F448305

General Info

Members Datasets Scaffolds Average Seq Length
459 199 918 92

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100075262|Ga0070660_1000752623
Length 111
Sequence MNRCQAGFTSMALEGSMRSRVNMRIGRTMLVLGGVALVAAAGYATAASGQDQKTPKGWSYEIKDGKRVPKANRVTNADGSWREEVKQGNCVTIKEKSAAGEYKETRQCNPN

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.49
Rhizosphere 95.64
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100075262 3300005339 Bacteria 2643
2 JGI24740J21852_10026117 3300001979 Bacteria 1960
3 JGI24739J22299_10045677 3300001989 Bacteria 1436
4 JGI24737J22298_10000655 3300001990 Bacteria 12249
5 JGI24737J22298_10056357 3300001990 Bacteria 1187
6 JGI24737J22298_10080053 3300001990 Bacteria 972
7 JGI24737J22298_10217794 3300001990 Bacteria 563
8 JGI24743J22301_10022072 3300001991 Bacteria 1218
9 JGI24743J22301_10048885 3300001991 Bacteria 859
10 JGI24735J21928_10115962 3300002067 Bacteria 771
11 JGI24738J21930_10033104 3300002075 Bacteria 1054
12 JGI24738J21930_10051734 3300002075 Bacteria 838
13 JGI24738J21930_10113884 3300002075 Bacteria 584
14 JGI24033J26618_1008260 3300002155 Bacteria 1196
15 JGI24034J26672_10038758 3300002239 Bacteria 795
16 JGI24742J22300_10036750 3300002244 Bacteria 866
17 JGI25406J46586_10057809 3300003203 Bacteria 1267
18 Ga0065715_10209830 3300005293 Bacteria 1319
19 Ga0070658_10009104 3300005327 Bacteria 7985
20 Ga0070658_10013533 3300005327 Bacteria 6546
21 Ga0070658_10016356 3300005327 Bacteria 5937
22 Ga0070658_10034152 3300005327 Bacteria 4092
23 Ga0070658_10197038 3300005327 Bacteria 1698
24 Ga0070676_10008701 3300005328 Bacteria 5477
25 Ga0070676_10149813 3300005328 Bacteria 1492
26 Ga0070683_100037243 3300005329 Bacteria 4452
27 Ga0070690_100060826 3300005330 Bacteria 2432
28 Ga0070690_100137193 3300005330 Bacteria 1657
29 Ga0070670_100099644 3300005331 Bacteria 2500
30 Ga0070670_100211953 3300005331 Bacteria 1684
31 Ga0070670_100271022 3300005331 Bacteria 1481
32 Ga0070670_100425379 3300005331 Bacteria 1174
33 Ga0070677_10001140 3300005333 Bacteria 8560
34 Ga0070677_10609014 3300005333 Bacteria 606
35 Ga0070677_10889172 3300005333 Bacteria 514
36 Ga0068869_100034744 3300005334 Bacteria 3568
37 Ga0070666_10032086 3300005335 Bacteria 3469
38 Ga0070666_10193411 3300005335 Unclassified 1430
39 Ga0070666_10208281 3300005335 Bacteria 1376
40 Ga0070680_100217441 3300005336 Bacteria 1612
41 Ga0070680_100862323 3300005336 Bacteria 781
42 Ga0070680_100937513 3300005336 Unclassified 747
43 Ga0070680_100941302 3300005336 Bacteria 746
44 Ga0070682_100757214 3300005337 Bacteria 785
45 Ga0068868_100024884 3300005338 Bacteria 4546
46 Ga0068868_100147000 3300005338 Bacteria 1939
47 Ga0070660_100015001 3300005339 Bacteria 5588
48 Ga0070660_100068784 3300005339 Bacteria 2760
49 Ga0070660_100107887 3300005339 Bacteria 2213
50 Ga0070660_100115838 3300005339 Bacteria 2137
51 Ga0070660_100170557 3300005339 Bacteria 1757
52 Ga0070660_101036759 3300005339 Bacteria 693
53 Ga0070660_101192019 3300005339 Bacteria 645
54 Ga0070687_100106251 3300005343 Bacteria 1581
55 Ga0070661_100011611 3300005344 Bacteria 6139
56 Ga0070661_100118743 3300005344 Bacteria 1979
57 Ga0070661_100120597 3300005344 Bacteria 1964
58 Ga0070661_100254637 3300005344 Bacteria 1356
59 Ga0070661_100325891 3300005344 Bacteria 1200
60 Ga0070661_100365651 3300005344 Bacteria 1134
61 Ga0070661_100583142 3300005344 Bacteria 902
62 Ga0070661_101430904 3300005344 Bacteria 582
63 Ga0070661_101938680 3300005344 Bacteria 501
64 Ga0070692_10008029 3300005345 Bacteria 4685
65 Ga0070692_10016005 3300005345 Bacteria 3560
66 Ga0070692_10069687 3300005345 Bacteria 1871
67 Ga0070668_100022039 3300005347 Bacteria 4815
