F448280

General Info

Members Datasets Scaffolds Average Seq Length
458 365 916 219

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582581316|2585333631
Length 266
Sequence DSVARFKSQLVTSAARTLDSVFEFLEDDVGAAASQTSFAHDPRSTEDIMRKVIAATFISLDGVIQAPGGPQEDPTGGFEHGGWTFHYFDEATGKALFAIFDKPFDLLLGRKTYDIFAAHWPHAGDDDPIAKQFNRVTKYVATRGNRKLDWNNSQSLGSDVVAGIRELKAGEGPNLLIQGSSDLIQTLLRNGLIDEFNLLIFPLVLGGGKKLFGDGAMPAAMKLLRTQSSPTGVIMATYQPDGPVKTGSFALPDPSDEEIDRRNRLK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
109 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
248 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
249 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
250 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
254 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
255 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
256 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
257 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
258 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
259 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
278 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
279 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
287 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
289 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
290 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
291 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
292 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
293 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
294 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
295 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
296 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
297 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
298 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
299 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
300 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
301 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
302 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
303 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
304 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
305 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
306 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
307 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
308 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
309 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
310 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
311 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
312 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
313 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
314 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
315 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
316 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
317 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
318 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
319 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
320 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
321 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
322 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
323 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
324 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
325 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
326 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
327 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
328 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
329 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
330 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
331 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
332 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
333 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
334 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
335 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
336 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
337 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
338 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
339 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
340 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
341 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
342 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
343 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
344 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
345 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
346 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
347 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
348 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
349 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
