 Ga0157371_10050249
618 Ga0157371_10058404
619 Ga0157370_10000232
620 Ga0157370_10001387
621 Ga0157370_10073049
622 Ga0157369_10000826
623 Ga0157369_10001538
624 Ga0157369_10068429
625 Ga0157369_10161422
626 Ga0157369_10230604
627 Ga0157369_10385922
628 Ga0157374_10000014
629 Ga0157374_10006886
630 Ga0157378_10519427
631 Ga0157378_10852738
632 Ga0157372_10000007
633 Ga0157372_10000509
634 Ga0157372_10037735
635 Ga0157372_10042702
636 Ga0157372_10163592
637 Ga0157372_10797752
638 Ga0157372_10904371
639 Ga0157372_11272499
640 Ga0157376_10000223
641 Ga0207680_10053071
642 Ga0207647_10000087
643 Ga0207645_10014711
644 Ga0207645_10168885
645 Ga0207705_10000019
646 Ga0207705_10010500
647 Ga0207705_10979731
648 Ga0207654_10043496
649 Ga0207707_10058222
650 Ga0207707_11097096
651 Ga0207695_10000009
652 Ga0207695_10002910
653 Ga0207695_10012470
654 Ga0207695_10014974
655 Ga0207695_10046805
656 Ga0207695_10333721
657 Ga0207695_10478136
658 Ga0207671_10000003
659 Ga0207671_10000008
660 Ga0207660_10109391
661 Ga0207660_10200943
662 Ga0207657_10000226
663 Ga0207657_10000547
664 Ga0207657_10028548
665 Ga0207652_10002428
666 Ga0207652_10007281
667 Ga0207652_10011441
668 Ga0207652_10131974
669 Ga0207652_10159167
670 Ga0207681_10202398
671 Ga0207694_10000785
672 Ga0207694_10036569
673 Ga0207650_10018353
674 Ga0207650_10190464
675 Ga0207687_10000008
676 Ga0207687_10067931
677 Ga0207687_10146123
678 Ga0207644_10000001
679 Ga0207690_11014980
680 Ga0207711_10026148
681 Ga0207661_10001467
682 Ga0207661_10002072
683 Ga0207661_10453416
684 Ga0207679_10465567
685 Ga0207667_10000005
686 Ga0207667_10000048
687 Ga0207667_10004009
688 Ga0207667_10015416
689 Ga0207667_10418804
690 Ga0207667_10707950
691 Ga0207712_10005969
692 Ga0207640_10298215
693 Ga0207658_10000003
694 Ga0207658_10015037
695 Ga0207677_10930899
696 Ga0207702_10000079
697 Ga0207702_10001968
698 Ga0207702_10026125
699 Ga0207702_10389376
700 Ga0207641_10936179
701 Ga0207674_10051022
702 Ga0207674_10074449
703 Ga0207674_10153019
704 Ga0207674_10486030
705 Ga0207674_10980485
706 Ga0207675_100448407
707 Ga0207683_10023437
708 Ga0207698_10000001
709 Ga0207698_10000820
710 Ga0207698_10013289
711 Ga0207698_10100487
712 Ga0209813_10000492
713 Ga0209813_10199237
714 Ga0268266_10761769
715 Ga0268264_10004228
716 Ga0265319_1062597
717 Ga0265334_10012087
718 Ga0265334_10150191
719 Ga0265318_10072980
720 Ga0265322_10002967
721 Ga0265338_10000268
722 Ga0265338_10001797
723 Ga0265338_10006376
724 Ga0265338_10043034
725 Ga0265338_10063294
726 Ga0265338_10161152
727 Ga0265338_10266925
728 Ga0265324_10015610
729 Ga0314311_1002612
730 Ga0316179_1056598
731 Ga0316180_1008004
732 Ga0316183_1065354
733 Ga0316183_1102601
734 Ga0316183_1172979
735 Ga0316181_1123581
736 Ga0316181_1158685
737 Ga0316182_1014140
738 Ga0316182_1032588
739 Ga0316182_1088046
740 Ga0316182_1149236