68 Ga0070668_100544512 3300005347 Bacteria 1009
69 Ga0070669_100036967 3300005353 Bacteria 3540
70 Ga0070669_100140030 3300005353 Bacteria 1864
71 Ga0070669_100496753 3300005353 Bacteria 1012
72 Ga0070675_100017347 3300005354 Bacteria 5719
73 Ga0070675_101253364 3300005354 Bacteria 683
74 Ga0070675_101493444 3300005354 Bacteria 623
75 Ga0070671_100000866 3300005355 Bacteria 22123
76 Ga0070671_100147839 3300005355 Bacteria 1984
77 Ga0070671_100196846 3300005355 Bacteria 1708
78 Ga0070674_100059776 3300005356 Bacteria 2654
79 Ga0070674_100082580 3300005356 Bacteria 2299
80 Ga0070674_100111426 3300005356 Bacteria 2010
81 Ga0070673_100029963 3300005364 Bacteria 4065
82 Ga0070673_100072882 3300005364 Bacteria 2763
83 Ga0070673_100274689 3300005364 Bacteria 1476
84 Ga0070673_101316677 3300005364 Bacteria 679
85 Ga0070659_100005147 3300005366 Bacteria 9376
86 Ga0070659_100034853 3300005366 Bacteria 3917
87 Ga0070659_100044675 3300005366 Bacteria 3469
88 Ga0070659_100329751 3300005366 Bacteria 1277
89 Ga0070659_100389646 3300005366 Bacteria 1175
90 Ga0070659_100794801 3300005366 Bacteria 822
91 Ga0070667_100031529 3300005367 Bacteria 4419
92 Ga0070667_100243972 3300005367 Bacteria 1605
93 Ga0070667_100264287 3300005367 Bacteria 1541
94 Ga0070667_101118227 3300005367 Bacteria 737
95 Ga0070694_100040059 3300005444 Bacteria 3122
96 Ga0070663_100222806 3300005455 Bacteria 1481
97 Ga0070663_100388540 3300005455 Unclassified 1138
98 Ga0070663_100845258 3300005455 Bacteria 787
99 Ga0070678_100003460 3300005456 Bacteria 8800
100 Ga0070678_100008774 3300005456 Bacteria 6074
101 Ga0070662_100009922 3300005457 Bacteria 6239
102 Ga0070662_100011267 3300005457 Bacteria 5894
103 Ga0070662_100013335 3300005457 Bacteria 5467
104 Ga0070662_100031671 3300005457 Bacteria 3713
105 Ga0070662_100076212 3300005457 Bacteria 2485
106 Ga0070662_100201082 3300005457 Bacteria 1581
107 Ga0070662_100237020 3300005457 Bacteria 1462
108 Ga0070681_10063111 3300005458 Bacteria 3677
109 Ga0070681_10276705 3300005458 Bacteria 1590
110 Ga0070681_11286978 3300005458 Bacteria 654
111 Ga0068867_100020121 3300005459 Bacteria 4756
112 Ga0068867_100093557 3300005459 Bacteria 2285
113 Ga0068867_100170969 3300005459 Bacteria 1721
114 Ga0068867_100932496 3300005459 Bacteria 783
115 Ga0068867_101738419 3300005459 Bacteria 585
116 Ga0070679_100094881 3300005530 Bacteria 2971
117 Ga0070679_100211998 3300005530 Bacteria 1900
118 Ga0070679_100985419 3300005530 Bacteria 787
119 Ga0070679_101238253 3300005530 Unclassified 692
120 Ga0070684_100050247 3300005535 Bacteria 3621
121 Ga0068853_100051224 3300005539 Bacteria 3554
122 Ga0068853_100100007 3300005539 Bacteria 2563
123 Ga0068853_100248837 3300005539 Bacteria 1630
124 Ga0068853_100260987 3300005539 Bacteria 1593
125 Ga0068853_102100201 3300005539 Bacteria 548
126 Ga0070672_100009584 3300005543 Bacteria 6681
127 Ga0070672_100040745 3300005543 Bacteria 3566
128 Ga0070672_100088437 3300005543 Bacteria 2494
129 Ga0070672_100169185 3300005543 Bacteria 1816
130 Ga0070672_101281777 3300005543 Bacteria 654
131 Ga0070686_100063234 3300005544 Bacteria 2397
132 Ga0070686_100126900 3300005544 Bacteria 1759
133 Ga0070695_100129609 3300005545 Bacteria 1737
134 Ga0070696_100002969 3300005546 Bacteria 11259
135 Ga0070696_101417411 3300005546 Bacteria 593
136 Ga0070693_100120838 3300005547 Bacteria 1624
137 Ga0070693_100274337 3300005547 Bacteria 1127
138 Ga0070665_100105865 3300005548 Bacteria 2815
139 Ga0070704_100623364 3300005549 Bacteria 950
140 Ga0068855_100024916 3300005563 Bacteria 7158
141 Ga0068855_100082525 3300005563 Bacteria 3725
142 Ga0068855_100089988 3300005563 Bacteria 3543
143 Ga0070664_100003026 3300005564 Bacteria 13593