350 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
351 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
352 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
353 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
354 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
355 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
356 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
357 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
358 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
359 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
360 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
361 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
362 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
363 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
364 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
365 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.97
Metatranscriptomes 0
Isolates 17.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 11.57
Rhizoplane 1.97
Rhizosphere 68.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002553 3300001979 Bacteria 8212
2 JGI25155J39150_1000011 3300002704 Bacteria 207685
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25162J39368_1001401 3300002737 Bacteria 13172
5 JGI25162J39368_1001515 3300002737 Bacteria 12058
6 JGI25154J39366_1000289 3300002738 Bacteria 30213
7 JGI25157J39369_1000010 3300002741 Bacteria 207685
8 JGI25159J45721_1007706 3300002987 Bacteria 3051
9 JGI25165J46597_1001229 3300003214 Bacteria 15248
10 JGI25165J46597_1004859 3300003214 Bacteria 2734
11 rootH1_10105689 3300003316 Bacteria 3620
12 rootH2_10001490 3300003320 Bacteria 9345
13 rootL2_10075208 3300003322 Bacteria 17065
14 rootH1_10006224 3300003323 Bacteria 10205
15 JGI25160J50197_1000004 3300003354 Bacteria 419797
16 JGI25161J50226_1000003 3300003374 Bacteria 413345
17 Ga0055543_1000001 3300004625 Bacteria 419949
18 Ga0065165_1001508 3300005262 Bacteria 24628
19 Ga0065712_10080891 3300005290 Bacteria 3060
20 Ga0065715_10173728 3300005293 Bacteria 1528
21 Ga0070676_10014118 3300005328 Bacteria 4386
22 Ga0070690_100009348 3300005330 Bacteria 5677
23 Ga0068869_100001572 3300005334 Bacteria 13583
24 Ga0068869_100235695 3300005334 Bacteria 1456
25 Ga0070666_10087456 3300005335 Bacteria 2136
26 Ga0070680_100000978 3300005336 Bacteria 20273
27 Ga0068868_100000036 3300005338 Bacteria 74490
28 Ga0068868_100013619 3300005338 Bacteria 5971
29 Ga0070689_100000194 3300005340 Bacteria 37040
30 Ga0070687_100003801 3300005343 Bacteria 5927
31 Ga0070661_100001270 3300005344 Bacteria 17731
32 Ga0070692_10055450 3300005345 Bacteria 2072
33 Ga0070669_100002925 3300005353 Bacteria 12302
34 Ga0070675_100000517 3300005354 Bacteria 26306
35 Ga0070675_100008116 3300005354 Bacteria 8140
36 Ga0070671_100013385 3300005355 Bacteria 6613
37 Ga0070674_100514148 3300005356 Bacteria 999
38 Ga0070673_100010045 3300005364 Bacteria 6387
39 Ga0070688_100000635 3300005365 Bacteria 17475
40 Ga0070659_100000025 3300005366 Bacteria 144955
41 Ga0070667_100215632 3300005367 Bacteria 1707
42 Ga0070709_10277111 3300005434 Bacteria 1217
43 Ga0070714_100031652 3300005435 Bacteria 4415
44 Ga0070713_100009452 3300005436 Bacteria 6982
45 Ga0070710_10035956 3300005437 Bacteria 2704
46 Ga0070701_10036456 3300005438 Bacteria 2478
47 Ga0070708_100587921 3300005445 Bacteria 1049
48 Ga0070662_100082560 3300005457 Bacteria 2397
49 Ga0070662_100164999 3300005457 Bacteria 1735
50 Ga0070681_10008557 3300005458 Bacteria 10024
51 Ga0070685_10006204 3300005466 Bacteria 6086
52 Ga0070706_100058938 3300005467 Bacteria 3543
53 Ga0070707_100015169 3300005468 Bacteria 7233
54 Ga0070698_100452570 3300005471 Bacteria 1219
55 Ga0070699_100294083 3300005518 Bacteria 1456
56 Ga0070679_100010187 3300005530 Bacteria 8909
57 Ga0070679_100211417 3300005530 Bacteria 1904
58 Ga0070684_100007975 3300005535 Bacteria 8266
59 Ga0070672_100010341 3300005543 Bacteria 6471
60 Ga0070686_100002576 3300005544 Bacteria 9999
61 Ga0070696_100579585 3300005546 Bacteria 902
62 Ga0070665_100053253 3300005548 Bacteria 4058
63 Ga0070665_100690150 3300005548 Bacteria 1034
64 Ga0068855_100125276 3300005563 Bacteria 2938
65 Ga0070664_100000173 3300005564 Bacteria 45248
66 Ga0068857_100027285 3300005577 Bacteria 5036
67 Ga0068854_100098202 3300005578 Bacteria 2191
68 Ga0068856_100070180 3300005614 Bacteria 3465
69 Ga0068856_100144007 3300005614 Bacteria 2391
70 Ga0070702_100011978 3300005615 Bacteria 4329
71 Ga0068859_100002708 3300005617 Bacteria 17978
72 Ga0068864_100000829 3300005618 Bacteria 26078
73 Ga0068864_100846123 3300005618 Bacteria 901
74 Ga0068861_100001405 3300005719 Bacteria 15143
75 Ga0068861_100006525 3300005719 Bacteria 7958
76 Ga0068870_10050717 3300005840 Bacteria 2194
77 Ga0068863_100004115 3300005841 Bacteria 14374
78 Ga0068858_100031834 3300005842 Bacteria 4902