741 Ga0316182_1188782
742 Ga0265320_10003120
743 Ga0265325_10029613
744 Ga0265340_10062474
745 Ga0265339_10043579
746 Ga0265327_10000260
747 Ga0265327_10059694
748 Ga0265327_10167225
749 Ga0265316_10441927
750 Ga0307509_10059742
751 Ga0307516_10037585
752 Ga0307516_10372819
753 Ga0307405_10060733
754 Ga0307406_10000001
755 Ga0307406_10001261
756 Ga0307412_10111240
757 Ga0373959_0000080
758 Ga0395899_0047068
759 Ga0395900_0009510
760 Ga0395900_0016132
761 Ga0395900_0051070
762 Ga0395900_0121346
763 Ga0395900_0231673
764 Ga0395898_0023510
765 Ga0395898_0084532
766 Ga0395898_0088014
767 Ga0395905_0050956
768 Ga0395905_0284093
769 Ga0395901_0004063
770 Ga0395901_0016381
771 Ga0395901_0157687
772 Ga0395901_1235742
773 Ga0439447_005581
774 Ga0439466_0020707
775 Ga0439431_0006269
776 Ga0439431_0028749
777 Ga0439445_0003506
778 Ga0439432_000342
779 Ga0450920_002185
780 Ga0450906_000764
781 Ga0439446_0000002
782 Ga0439446_0024084
783 Ga0439434_0000935
784 Ga0439464_0045836
785 Ga0466965_0002723
786 Ga0466963_0082876
787 Ga0453684_0802059
788 Ga0453684_0808789
789 Ga0466970_0032787
790 Ga0466970_0219438
791 Ga0451576_0088196
792 Ga0451576_0349133
793 Ga0466967_0554269
794 Ga0495638_0000119
795 Ga0495638_0000256
796 Ga0495583_0021506
797 Ga0495587_0250263
798 Ga0495609_0132008
799 Ga0495597_0008521
800 Ga0495622_0000231
801 Ga0495588_0000594
802 Ga0495658_0001166
803 Ga0495671_0174319
804 Ga0495600_0003400
805 Ga0495660_0000114
806 Ga0495660_0009713
807 Ga0495672_0000284
808 Ga0495672_0048276
809 Ga0496100_0444601
810 Ga0496115_0000001
811 Ga0501034_0000187
812 Ga0501034_0001207
813 Ga0501034_0089672
814 Ga0501037_0000001
815 Ga0501037_0309086
816 Ga0501073_0787334
817 Ga0501080_0000007
818 Ga0501083_0235397
819 Ga0501044_0394083
820 nmdc:mga03683_4298_c1
821 nmdc:mga03n38_110106_c1
822 nmdc:mga00v17_12587_c1
823 nmdc:mga00v17_1326_c1
824 nmdc:mga00v17_136982_c1
825 nmdc:mga00v17_235739_c1
826 nmdc:mga00v17_301_c1
827 nmdc:mga00v17_3682_c1
828 nmdc:mga00v17_6979_c1
829 nmdc:mga00v17_9270_c1
830 nmdc:mga00v17_9643_c1
831 nmdc:mga0yw44_103269_c1
832 nmdc:mga0yw44_114_c1
833 nmdc:mga0yw44_11_c1
834 nmdc:mga0yw44_180600_c1
835 nmdc:mga0yw44_3_c1
836 nmdc:mga0yw44_5740_c1
837 nmdc:mga0yw44_5_c1
838 nmdc:mga0yw44_619814_c1
839 nmdc:mga0yw44_6867_c1
840 nmdc:mga0yw44_7_c1
841 nmdc:mga0yw44_94354_c1
842 nmdc:mga0k408_1_c1
843 nmdc:mga0k408_204018_c1
844 nmdc:mga0k408_27102_c1
845 nmdc:mga0k408_4338_c1
846 nmdc:mga0k408_54_c1
847 nmdc:mga0k408_691_c1
848 nmdc:mga06z11_131901_c1
849 nmdc:mga06z11_2968_c1
850 nmdc:mga04h51_12588_c1
851 nmdc:mga04h51_228573_c1
852 nmdc:mga07m45_219151_c1
853 nmdc:mga07m45_25242_c2
854 nmdc:mga07m45_254352_c1
855 nmdc:mga07m45_3028_c1
856 nmdc:mga07m45_37210_c1
857 nmdc:mga07m45_3765_c1
858 nmdc:mga0sz30_10_c2
859 nmdc:mga0sz30_145736_c1
860 nmdc:mga0sz30_28338_c1