144 Ga0070664_100004108 3300005564 Bacteria 11693
145 Ga0070664_100006591 3300005564 Bacteria 9361
146 Ga0070664_100138485 3300005564 Bacteria 2141
147 Ga0070664_100168051 3300005564 Bacteria 1944
148 Ga0070664_100268612 3300005564 Bacteria 1536
149 Ga0070664_100532750 3300005564 Bacteria 1085
150 Ga0070664_100953192 3300005564 Bacteria 805
151 Ga0068857_100002189 3300005577 Bacteria 15896
152 Ga0068857_100252035 3300005577 Bacteria 1619
153 Ga0068857_100795816 3300005577 Bacteria 903
154 Ga0068854_100111101 3300005578 Bacteria 2068
155 Ga0068854_100346504 3300005578 Bacteria 1214
156 Ga0068856_100063582 3300005614 Bacteria 3646
157 Ga0070702_101047389 3300005615 Unclassified 649
158 Ga0068852_100025514 3300005616 Bacteria 4790
159 Ga0068852_100032451 3300005616 Bacteria 4324
160 Ga0068852_100688902 3300005616 Bacteria 1031
161 Ga0068859_100013237 3300005617 Bacteria 8277
162 Ga0068859_100037850 3300005617 Bacteria 4841
163 Ga0068859_100430578 3300005617 Bacteria 1416
164 Ga0068859_100650680 3300005617 Bacteria 1146
165 Ga0068864_100022361 3300005618 Bacteria 5302
166 Ga0068864_100081707 3300005618 Bacteria 2833
167 Ga0068866_10005188 3300005718 Bacteria 5368
168 Ga0068866_10215967 3300005718 Bacteria 1154
169 Ga0068861_100074791 3300005719 Bacteria 2635
170 Ga0068861_102355829 3300005719 Bacteria 535
171 Ga0068851_10018054 3300005834 Bacteria 3396
172 Ga0068851_10161667 3300005834 Bacteria 1230
173 Ga0068863_100015881 3300005841 Bacteria 7222
174 Ga0068863_100024403 3300005841 Bacteria 5767
175 Ga0068863_100064125 3300005841 Bacteria 3474
176 Ga0068863_100079639 3300005841 Bacteria 3102
177 Ga0068863_102196754 3300005841 Bacteria 562
178 Ga0068858_100002348 3300005842 Bacteria 19118
179 Ga0068858_100055846 3300005842 Bacteria 3650
180 Ga0068860_100003557 3300005843 Bacteria 16020
181 Ga0068860_100160812 3300005843 Bacteria 2165
182 Ga0068860_100378290 3300005843 Bacteria 1397
183 Ga0068862_100010067 3300005844 Bacteria 7806
184 Ga0068862_100016753 3300005844 Bacteria 6101
185 Ga0068862_100186233 3300005844 Bacteria 1865
186 Ga0068862_102342777 3300005844 Bacteria 546
187 Ga0097621_100013030 3300006237 Bacteria 6181
188 Ga0097621_102206123 3300006237 Bacteria 527
189 Ga0068871_100005666 3300006358 Bacteria 8763
190 Ga0068871_100268635 3300006358 Bacteria 1489
191 Ga0075428_100588541 3300006844 Bacteria 1189
192 Ga0068865_100001424 3300006881 Bacteria 13953
193 Ga0068865_101993537 3300006881 Bacteria 527
194 Ga0097620_100013239 3300006931 Bacteria 8277
195 Ga0097620_100037851 3300006931 Bacteria 4841
196 Ga0097620_100430576 3300006931 Bacteria 1416
197 Ga0097620_100650811 3300006931 Bacteria 1146
198 Ga0105240_10122528 3300009093 Bacteria 3129
199 Ga0105240_10899137 3300009093 Bacteria 953
200 Ga0111539_10292579 3300009094 Bacteria 1895
201 Ga0105245_10019331 3300009098 Bacteria 5963
202 Ga0114129_11527414 3300009147 Bacteria 820
203 Ga0105243_10024746 3300009148 Bacteria 4582
204 Ga0105243_10425369 3300009148 Bacteria 1240
205 Ga0105243_10678028 3300009148 Bacteria 1002
206 Ga0105243_12851954 3300009148 Bacteria 524
207 Ga0105241_10114736 3300009174 Bacteria 2161
208 Ga0105241_10277531 3300009174 Bacteria 1430
209 Ga0105242_10489383 3300009176 Unclassified 1167
210 Ga0105248_10044563 3300009177 Bacteria 4975
211 Ga0105248_10197736 3300009177 Bacteria 2265
212 Ga0105248_10332785 3300009177 Bacteria 1710
213 Ga0105248_10860076 3300009177 Bacteria 1024
214 Ga0105248_12362076 3300009177 Bacteria 605
215 Ga0105238_10105363 3300009551 Bacteria 2801
216 Ga0105249_10021461 3300009553 Bacteria 5781
217 Ga0105249_10026474 3300009553 Bacteria 5226
218 Ga0105249_10297614 3300009553 Bacteria 1617