79 Ga0068860_100026455 3300005843 Bacteria 5593
80 Ga0068862_100001554 3300005844 Bacteria 20983
81 Ga0068862_100003156 3300005844 Bacteria 14322
82 Ga0081538_10003863 3300005981 Bacteria 13989
83 Ga0081538_10006679 3300005981 Bacteria 10107
84 Ga0081540_1038002 3300005983 Bacteria 2544
85 Ga0081539_10011340 3300005985 Bacteria 7066
86 Ga0075365_10109918 3300006038 Bacteria 1894
87 Ga0070716_100593532 3300006173 Bacteria 832
88 Ga0070712_100019369 3300006175 Bacteria 4438
89 Ga0075369_10106207 3300006186 Bacteria 1263
90 Ga0075427_10019608 3300006194 Bacteria 1067
91 Ga0075366_10094065 3300006195 Bacteria 1796
92 Ga0068871_100099029 3300006358 Bacteria 2440
93 Ga0075428_100003456 3300006844 Bacteria 17283
94 Ga0075428_100017618 3300006844 Bacteria 7890
95 Ga0075428_100139720 3300006844 Bacteria 2633
96 Ga0075430_100001023 3300006846 Bacteria 22134
97 Ga0075430_100001510 3300006846 Bacteria 18988
98 Ga0075430_100243630 3300006846 Bacteria 1490
99 Ga0075431_100000690 3300006847 Bacteria 29038
100 Ga0075431_100001463 3300006847 Bacteria 21778
101 Ga0075431_100220561 3300006847 Bacteria 1934
102 Ga0075434_100211293 3300006871 Bacteria 1960
103 Ga0075429_100001468 3300006880 Bacteria 19384
104 Ga0068865_100010229 3300006881 Bacteria 5833
105 Ga0097620_100002708 3300006931 Bacteria 17978
106 Ga0105240_10000005 3300009093 Bacteria 702630
107 Ga0105240_10035922 3300009093 Bacteria 6380
108 Ga0105240_10075688 3300009093 Bacteria 4151
109 Ga0111539_10022489 3300009094 Bacteria 7746
110 Ga0111539_10027306 3300009094 Bacteria 6971
111 Ga0111539_10039175 3300009094 Bacteria 5713
112 Ga0111539_10910500 3300009094 Bacteria 1023
113 Ga0105245_10018593 3300009098 Bacteria 6078
114 Ga0105245_10020493 3300009098 Bacteria 5799
115 Ga0105245_10059129 3300009098 Bacteria 3451
116 Ga0114129_10001484 3300009147 Bacteria 31760
117 Ga0114129_10931738 3300009147 Bacteria 1098
118 Ga0114129_11316356 3300009147 Bacteria 895
119 Ga0105243_10687498 3300009148 Bacteria 996
120 Ga0105248_10003681 3300009177 Bacteria 16984
121 Ga0105237_10000773 3300009545 Bacteria 43739
122 Ga0105237_10284099 3300009545 Bacteria 1657
123 Ga0105238_10314482 3300009551 Bacteria 1551
124 Ga0105249_10007372 3300009553 Bacteria 9594
125 Ga0105239_10014053 3300010375 Bacteria 8887
126 Ga0105239_10049965 3300010375 Bacteria 4586
127 Ga0105239_11159443 3300010375 Bacteria 890
128 Ga0157370_10001070 3300013104 Bacteria 34278
129 Ga0157370_10026380 3300013104 Bacteria 5738
130 Ga0157370_10182989 3300013104 Bacteria 1947
131 Ga0157369_10072192 3300013105 Bacteria 3705
132 Ga0157374_10250153 3300013296 Bacteria 1744
133 Ga0163162_10027016 3300013306 Bacteria 5676
134 Ga0157372_10320094 3300013307 Bacteria 1806
135 Ga0163163_10004763 3300014325 Bacteria 11640
136 Ga0163163_10616078 3300014325 Bacteria 1149
137 Ga0182008_10074860 3300014497 Bacteria 1666
138 Ga0157377_10004716 3300014745 Bacteria 6313
139 Ga0157377_10528628 3300014745 Bacteria 829
140 Ga0182007_10008279 3300015262 Bacteria 4280
141 Ga0182005_1002283 3300015265 Bacteria 7020
142 Ga0163161_10013418 3300017792 Bacteria 5701
143 Ga0209435_100022 3300025206 Bacteria 207766
144 Ga0209436_110482 3300025208 Bacteria 1693
145 Ga0209437_100160 3300025233 Bacteria 149451
146 Ga0209646_1000078 3300025246 Bacteria 207766
147 Ga0209646_1008366 3300025246 Bacteria 1664
148 Ga0209026_1000065 3300025250 Bacteria 207766
149 Ga0209759_1000055 3300025256 Bacteria 207766
150 Ga0209233_1000168 3300025261 Bacteria 149312
151 Ga0209233_1000297 3300025261 Bacteria 61773
152 Ga0209455_1009217 3300025272 Bacteria 2609
153 Ga0209130_1000012 3300025284 Bacteria 421329
154 Ga0207426_1000010 3300025302 Bacteria 796003
155 Ga0207692_10014251 3300025898 Bacteria 3470
156 Ga0207688_10020352 3300025901 Bacteria 3623
157 Ga0207680_10096390 3300025903 Bacteria 1892
158 Ga0207699_10015874 3300025906 Bacteria 3924
159 Ga0207643_10035508 3300025908 Bacteria 2795
160 Ga0207643_10074048 3300025908 Bacteria 1963
161 Ga0207684_10026128 3300025910 Bacteria 4976
162 Ga0207707_10027004 3300025912 Bacteria 5017
163 Ga0207695_10000011 3300025913 Bacteria 910221
164 Ga0207695_10644683 3300025913 Bacteria 940
165 Ga0207671_10001637 3300025914 Bacteria 25476
166 Ga0207693_10075550 3300025915 Bacteria 2638
167 Ga0207660_10096644 3300025917 Bacteria 2199
168 Ga0207662_10006575 3300025918 Bacteria 6275
169 Ga0207649_10010266 3300025920 Bacteria 5141
170 Ga0207652_10017076 3300025921 Bacteria 5936
171 Ga0207652_10256268 3300025921 Bacteria 1578
172 Ga0207646_10019715 3300025922 Bacteria 6260
173 Ga0207681_10003623 3300025923 Bacteria 9604
174 Ga0207694_10365750 3300025924 Bacteria 1196
175 Ga0207650_10036424 3300025925 Bacteria 3580
176 Ga0207650_10897655 3300025925 Bacteria 752
177 Ga0207659_10090989 3300025926 Bacteria 2278
178 Ga0207659_10150176 3300025926 Bacteria 1819