861 nmdc:mga0sz30_2_c1
862 nmdc:mga0sz30_301571_c1
863 nmdc:mga0sz30_5229_c1
864 Ga0500643_000061
865 Ga0500643_000157
866 Ga0500643_002224
867 Ga0500643_002762
868 Ga0500644_0001390
869 Ga0500644_0010070
870 Ga0500646_0000010
871 Ga0500646_0022151
872 Ga0500583_0000199
873 Ga0500583_0008417
874 Ga0500583_0312728
875 Ga0500651_0000043
876 Ga0500651_0000319
877 Ga0500651_0440938
878 Ga0500566_0000001
879 Ga0500641_0000001
880 Ga0500650_0001096
881 Ga0500555_000001
882 Ga0500555_000002
883 Ga0500555_000045
884 Ga0500562_000001
885 Ga0500562_000002
886 Ga0500569_000002
887 Ga0500593_000001
888 Ga0500594_0000019
889 Ga0500594_0000028
890 Ga0500614_000001
891 Ga0500628_000005
892 Ga0500652_000001
893 Ga0500652_000012
894 Ga0500652_055206
895 Ga0500655_001360
896 Ga0500559_0010084
897 Ga0500561_0000002
898 Ga0500568_0006413
899 Ga0500568_0014578
900 Ga0500577_0000143
901 Ga0500577_0014452
902 Ga0500577_0027143
903 Ga0500577_0100037
904 Ga0500588_0001636
905 Ga0500589_021455
906 Ga0500616_0000005
907 Ga0500616_0000067
908 Ga0500616_0024645
909 Ga0500620_015172
910 Ga0500649_000006
911 Ga0500570_000001
912 Ga0500570_027611
913 Ga0500570_033704
914 Ga0500611_001283
915 Ga0500611_018595
916 Ga0500613_000093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

172

226

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

110

163

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

45

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8543 4 66
6s8z-assembly1.cif.gz_A elongation factor p from corynebacterium glutamicum 0.8153 4 189
6s8z-assembly1.cif.gz_A elongation factor p from corynebacterium glutamicum 0.8113 4 189
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8093 4 66
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.7998 4 60
ID Description Score Start End Superfamily
af_I1L709_180_237_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9636 131 187 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9458 131 187 2.40.50.140
1ybyB03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9346 131 187 2.40.50.140
af_I1L709_180_237_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9319 131 187 2.40.50.140
af_P0A6N8_132_190_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.928 131 188 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2W4I513-F1-model_v4 Elongation factor P (EF-P) 0.9428 4 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A1F4XLJ2-F1-model_v4 Elongation factor P (EF-P) 0.9418 4 189 GO:0003746
GO:0005737
GO:0043043
AF-A0A0G1JVK9-F1-model_v4 Elongation factor P (EF-P) 0.9369 4 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A1F4VJN1-F1-model_v4 Elongation factor P (EF-P) 0.9365 4 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A2W4I513-F1-model_v4 Elongation factor P (EF-P) 0.9331 4 188 GO:0003746
GO:0005737
GO:0043043

Map