219 Ga0105249_10763485 3300009553 Bacteria 1029
220 Ga0105249_11455563 3300009553 Bacteria 757
221 Ga0105239_10042112 3300010375 Bacteria 5004
222 Ga0105239_11128004 3300010375 Bacteria 903
223 Ga0105246_10190958 3300011119 Bacteria 1585
224 Ga0105246_10686742 3300011119 Unclassified 895
225 Ga0105246_11372624 3300011119 Bacteria 658
226 Ga0157315_1007749 3300012508 Bacteria 880
227 Ga0157373_11275804 3300013100 Unclassified 555
228 Ga0157371_10011898 3300013102 Bacteria 6677
229 Ga0157371_10079776 3300013102 Bacteria 2318
230 Ga0157371_10429716 3300013102 Archaea 969
231 Ga0157371_10833754 3300013102 Bacteria 696
232 Ga0157371_10859671 3300013102 Bacteria 686
233 Ga0157370_10109351 3300013104 Bacteria 2584
234 Ga0157369_10025475 3300013105 Bacteria 6568
235 Ga0157374_10116923 3300013296 Bacteria 2570
236 Ga0157374_10312604 3300013296 Bacteria 1556
237 Ga0157378_10182112 3300013297 Bacteria 1977
238 Ga0157378_11335425 3300013297 Bacteria 759
239 Ga0163162_10088341 3300013306 Bacteria 3179
240 Ga0163162_10154261 3300013306 Bacteria 2416
241 Ga0163162_10980635 3300013306 Bacteria 955
242 Ga0163162_11064545 3300013306 Bacteria 916
243 Ga0157372_11269749 3300013307 Bacteria 850
244 Ga0157372_12092314 3300013307 Bacteria 650
245 Ga0157372_12300387 3300013307 Bacteria 619
246 Ga0157375_10281480 3300013308 Bacteria 1826
247 Ga0157375_12120061 3300013308 Bacteria 669
248 Ga0163163_10093474 3300014325 Bacteria 3024
249 Ga0163163_10808921 3300014325 Bacteria 1001
250 Ga0157380_10018252 3300014326 Bacteria 5205
251 Ga0157380_10675354 3300014326 Bacteria 1034
252 Ga0182008_10710817 3300014497 Bacteria 575
253 Ga0157379_10148042 3300014968 Bacteria 2118
254 Ga0157379_10278365 3300014968 Bacteria 1522
255 Ga0157379_10783424 3300014968 Bacteria 899
256 Ga0157376_10003882 3300014969 Bacteria 10338
257 Ga0163161_10140702 3300017792 Bacteria 1827
258 Ga0224712_10476621 3300022467 Bacteria 601
259 Ga0207697_10020248 3300025315 Bacteria 2725
260 Ga0207656_10109893 3300025321 Bacteria 1273
261 Ga0207682_10001204 3300025893 Bacteria 11981
262 Ga0207682_10279675 3300025893 Bacteria 780
263 Ga0207642_10193347 3300025899 Unclassified 1118
264 Ga0207688_10064658 3300025901 Bacteria 2066
265 Ga0207688_10174628 3300025901 Bacteria 1279
266 Ga0207680_10022791 3300025903 Bacteria 3410
267 Ga0207680_10263582 3300025903 Bacteria 1193
268 Ga0207647_10387190 3300025904 Bacteria 789
269 Ga0207645_10079621 3300025907 Bacteria 2100
270 Ga0207645_10288283 3300025907 Bacteria 1091
271 Ga0207645_10581041 3300025907 Bacteria 760
272 Ga0207705_10077360 3300025909 Bacteria 2420
273 Ga0207705_10101837 3300025909 Bacteria 2113
274 Ga0207705_10175791 3300025909 Bacteria 1614
275 Ga0207705_10213857 3300025909 Bacteria 1462
276 Ga0207707_10865422 3300025912 Bacteria 749
277 Ga0207695_10487491 3300025913 Bacteria 1115
278 Ga0207660_11588124 3300025917 Unclassified 527
279 Ga0207657_10020046 3300025919 Bacteria 6333
280 Ga0207657_10021739 3300025919 Bacteria 6030
281 Ga0207657_10026681 3300025919 Bacteria 5302
282 Ga0207657_10136624 3300025919 Bacteria 2005
283 Ga0207649_10017891 3300025920 Bacteria 4020
284 Ga0207649_10029155 3300025920 Bacteria 3257
285 Ga0207649_10535357 3300025920 Bacteria 894
286 Ga0207649_10746772 3300025920 Bacteria 761
287 Ga0207652_10191010 3300025921 Bacteria 1842
288 Ga0207652_10721322 3300025921 Unclassified 889
289 Ga0207681_10035367 3300025923 Bacteria 3291
290 Ga0207694_10174361 3300025924 Bacteria 1742
291 Ga0207650_10081068 3300025925 Bacteria 2461
292 Ga0207650_10268459 3300025925 Bacteria 1386
293 Ga0207659_10032231 3300025926 Bacteria 3594
294 Ga0207659_10434818 3300025926 Bacteria 1103
295 Ga0207687_10414331 3300025927 Bacteria 1111