179 Ga0207687_10078687 3300025927 Bacteria 2375
180 Ga0207687_10119062 3300025927 Bacteria 1972
181 Ga0207700_10248996 3300025928 Bacteria 1517
182 Ga0207664_10024085 3300025929 Bacteria 4571
183 Ga0207644_10005288 3300025931 Bacteria 8425
184 Ga0207690_10000005 3300025932 Bacteria 581199
185 Ga0207706_10098626 3300025933 Bacteria 2570
186 Ga0207670_10003717 3300025936 Bacteria 8099
187 Ga0207669_10471080 3300025937 Bacteria 999
188 Ga0207704_10047885 3300025938 Bacteria 2559
189 Ga0207665_10268727 3300025939 Bacteria 1266
190 Ga0207691_10018172 3300025940 Bacteria 6661
191 Ga0207711_10035062 3300025941 Bacteria 4251
192 Ga0207689_10004557 3300025942 Bacteria 12545
193 Ga0207689_10145868 3300025942 Archaea 1950
194 Ga0207661_10375820 3300025944 Bacteria 1286
195 Ga0207679_10004316 3300025945 Bacteria 8843
196 Ga0207712_10009442 3300025961 Bacteria 6173
197 Ga0207668_10006832 3300025972 Bacteria 6765
198 Ga0207640_10496958 3300025981 Bacteria 1015
199 Ga0207658_10148917 3300025986 Bacteria 1904
200 Ga0207658_10834102 3300025986 Bacteria 838
201 Ga0207677_10000044 3300026023 Bacteria 107614
202 Ga0207677_10632458 3300026023 Bacteria 942
203 Ga0207703_10173926 3300026035 Bacteria 1896
204 Ga0207639_10080703 3300026041 Bacteria 2574
205 Ga0207708_10071538 3300026075 Bacteria 2657
206 Ga0207702_10120436 3300026078 Bacteria 2348
207 Ga0207641_10013775 3300026088 Bacteria 6631
208 Ga0207648_10120375 3300026089 Bacteria 2308
209 Ga0207676_10046386 3300026095 Bacteria 3362
210 Ga0207674_10034896 3300026116 Bacteria 5253
211 Ga0207674_10064429 3300026116 Bacteria 3696
212 Ga0207675_100005214 3300026118 Bacteria 12511
213 Ga0207675_100011841 3300026118 Bacteria 8152
214 Ga0207675_100364222 3300026118 Bacteria 1419
215 Ga0207428_10019799 3300027907 Bacteria 5732
216 Ga0207428_10074775 3300027907 Bacteria 2656
217 Ga0207428_10114399 3300027907 Bacteria 2073
218 Ga0268266_10084743 3300028379 Bacteria 2768
219 Ga0268265_10002382 3300028380 Bacteria 14221
220 Ga0268265_10008148 3300028380 Bacteria 7080
221 Ga0268264_10269365 3300028381 Bacteria 1590
222 Ga0307515_10220688 3300028794 Bacteria 1715
223 Ga0265338_10312722 3300028800 Bacteria 1139
224 Ga0265331_10004264 3300031250 Bacteria 8952
225 Ga0307408_100012699 3300031548 Bacteria 5586
226 Ga0307408_100019349 3300031548 Bacteria 4584
227 Ga0307408_100225745 3300031548 Bacteria 1531
228 Ga0307408_100890188 3300031548 Bacteria 814
229 Ga0265313_10000149 3300031595 Bacteria 73203
230 Ga0265314_10083088 3300031711 Bacteria 2106
231 Ga0265342_10060017 3300031712 Bacteria 2244
232 Ga0307405_10050738 3300031731 Bacteria 2571
233 Ga0307405_10293984 3300031731 Bacteria 1229
234 Ga0307405_10912622 3300031731 Bacteria 744
235 Ga0307406_10083279 3300031901 Bacteria 2133
236 Ga0307412_10194763 3300031911 Bacteria 1535
237 Ga0307412_10300560 3300031911 Bacteria 1268
238 Ga0307412_10503868 3300031911 Bacteria 1008
239 Ga0307409_100154280 3300031995 Bacteria 1999
240 Ga0307416_100090247 3300032002 Bacteria 2627
241 Ga0307416_100455977 3300032002 Bacteria 1332
242 Ga0307411_10647252 3300032005 Bacteria 915
243 Ga0307415_100031322 3300032126 Bacteria 3425
244 Ga0307415_100993411 3300032126 Bacteria 780
245 Ga0373958_0012508 3300034819 Bacteria 1453
246 Ga0373953_0006700 3300035117 Bacteria 3813
247 Ga0373943_0061389 3300035170 Bacteria 1879
248 Ga0373955_0017563 3300035172 Bacteria 3544
249 Ga0373955_0029146 3300035172 Bacteria 2868
250 Ga0373931_0017546 3300035691 Bacteria 3544
251 Ga0373927_0061164 3300035695 Bacteria 2437
252 Ga0373933_0004056 3300035724 Bacteria 8073
253 Ga0373933_0122230 3300035724 Bacteria 1631
254 Ga0373937_0004039 3300036401 Bacteria 12429
255 Ga0373937_0009699 3300036401 Bacteria 8391
256 Ga0395899_0107351 3300037312 Bacteria 2009
257 Ga0395900_0104231 3300037418 Bacteria 2914
258 Ga0395898_0317346 3300037466 Bacteria 1487
259 Ga0395898_0649283 3300037466 Bacteria 997
260 Ga0395905_0000386 3300037471 Bacteria 62786
261 Ga0395905_0042368 3300037471 Bacteria 4272
262 Ga0395905_0047392 3300037471 Bacteria 4028
263 Ga0395905_0860525 3300037471 Bacteria 809
264 Ga0395901_0102976 3300038443 Bacteria 2995
265 Ga0395901_0845398 3300038443 Bacteria 901
266 Ga0436361_0188754 3300039447 Bacteria 2310
267 Ga0439442_010319 3300042002 Bacteria 1893
268 Ga0453684_0722808 3300044712 Bacteria 1080
269 Ga0466968_0041937 3300044735 Bacteria 1933
270 Ga0451576_0011354 3300045051 Bacteria 10134
271 Ga0466967_0145652 3300045976 Bacteria 2210
272 Ga0495638_0000163 3300046460 Bacteria 103363
273 Ga0495651_0088167 3300046462 Bacteria 2332
274 Ga0495653_0168337 3300046463 Bacteria 1515
275 Ga0495662_0164500 3300046476 Bacteria 1093
276 Ga0495664_0003721 3300046477 Bacteria 8317
277 Ga0495583_0016919 3300046506 Bacteria 3895
278 Ga0495606_0026761 3300046507 Bacteria 4104
279 Ga0495608_0005604 3300046511 Bacteria 8972