296 Ga0207687_11632263 3300025927 Bacteria 553
297 Ga0207644_10001103 3300025931 Bacteria 17326
298 Ga0207644_10043002 3300025931 Bacteria 3204
299 Ga0207644_10122017 3300025931 Bacteria 1985
300 Ga0207690_10140316 3300025932 Bacteria 1780
301 Ga0207690_10145882 3300025932 Bacteria 1749
302 Ga0207690_10335566 3300025932 Bacteria 1192
303 Ga0207706_10006865 3300025933 Bacteria 10524
304 Ga0207706_10015694 3300025933 Bacteria 6847
305 Ga0207706_10049976 3300025933 Bacteria 3695
306 Ga0207706_10132255 3300025933 Bacteria 2194
307 Ga0207706_10464456 3300025933 Bacteria 1094
308 Ga0207706_10783179 3300025933 Bacteria 811
309 Ga0207686_10228229 3300025934 Bacteria 1348
310 Ga0207709_10373253 3300025935 Bacteria 1083
311 Ga0207669_10007101 3300025937 Bacteria 5157
312 Ga0207669_10743224 3300025937 Unclassified 809
313 Ga0207704_10342826 3300025938 Bacteria 1160
314 Ga0207691_10014251 3300025940 Bacteria 7584
315 Ga0207691_10055543 3300025940 Bacteria 3608
316 Ga0207691_10082960 3300025940 Bacteria 2878
317 Ga0207711_10007160 3300025941 Bacteria 9351
318 Ga0207711_10047302 3300025941 Bacteria 3677
319 Ga0207711_10268578 3300025941 Bacteria 1569
320 Ga0207679_10183587 3300025945 Bacteria 1733
321 Ga0207679_10963674 3300025945 Bacteria 781
322 Ga0207679_11073854 3300025945 Bacteria 738
323 Ga0207651_10008035 3300025960 Bacteria 5661
324 Ga0207651_10877957 3300025960 Bacteria 798
325 Ga0207651_11109267 3300025960 Bacteria 709
326 Ga0207668_10013440 3300025972 Bacteria 5041
327 Ga0207668_10033122 3300025972 Bacteria 3421
328 Ga0207668_10155558 3300025972 Bacteria 1776
329 Ga0207640_10141564 3300025981 Bacteria 1754
330 Ga0207640_10156815 3300025981 Bacteria 1679
331 Ga0207658_10107463 3300025986 Bacteria 2199
332 Ga0207658_10177607 3300025986 Bacteria 1759
333 Ga0207658_10188689 3300025986 Bacteria 1711
334 Ga0207658_11062805 3300025986 Bacteria 739
335 Ga0207677_10066798 3300026023 Bacteria 2516
336 Ga0207703_10027296 3300026035 Bacteria 4496
337 Ga0207639_10036739 3300026041 Bacteria 3632
338 Ga0207639_10583015 3300026041 Bacteria 1030
339 Ga0207639_11024950 3300026041 Bacteria 773
340 Ga0207678_10003992 3300026067 Bacteria 13273
341 Ga0207678_11259499 3300026067 Bacteria 655
342 Ga0207702_10368541 3300026078 Bacteria 1378
343 Ga0207702_11107425 3300026078 Unclassified 786
344 Ga0207702_11501155 3300026078 Bacteria 667
345 Ga0207641_10064867 3300026088 Bacteria 3122
346 Ga0207641_10281454 3300026088 Bacteria 1564
347 Ga0207648_10020517 3300026089 Bacteria 5950
348 Ga0207648_10303784 3300026089 Bacteria 1431
349 Ga0207648_11564487 3300026089 Bacteria 620
350 Ga0207674_11389659 3300026116 Bacteria 671
351 Ga0207683_10002763 3300026121 Bacteria 15335
352 Ga0207683_10052050 3300026121 Bacteria 3588
353 Ga0207683_10629497 3300026121 Bacteria 994
354 Ga0207698_10006707 3300026142 Bacteria 7194
355 Ga0207698_12535580 3300026142 Unclassified 523
356 Ga0268265_10003724 3300028380 Bacteria 10841
357 Ga0268265_11408857 3300028380 Unclassified 699
358 Ga0268265_11519237 3300028380 Bacteria 673
359 Ga0268264_10444459 3300028381 Bacteria 1255
360 Ga0268264_10747498 3300028381 Bacteria 974
361 Ga0307513_10504345 3300031456 Bacteria 927
362 Ga0307408_100331310 3300031548 Bacteria 1286
363 Ga0307405_10162711 3300031731 Bacteria 1583
364 Ga0307405_11519128 3300031731 Bacteria 589
365 Ga0307413_10081843 3300031824 Bacteria 2072
366 Ga0307413_10293731 3300031824 Bacteria 1229
367 Ga0307410_10000365 3300031852 Bacteria 17643
368 Ga0307410_10246541 3300031852 Bacteria 1387
369 Ga0307406_10782456 3300031901 Unclassified 804
370 Ga0307407_10109875 3300031903 Bacteria 1729
371 Ga0307407_10296377 3300031903 Bacteria 1126