280 Ga0495608_0183180 3300046511 Bacteria 1324
281 Ga0495618_0048967 3300046514 Bacteria 2669
282 Ga0495652_0032279 3300046529 Bacteria 4581
283 Ga0495652_0212812 3300046529 Bacteria 1458
284 Ga0495640_0048320 3300046533 Bacteria 2941
285 Ga0495587_0008034 3300046536 Bacteria 6812
286 Ga0495587_0204691 3300046536 Bacteria 1115
287 Ga0495645_0025902 3300046543 Bacteria 4257
288 Ga0495667_0008964 3300046559 Bacteria 6801
289 Ga0495668_0004661 3300046616 Bacteria 9625
290 Ga0495625_0011026 3300046660 Bacteria 7412
291 Ga0495657_0011588 3300046675 Bacteria 6588
292 Ga0495623_0147325 3300046679 Bacteria 1395
293 Ga0495600_0131457 3300046809 Bacteria 1627
294 Ga0495660_0019203 3300046810 Bacteria 3925
295 Ga0495604_0038549 3300047317 Bacteria 3759
296 Ga0495675_0031531 3300047444 Bacteria 3383
297 Ga0495677_0013471 3300047445 Bacteria 2977
298 Ga0495684_0036562 3300047471 Bacteria 3764
299 Ga0495602_0000369 3300048088 Bacteria 41909
300 Ga0495602_0048152 3300048088 Bacteria 3835
301 Ga0496100_0009147 3300048903 Bacteria 5558
302 Ga0496101_0332436 3300048904 Bacteria 1193
303 Ga0496102_0007969 3300048905 Bacteria 9053
304 Ga0496103_0005133 3300048906 Bacteria 7882
305 Ga0496109_0013832 3300048912 Bacteria 7012
306 Ga0496111_0114753 3300048914 Bacteria 1986
307 Ga0496113_0031366 3300048916 Bacteria 3857
308 Ga0496113_0534838 3300048916 Bacteria 940
309 Ga0496116_0059830 3300048919 Bacteria 2474
310 Ga0496116_0110229 3300048919 Bacteria 1620
311 Ga0496117_0002298 3300048920 Bacteria 24600
312 Ga0496117_0085273 3300048920 Bacteria 2057
313 Ga0496118_0007362 3300048921 Bacteria 11698
314 Ga0496119_0007114 3300048922 Bacteria 10169
315 Ga0496119_0018252 3300048922 Bacteria 5236
316 Ga0496120_0007864 3300048923 Bacteria 7855
317 Ga0496120_0044855 3300048923 Bacteria 2566
318 Ga0496121_0002309 3300048924 Bacteria 29564
319 Ga0496121_0091527 3300048924 Bacteria 2374
320 Ga0496122_0022897 3300048925 Bacteria 5531
321 Ga0496122_0055277 3300048925 Bacteria 2971
322 Ga0496123_0017051 3300048926 Bacteria 5864
323 Ga0496123_0152174 3300048926 Bacteria 1246
324 Ga0496124_0013120 3300048927 Bacteria 8111
325 Ga0496124_0035429 3300048927 Bacteria 4367
326 Ga0496125_0370245 3300048928 Bacteria 848
327 Ga0496126_0089660 3300048929 Bacteria 2706
328 Ga0495678_098127 3300049459 Bacteria 1019
329 Ga0501292_001880 3300049515 Bacteria 2634
330 Ga0501294_006059 3300049517 Bacteria 1153
331 Ga0501298_009264 3300049521 Bacteria 1671
332 Ga0501303_000707 3300049526 Bacteria 2542
333 Ga0501042_0068510 3300049578 Bacteria 2537
334 Ga0501042_0073974 3300049578 Bacteria 2438
335 Ga0501072_0372770 3300049588 Bacteria 1133
336 Ga0501206_002283 3300049653 Bacteria 2415
337 Ga0501222_014911 3300049662 Bacteria 1026
338 Ga0501223_035384 3300049663 Bacteria 971
339 Ga0501255_003717 3300049684 Bacteria 1436
340 Ga0501262_001375 3300049759 Bacteria 2727
341 Ga0501265_001987 3300049762 Bacteria 2329
342 Ga0501281_01776 3300049777 Bacteria 1639
343 Ga0501045_0099231 3300049824 Bacteria 2155
344 nmdc:mga0yw44_108991_c1 3300050492 Bacteria 1772
345 nmdc:mga07m45_199679_c1 3300050496 Bacteria 1163
346 nmdc:mga05p37_620_c1 3300050507 Bacteria 39253
347 nmdc:mga09592_58785_c1 3300050508 Bacteria 3251
348 nmdc:mga09592_949_c1 3300050508 Bacteria 22803
349 nmdc:mga0qj67_506_c1 3300050509 Bacteria 26635
350 nmdc:mga0qj67_568173_c1 3300050509 Bacteria 909
351 nmdc:mga0qj67_673838_c1 3300050509 Bacteria 824
352 nmdc:mga0qj67_887_c1 3300050509 Bacteria 20521
353 nmdc:mga06r32_644_c1 3300050510 Bacteria 30414
354 nmdc:mga06r32_934_c1 3300050510 Bacteria 25991
355 nmdc:mga08y16_42176_c2 3300050511 Bacteria 3657
356 nmdc:mga08y16_72725_c1 3300050511 Bacteria 3583
357 nmdc:mga08y16_76259_c1 3300050511 Bacteria 3494
358 nmdc:mga0n895_218909_c1 3300050512 Bacteria 1933
359 nmdc:mga08x19_234629_c1 3300050514 Bacteria 1263
360 nmdc:mga0sz30_139672_c1 3300050516 Bacteria 1069
361 nmdc:mga0sz30_66970_c1 3300050516 Bacteria 1198
362 Ga0495601_0073772 3300053077 Bacteria 2182
363 Ga0495612_0001320 3300053078 Bacteria 10215
364 Ga0500610_0042067 3300053079 Bacteria 2364
365 Ga0500635_0023898 3300053080 Bacteria 1912
366 Ga0495595_0025425 3300053084 Bacteria 2624
367 Ga0495619_0003423 3300053085 Bacteria 10240
368 Ga0495619_0051015 3300053085 Bacteria 2733
369 Ga0500646_0015226 3300053090 Bacteria 2002
370 Ga0500647_0065532 3300053091 Bacteria 1747
371 Ga0500569_002060 3300053109 Bacteria 3910
372 Ga0500594_0001291 3300053118 Bacteria 5440
373 Ga0500618_002464 3300053125 Bacteria 6965
374 Ga0500568_0009261 3300053139 Bacteria 4692
375 Ga0500604_0000109 3300053151 Bacteria 25338
376 Ga0500616_0000483 3300053153 Bacteria 51655
377 Ga0500616_0175919 3300053153 Bacteria 968
378 Ga0500636_0036883 3300053177 Bacteria 2893
379 Ga0500587_000506 3300053739 Bacteria 4707
380 Ga0590071_066060 3300059421 Bacteria 888
381 2585333631 2582581316 Bacteria 7774528
382 2522550796 2522125168 Bacteria 7376607
383 2585277021 2582581308 Bacteria 7413247
384 2585323973 2582581315 Bacteria 7318924
385 2585537032 2585427527 Bacteria 7273426
386 2585551883 2585427530 Bacteria 7383882
387 2597812416 2597489875 Bacteria 7010078
388 2616308395 2615840626 Bacteria 7921970
389 2616556534 2615840698 Bacteria 7319877
390 2617385882 2617270742 Bacteria 6808054
391 2671115795 2667528174 Bacteria 6435400
392 2757569363 2757320392 Bacteria 3737298
393 2778176534 2775507266 Bacteria 7392367
394 2792752106 2791355123 Bacteria 8049106
395 2819610349 2818991448 Bacteria 6772224
396 2819638089 2818991453 Bacteria 7181617
397 2838035078 2838029111 Bacteria 6603031
398 2841738433 2841734538 Bacteria 6784580
399 2842481870 2842475841 Bacteria 6603183
400 2842508745 2842502639 Bacteria 6604161
401 2852389684 2852387548 Bacteria 8025568
402 2856366256 2856364286 Bacteria 6939991
403 2857351425 2857349434 Bacteria 7926032
404 2869287291 2869285874 Bacteria 6901219
405 2871430590 2871429161 Bacteria 6547891
406 2871479941 2871474448 Bacteria 6806570
407 2874149131 2874146452 Bacteria 7533118
408 2874156082 2874155637 Bacteria 6724144
409 2874169051 2874168670 Bacteria 8062617
410 2876415445 2876413966 Bacteria 6831344
411 2878747023 2878745973 Bacteria 6867388
412 2878789607 2878788777 Bacteria 6567085
413 2884794310 2884791551 Bacteria 8511252
414 2885312551 2885312484 Bacteria 6415165
415 2888346185 2888343758 Bacteria 6611049
416 2888355493 2888350351 Bacteria 7372807
417 2889010464 2889010040 Bacteria 6749192
418 2889017869 2889016732 Bacteria 6700763
419 2889309943 2889306138 Bacteria 6358934
420 2896384955 2896384573 Bacteria 7700774
421 2903500460 2903492973 Bacteria 13473544
422 2906309836 2906308376 Bacteria 6841989
423 2906322471 2906321335 Bacteria 6579571
424 2906354320 2906354277 Bacteria 6991324
425 2919409850 2919408235 Bacteria 6149349
426 2922133019 2922130491 Bacteria 7173936
427 2922191332 2922185730 Bacteria 7113964
428 2937814865 2937813078 Bacteria 7783518
429 2937841713 2937836603 Bacteria 6811263
430 2937846797 2937843397 Bacteria 5256375
431 2958077948 2958071322 Bacteria 6815895
432 2958102834 2958100919 Bacteria 6800575
433 2958131791 2958130278 Bacteria 6897202
434 2958176671 2958172287 Bacteria 6716688
435 2958180851 2958179912 Bacteria 6874908
436 2961078689 2961077736 Bacteria 7079850
437 2965121817 2965119406 Bacteria 6956431
438 2968119711 2968117919 Bacteria 6536078
439 2970542306 2970540015 Bacteria 6977556
440 2977845674 2977843712 Bacteria 6753583
441 2977945245 2977942078 Bacteria 7570577
442 2977978403 2977971508 Bacteria 7472917
443 2979716453 2979710463 Bacteria 6785254
444 2979747738 2979742915 Bacteria 7301278
445 2987638609 2987636660 Bacteria 8088555
446 2987655006 2987652177 Bacteria 6969023
447 3000139988 3000135777 Bacteria 6891109
448 3004205148 3004203850 Bacteria 7307914
449 3005420287 3005416602 Bacteria 7064308
450 8004389128 8004387939 Bacteria 7049250
451 8004636950 8004633249 Bacteria 6723080
452 8004716191 8004714634 Bacteria 6776161
453 8005317238 8005314921 Bacteria 7072929
454 8005486700 8005484373 Bacteria 6297373
455 8005646160 8005645114 Bacteria 6950293
456 8005686290 8005682033 Bacteria 6726518
457 8046773960 8046767195 Bacteria 7547379
458 8055619911 8055617313 Bacteria 7548464
459 JGI24740J21852_10002553
460 JGI25155J39150_1000011
461 JGI25156J39149_1000030
462 JGI25162J39368_1001401
463 JGI25162J39368_1001515
464 JGI25154J39366_1000289
465 JGI25157J39369_1000010
466 JGI25159J45721_1007706
467 JGI25165J46597_1001229
468 JGI25165J46597_1004859
469 rootH1_10105689
470 rootH2_10001490
471 rootL2_10075208
472 rootH1_10006224
473 JGI25160J50197_1000004
474 JGI25161J50226_1000003
475 Ga0055543_1000001
476 Ga0065165_1001508
477 Ga0065712_10080891
478 Ga0065715_10173728
479 Ga0070676_10014118
480 Ga0070690_100009348
481 Ga0068869_100001572
482 Ga0068869_100235695
483 Ga0070666_10087456
484 Ga0070680_100000978
485 Ga0068868_100000036
486 Ga0068868_100013619
487 Ga0070689_100000194
488 Ga0070687_100003801
489 Ga0070661_100001270
490 Ga0070692_10055450
491 Ga0070669_100002925
492 Ga0070675_100000517
493 Ga0070675_100008116
494 Ga0070671_100013385
495 Ga0070674_100514148
496 Ga0070673_100010045
497 Ga0070688_100000635
498 Ga0070659_100000025
499 Ga0070667_100215632
500 Ga0070709_10277111
501 Ga0070714_100031652
502 Ga0070713_100009452
503 Ga0070710_10035956
504 Ga0070701_10036456
505 Ga0070708_100587921
506 Ga0070662_100082560
507 Ga0070662_100164999
508 Ga0070681_10008557
509 Ga0070685_10006204
510 Ga0070706_100058938
511 Ga0070707_100015169
512 Ga0070698_100452570
513 Ga0070699_100294083
514 Ga0070679_100010187
515 Ga0070679_100211417
516 Ga0070684_100007975
517 Ga0070672_100010341