372 Ga0307412_12258245 3300031911 Bacteria 507
373 Ga0307409_100044755 3300031995 Bacteria 3336
374 Ga0307409_100459095 3300031995 Bacteria 1231
375 Ga0307409_101168228 3300031995 Unclassified 792
376 Ga0307416_100009695 3300032002 Bacteria 6323
377 Ga0307416_100017708 3300032002 Bacteria 4994
378 Ga0307416_100277165 3300032002 Bacteria 1651
379 Ga0307416_102792994 3300032002 Bacteria 584
380 Ga0307414_11597677 3300032004 Bacteria 608
381 Ga0307411_10001018 3300032005 Bacteria 10831
382 Ga0307415_100001082 3300032126 Bacteria 12655
383 Ga0307415_100129072 3300032126 Bacteria 1910
384 Ga0307415_100169430 3300032126 Bacteria 1701
385 Ga0373930_0068565 3300034816 Bacteria 803
386 Ga0373940_0140169 3300035088 Bacteria 764
387 Ga0373960_0160354 3300035121 Bacteria 774
388 Ga0373931_0087294 3300035691 Bacteria 1732
389 Ga0395899_0038519 3300037312 Bacteria 3581
390 Ga0395899_0044788 3300037312 Bacteria 3296
391 Ga0395899_0059381 3300037312 Bacteria 2819
392 Ga0395899_0458452 3300037312 Bacteria 833
393 Ga0395899_0514500 3300037312 Bacteria 774
394 Ga0395899_0581002 3300037312 Bacteria 716
395 Ga0395900_0016178 3300037418 Bacteria 7599
396 Ga0395900_0106919 3300037418 Bacteria 2874
397 Ga0395900_0257566 3300037418 Bacteria 1743
398 Ga0395898_0064367 3300037466 Bacteria 3556
399 Ga0395898_0074343 3300037466 Bacteria 3282
400 Ga0395898_0391213 3300037466 Bacteria 1325
401 Ga0395905_0006012 3300037471 Bacteria 12289
402 Ga0395905_0015442 3300037471 Bacteria 7260
403 Ga0395905_0051705 3300037471 Bacteria 3848
404 Ga0395905_0056589 3300037471 Bacteria 3668
405 Ga0395905_0121364 3300037471 Bacteria 2456
406 Ga0395905_0130362 3300037471 Bacteria 2365
407 Ga0395905_0154472 3300037471 Bacteria 2158
408 Ga0395905_0182532 3300037471 Bacteria 1970
409 Ga0395905_0301272 3300037471 Bacteria 1490
410 Ga0395905_0363221 3300037471 Bacteria 1340
411 Ga0395905_0564245 3300037471 Bacteria 1040
412 Ga0395905_1320953 3300037471 Bacteria 625
413 Ga0395905_1518229 3300037471 Unclassified 574
414 Ga0395901_0008128 3300038443 Bacteria 10595
415 Ga0395901_0271280 3300038443 Bacteria 1764
416 Ga0395901_0468453 3300038443 Bacteria 1286
417 Ga0395901_0574687 3300038443 Unclassified 1139
418 Ga0395901_0608213 3300038443 Bacteria 1101
419 Ga0395901_1498503 3300038443 Bacteria 630
420 Ga0451843_0955937 3300041509 Bacteria 696
421 Ga0439464_0000350 3300042439 Bacteria 8930
422 Ga0466972_0080474 3300044658 Bacteria 1551
423 Ga0466965_0051100 3300044683 Bacteria 2051
424 Ga0466966_0046090 3300044684 Bacteria 2785
425 Ga0466961_0068555 3300044693 Bacteria 2252
426 Ga0466963_0102011 3300044694 Bacteria 1965
427 Ga0466963_0450937 3300044694 Bacteria 908
428 Ga0466963_0707353 3300044694 Bacteria 711
429 Ga0466971_0053609 3300044719 Bacteria 1817
430 Ga0466968_0615518 3300044735 Bacteria 549
431 Ga0466970_0128660 3300044765 Bacteria 1390
432 Ga0466970_0948237 3300044765 Unclassified 507
433 Ga0466957_0094016 3300044842 Bacteria 1882
434 Ga0466959_0377268 3300045049 Bacteria 965
435 Ga0466958_0035724 3300045836 Bacteria 2969
436 Ga0466967_0259618 3300045976 Bacteria 1662
437 Ga0495668_0050557 3300046616 Bacteria 2303
438 Ga0495670_0705858 3300046691 Bacteria 550
439 Ga0495672_0201175 3300047320 Bacteria 996
440 Ga0495677_0047340 3300047445 Bacteria 1579
441 Ga0496100_0006995 3300048903 Bacteria 6188
442 Ga0496100_0667662 3300048903 Bacteria 810
443 Ga0496102_0144054 3300048905 Bacteria 2235
444 Ga0496103_0360178 3300048906 Bacteria 935
445 Ga0496103_0451750 3300048906 Bacteria 824
446 Ga0496106_0111285 3300048909 Bacteria 2132
447 Ga0496106_1319797 3300048909 Bacteria 560
448 Ga0496107_0008263 3300048910 Bacteria 7203
449 Ga0496107_0144468 3300048910 Bacteria 1759