518 Ga0070686_100002576
519 Ga0070696_100579585
520 Ga0070665_100053253
521 Ga0070665_100690150
522 Ga0068855_100125276
523 Ga0070664_100000173
524 Ga0068857_100027285
525 Ga0068854_100098202
526 Ga0068856_100070180
527 Ga0068856_100144007
528 Ga0070702_100011978
529 Ga0068859_100002708
530 Ga0068864_100000829
531 Ga0068864_100846123
532 Ga0068861_100001405
533 Ga0068861_100006525
534 Ga0068870_10050717
535 Ga0068863_100004115
536 Ga0068858_100031834
537 Ga0068860_100026455
538 Ga0068862_100001554
539 Ga0068862_100003156
540 Ga0081538_10003863
541 Ga0081538_10006679
542 Ga0081540_1038002
543 Ga0081539_10011340
544 Ga0075365_10109918
545 Ga0070716_100593532
546 Ga0070712_100019369
547 Ga0075369_10106207
548 Ga0075427_10019608
549 Ga0075366_10094065
550 Ga0068871_100099029
551 Ga0075428_100003456
552 Ga0075428_100017618
553 Ga0075428_100139720
554 Ga0075430_100001023
555 Ga0075430_100001510
556 Ga0075430_100243630
557 Ga0075431_100000690
558 Ga0075431_100001463
559 Ga0075431_100220561
560 Ga0075434_100211293
561 Ga0075429_100001468
562 Ga0068865_100010229
563 Ga0097620_100002708
564 Ga0105240_10000005
565 Ga0105240_10035922
566 Ga0105240_10075688
567 Ga0111539_10022489
568 Ga0111539_10027306
569 Ga0111539_10039175
570 Ga0111539_10910500
571 Ga0105245_10018593
572 Ga0105245_10020493
573 Ga0105245_10059129
574 Ga0114129_10001484
575 Ga0114129_10931738
576 Ga0114129_11316356
577 Ga0105243_10687498
578 Ga0105248_10003681
579 Ga0105237_10000773
580 Ga0105237_10284099
581 Ga0105238_10314482
582 Ga0105249_10007372
583 Ga0105239_10014053
584 Ga0105239_10049965
585 Ga0105239_11159443
586 Ga0157370_10001070
587 Ga0157370_10026380
588 Ga0157370_10182989
589 Ga0157369_10072192
590 Ga0157374_10250153
591 Ga0163162_10027016
592 Ga0157372_10320094
593 Ga0163163_10004763
594 Ga0163163_10616078
595 Ga0182008_10074860
596 Ga0157377_10004716
597 Ga0157377_10528628
598 Ga0182007_10008279
599 Ga0182005_1002283
600 Ga0163161_10013418
601 Ga0209435_100022
602 Ga0209436_110482
603 Ga0209437_100160
604 Ga0209646_1000078
605 Ga0209646_1008366
606 Ga0209026_1000065
607 Ga0209759_1000055
608 Ga0209233_1000168
609 Ga0209233_1000297
610 Ga0209455_1009217
611 Ga0209130_1000012
612 Ga0207426_1000010
613 Ga0207692_10014251
614 Ga0207688_10020352
615 Ga0207680_10096390
616 Ga0207699_10015874
617 Ga0207643_10035508
618 Ga0207643_10074048
619 Ga0207684_10026128
620 Ga0207707_10027004
621 Ga0207695_10000011
622 Ga0207695_10644683
623 Ga0207671_10001637
624 Ga0207693_10075550
625 Ga0207660_10096644
626 Ga0207662_10006575
627 Ga0207649_10010266
628 Ga0207652_10017076
629 Ga0207652_10256268
630 Ga0207646_10019715
631 Ga0207681_10003623
632 Ga0207694_10365750
633 Ga0207650_10036424
634 Ga0207650_10897655
635 Ga0207659_10090989
636 Ga0207659_10150176
637 Ga0207687_10078687
638 Ga0207687_10119062
639 Ga0207700_10248996
640 Ga0207664_10024085
641 Ga0207644_10005288
642 Ga0207690_10000005
643 Ga0207706_10098626
644 Ga0207670_10003717
645 Ga0207669_10471080
646 Ga0207704_10047885
647 Ga0207665_10268727
648 Ga0207691_10018172
649 Ga0207711_10035062
650 Ga0207689_10004557
651 Ga0207689_10145868
652 Ga0207661_10375820
653 Ga0207679_10004316
654 Ga0207712_10009442
655 Ga0207668_10006832
656 Ga0207640_10496958
657 Ga0207658_10148917
658 Ga0207658_10834102
659 Ga0207677_10000044
660 Ga0207677_10632458
661 Ga0207703_10173926
662 Ga0207639_10080703
663 Ga0207708_10071538
664 Ga0207702_10120436
665 Ga0207641_10013775
666 Ga0207648_10120375
667 Ga0207676_10046386
668 Ga0207674_10034896
669 Ga0207674_10064429
670 Ga0207675_100005214
671 Ga0207675_100011841
672 Ga0207675_100364222
673 Ga0207428_10019799
674 Ga0207428_10074775
675 Ga0207428_10114399
676 Ga0268266_10084743
677 Ga0268265_10002382
678 Ga0268265_10008148
679 Ga0268264_10269365
680 Ga0307515_10220688
681 Ga0265338_10312722
682 Ga0265331_10004264
683 Ga0307408_100012699
684 Ga0307408_100019349
685 Ga0307408_100225745
686 Ga0307408_100890188
687 Ga0265313_10000149
688 Ga0265314_10083088
689 Ga0265342_10060017
690 Ga0307405_10050738
691 Ga0307405_10293984
692 Ga0307405_10912622
693 Ga0307406_10083279
694 Ga0307412_10194763
695 Ga0307412_10300560
696 Ga0307412_10503868
697 Ga0307409_100154280
698 Ga0307416_100090247
699 Ga0307416_100455977
700 Ga0307411_10647252
701 Ga0307415_100031322
702 Ga0307415_100993411
703 Ga0373958_0012508
704 Ga0373953_0006700
705 Ga0373943_0061389
706 Ga0373955_0017563
707 Ga0373955_0029146
708 Ga0373931_0017546
709 Ga0373927_0061164
710 Ga0373933_0004056
711 Ga0373933_0122230
712 Ga0373937_0004039
713 Ga0373937_0009699
714 Ga0395899_0107351
715 Ga0395900_0104231
716 Ga0395898_0317346
717 Ga0395898_0649283
718 Ga0395905_0000386
719 Ga0395905_0042368
720 Ga0395905_0047392
721 Ga0395905_0860525
722 Ga0395901_0102976
723 Ga0395901_0845398
724 Ga0436361_0188754
725 Ga0439442_010319
726 Ga0453684_0722808
727 Ga0466968_0041937
728 Ga0451576_0011354
729 Ga0466967_0145652
730 Ga0495638_0000163
731 Ga0495651_0088167
732 Ga0495653_0168337
733 Ga0495662_0164500
734 Ga0495664_0003721
735 Ga0495583_0016919
736 Ga0495606_0026761
737 Ga0495608_0005604
738 Ga0495608_0183180
739 Ga0495618_0048967
740 Ga0495652_0032279
741 Ga0495652_0212812
742 Ga0495640_0048320
743 Ga0495587_0008034
744 Ga0495587_0204691
745 Ga0495645_0025902
746 Ga0495667_0008964
747 Ga0495668_0004661
748 Ga0495625_0011026
749 Ga0495657_0011588
750 Ga0495623_0147325
751 Ga0495600_0131457
752 Ga0495660_0019203
753 Ga0495604_0038549
754 Ga0495675_0031531
755 Ga0495677_0013471
756 Ga0495684_0036562
757 Ga0495602_0000369
758 Ga0495602_0048152
759 Ga0496100_0009147
760 Ga0496101_0332436
761 Ga0496102_0007969
762 Ga0496103_0005133
763 Ga0496109_0013832
764 Ga0496111_0114753
765 Ga0496113_0031366
766 Ga0496113_0534838
767 Ga0496116_0059830
768 Ga0496116_0110229
769 Ga0496117_0002298
770 Ga0496117_0085273
771 Ga0496118_0007362
772 Ga0496119_0007114
773 Ga0496119_0018252
774 Ga0496120_0007864
775 Ga0496120_0044855
776 Ga0496121_0002309
777 Ga0496121_0091527
778 Ga0496122_0022897
779 Ga0496122_0055277
780 Ga0496123_0017051
781 Ga0496123_0152174
782 Ga0496124_0013120
783 Ga0496124_0035429
784 Ga0496125_0370245
785 Ga0496126_0089660
786 Ga0495678_098127
787 Ga0501292_001880
788 Ga0501294_006059
789 Ga0501298_009264
790 Ga0501303_000707
791 Ga0501042_0068510
792 Ga0501042_0073974
793 Ga0501072_0372770
794 Ga0501206_002283
795 Ga0501222_014911
796 Ga0501223_035384
797 Ga0501255_003717
798 Ga0501262_001375
799 Ga0501265_001987
800 Ga0501281_01776
801 Ga0501045_0099231
802 nmdc:mga0yw44_108991_c1
803 nmdc:mga07m45_199679_c1
804 nmdc:mga05p37_620_c1
805 nmdc:mga09592_58785_c1
806 nmdc:mga09592_949_c1
807 nmdc:mga0qj67_506_c1
808 nmdc:mga0qj67_568173_c1
809 nmdc:mga0qj67_673838_c1
810 nmdc:mga0qj67_887_c1
811 nmdc:mga06r32_644_c1
812 nmdc:mga06r32_934_c1
813 nmdc:mga08y16_42176_c2
814 nmdc:mga08y16_72725_c1
815 nmdc:mga08y16_76259_c1
816 nmdc:mga0n895_218909_c1
817 nmdc:mga08x19_234629_c1
818 nmdc:mga0sz30_139672_c1
819 nmdc:mga0sz30_66970_c1
820 Ga0495601_0073772
821 Ga0495612_0001320
822 Ga0500610_0042067
823 Ga0500635_0023898
824 Ga0495595_0025425
825 Ga0495619_0003423
826 Ga0495619_0051015
827 Ga0500646_0015226
828 Ga0500647_0065532
829 Ga0500569_002060
830 Ga0500594_0001291
831 Ga0500618_002464
832 Ga0500568_0009261
833 Ga0500604_0000109
834 Ga0500616_0000483
835 Ga0500616_0175919
836 Ga0500636_0036883
837 Ga0500587_000506
838 Ga0590071_066060
839 2585333631
840 2522550796
841 2585277021
842 2585323973
843 2585537032
844 2585551883
845 2597812416
846 2616308395
847 2616556534
848 2617385882
849 2671115795
850 2757569363
851 2778176534
852 2792752106
853 2819610349
854 2819638089
855 2838035078
856 2841738433
857 2842481870
858 2842508745
859 2852389684
860 2856366256
861 2857351425
862 2869287291
863 2871430590
864 2871479941
865 2874149131
866 2874156082
867 2874169051
868 2876415445
869 2878747023
870 2878789607
871 2884794310
872 2885312551
873 2888346185
874 2888355493
875 2889010464
876 2889017869
877 2889309943
878 2896384955
879 2903500460
880 2906309836
881 2906322471
882 2906354320
883 2919409850
884 2922133019
885 2922191332
886 2937814865
887 2937841713
888 2937846797
889 2958077948
890 2958102834
891 2958131791
892 2958176671
893 2958180851
894 2961078689
895 2965121817
896 2968119711
897 2970542306
898 2977845674
899 2977945245
900 2977978403
901 2979716453
902 2979747738
903 2987638609
904 2987655006
905 3000139988
906 3004205148
907 3005420287
908 8004389128
909 8004636950
910 8004716191
911 8005317238
912 8005486700
913 8005646160
914 8005686290
915 8046773960
916 8055619911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

50

235

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8235 1 193
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8192 1 193
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8059 2 193
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7917 3 193
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7871 2 191
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8177 1 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8133 2 190 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8133 1 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8086 2 190 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8039 4 191 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9822 52 190 GO:0008703
GO:0009231
AF-A0A1T5ETS6-F1-model_v4 Dihydrofolate reductase 0.9717 1 201 GO:0008703
GO:0009231
AF-A0A1H6VBG3-F1-model_v4 Dihydrofolate reductase 0.9711 1 217 GO:0008703
GO:0009231
AF-A0A528A7F9-F1-model_v4 Dihydrofolate reductase 0.9707 1 158 GO:0008703
GO:0009231
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9682 52 190 GO:0008703
GO:0009231

Map