450 Ga0496107_0170308 3300048910 Bacteria 1616
451 Ga0496107_1102636 3300048910 Bacteria 573
452 Ga0496108_0148879 3300048911 Bacteria 2019
453 Ga0496111_0510238 3300048914 Bacteria 884
454 Ga0496112_0117027 3300048915 Bacteria 2635
455 Ga0496113_0098386 3300048916 Bacteria 2264
456 Ga0496114_0177882 3300048917 Bacteria 1857
457 Ga0501069_0475559 3300049585 Bacteria 744
458 nmdc:mga03683_409252_c1 3300050489 Unclassified 648
459 Ga0500658_0000036 3300053134 Bacteria 85304
460 Ga0070660_100075262
461 JGI24740J21852_10026117
462 JGI24739J22299_10045677
463 JGI24737J22298_10000655
464 JGI24737J22298_10056357
465 JGI24737J22298_10080053
466 JGI24737J22298_10217794
467 JGI24743J22301_10022072
468 JGI24743J22301_10048885
469 JGI24735J21928_10115962
470 JGI24738J21930_10033104
471 JGI24738J21930_10051734
472 JGI24738J21930_10113884
473 JGI24033J26618_1008260
474 JGI24034J26672_10038758
475 JGI24742J22300_10036750
476 JGI25406J46586_10057809
477 Ga0065715_10209830
478 Ga0070658_10009104
479 Ga0070658_10013533
480 Ga0070658_10016356
481 Ga0070658_10034152
482 Ga0070658_10197038
483 Ga0070676_10008701
484 Ga0070676_10149813
485 Ga0070683_100037243
486 Ga0070690_100060826
487 Ga0070690_100137193
488 Ga0070670_100099644
489 Ga0070670_100211953
490 Ga0070670_100271022
491 Ga0070670_100425379
492 Ga0070677_10001140
493 Ga0070677_10609014
494 Ga0070677_10889172
495 Ga0068869_100034744
496 Ga0070666_10032086
497 Ga0070666_10193411
498 Ga0070666_10208281
499 Ga0070680_100217441
500 Ga0070680_100862323
501 Ga0070680_100937513
502 Ga0070680_100941302
503 Ga0070682_100757214
504 Ga0068868_100024884
505 Ga0068868_100147000
506 Ga0070660_100015001
507 Ga0070660_100068784
508 Ga0070660_100107887
509 Ga0070660_100115838
510 Ga0070660_100170557
511 Ga0070660_101036759
512 Ga0070660_101192019
513 Ga0070687_100106251
514 Ga0070661_100011611
515 Ga0070661_100118743
516 Ga0070661_100120597
517 Ga0070661_100254637
518 Ga0070661_100325891
519 Ga0070661_100365651
520 Ga0070661_100583142
521 Ga0070661_101430904
522 Ga0070661_101938680
523 Ga0070692_10008029
524 Ga0070692_10016005
525 Ga0070692_10069687
526 Ga0070668_100022039
527 Ga0070668_100544512
528 Ga0070669_100036967
529 Ga0070669_100140030
530 Ga0070669_100496753
531 Ga0070675_100017347
532 Ga0070675_101253364
533 Ga0070675_101493444
534 Ga0070671_100000866
535 Ga0070671_100147839
536 Ga0070671_100196846
537 Ga0070674_100059776
538 Ga0070674_100082580
539 Ga0070674_100111426
540 Ga0070673_100029963
541 Ga0070673_100072882
542 Ga0070673_100274689
543 Ga0070673_101316677
544 Ga0070659_100005147
545 Ga0070659_100034853
546 Ga0070659_100044675
547 Ga0070659_100329751
548 Ga0070659_100389646
549 Ga0070659_100794801
550 Ga0070667_100031529
551 Ga0070667_100243972
552 Ga0070667_100264287
553 Ga0070667_101118227
554 Ga0070694_100040059
555 Ga0070663_100222806
556 Ga0070663_100388540
557 Ga0070663_100845258
558 Ga0070678_100003460
559 Ga0070678_100008774
560 Ga0070662_100009922
561 Ga0070662_100011267
562 Ga0070662_100013335
563 Ga0070662_100031671
564 Ga0070662_100076212
565 Ga0070662_100201082
566 Ga0070662_100237020
567 Ga0070681_10063111
568 Ga0070681_10276705
569 Ga0070681_11286978
570 Ga0068867_100020121
571 Ga0068867_100093557
572 Ga0068867_100170969
573 Ga0068867_100932496
574 Ga0068867_101738419
575 Ga0070679_100094881
576 Ga0070679_100211998
577 Ga0070679_100985419
578 Ga0070679_101238253
579 Ga0070684_100050247
580 Ga0068853_100051224
581 Ga0068853_100100007
582 Ga0068853_100248837
583 Ga0068853_100260987
584 Ga0068853_102100201
585 Ga0070672_100009584
586 Ga0070672_100040745
587 Ga0070672_100088437
588 Ga0070672_100169185
589 Ga0070672_101281777
590 Ga0070686_100063234
591 Ga0070686_100126900
592 Ga0070695_100129609
593 Ga0070696_100002969
594 Ga0070696_101417411
595 Ga0070693_100120838
596 Ga0070693_100274337
597 Ga0070665_100105865
598 Ga0070704_100623364
599 Ga0068855_100024916
600 Ga0068855_100082525
601 Ga0068855_100089988
602 Ga0070664_100003026
603 Ga0070664_100004108
604 Ga0070664_100006591
605 Ga0070664_100138485
606 Ga0070664_100168051
607 Ga0070664_100268612
608 Ga0070664_100532750
609 Ga0070664_100953192
610 Ga0068857_100002189
611 Ga0068857_100252035
612 Ga0068857_100795816
613 Ga0068854_100111101
614 Ga0068854_100346504
615 Ga0068856_100063582
616 Ga0070702_101047389
617 Ga0068852_100025514
618 Ga0068852_100032451
619 Ga0068852_100688902
620 Ga0068859_100013237
621 Ga0068859_100037850
622 Ga0068859_100430578
623 Ga0068859_100650680
624 Ga0068864_100022361
625 Ga0068864_100081707
626 Ga0068866_10005188
627 Ga0068866_10215967
628 Ga0068861_100074791
629 Ga0068861_102355829
630 Ga0068851_10018054
631 Ga0068851_10161667
632 Ga0068863_100015881
633 Ga0068863_100024403
634 Ga0068863_100064125
635 Ga0068863_100079639
636 Ga0068863_102196754
637 Ga0068858_100002348
638 Ga0068858_100055846
639 Ga0068860_100003557
640 Ga0068860_100160812
641 Ga0068860_100378290
642 Ga0068862_100010067
643 Ga0068862_100016753
644 Ga0068862_100186233
645 Ga0068862_102342777
646 Ga0097621_100013030
647 Ga0097621_102206123
648 Ga0068871_100005666
649 Ga0068871_100268635
650 Ga0075428_100588541
651 Ga0068865_100001424
652 Ga0068865_101993537
653 Ga0097620_100013239
654 Ga0097620_100037851
655 Ga0097620_100430576
656 Ga0097620_100650811
657 Ga0105240_10122528
658 Ga0105240_10899137
659 Ga0111539_10292579
660 Ga0105245_10019331
661 Ga0114129_11527414
662 Ga0105243_10024746
663 Ga0105243_10425369
664 Ga0105243_10678028
665 Ga0105243_12851954
666 Ga0105241_10114736
667 Ga0105241_10277531
668 Ga0105242_10489383
669 Ga0105248_10044563
670 Ga0105248_10197736
671 Ga0105248_10332785
672 Ga0105248_10860076
673 Ga0105248_12362076
674 Ga0105238_10105363
675 Ga0105249_10021461
676 Ga0105249_10026474
677 Ga0105249_10297614
678 Ga0105249_10763485
679 Ga0105249_11455563
680 Ga0105239_10042112
681 Ga0105239_11128004
682 Ga0105246_10190958
683 Ga0105246_10686742
684 Ga0105246_11372624
685 Ga0157315_1007749
686 Ga0157373_11275804
687 Ga0157371_10011898
688 Ga0157371_10079776
689 Ga0157371_10429716
690 Ga0157371_10833754
691 Ga0157371_10859671
692 Ga0157370_10109351
693 Ga0157369_10025475
694 Ga0157374_10116923
695 Ga0157374_10312604
696 Ga0157378_10182112
697 Ga0157378_11335425
698 Ga0163162_10088341
699 Ga0163162_10154261
700 Ga0163162_10980635
701 Ga0163162_11064545
702 Ga0157372_11269749
703 Ga0157372_12092314
704 Ga0157372_12300387
705 Ga0157375_10281480
706 Ga0157375_12120061
707 Ga0163163_10093474
708 Ga0163163_10808921
709 Ga0157380_10018252
710 Ga0157380_10675354
711 Ga0182008_10710817
712 Ga0157379_10148042
713 Ga0157379_10278365
714 Ga0157379_10783424
715 Ga0157376_10003882
716 Ga0163161_10140702
717 Ga0224712_10476621
718 Ga0207697_10020248
719 Ga0207656_10109893
720 Ga0207682_10001204
721 Ga0207682_10279675
722 Ga0207642_10193347
723 Ga0207688_10064658
724 Ga0207688_10174628
725 Ga0207680_10022791
726 Ga0207680_10263582
727 Ga0207647_10387190
728 Ga0207645_10079621
729 Ga0207645_10288283
730 Ga0207645_10581041
731 Ga0207705_10077360
732 Ga0207705_10101837
733 Ga0207705_10175791
734 Ga0207705_10213857
735 Ga0207707_10865422
736 Ga0207695_10487491
737 Ga0207660_11588124
738 Ga0207657_10020046
739 Ga0207657_10021739
740 Ga0207657_10026681
741 Ga0207657_10136624
742 Ga0207649_10017891
743 Ga0207649_10029155
744 Ga0207649_10535357
745 Ga0207649_10746772
746 Ga0207652_10191010
747 Ga0207652_10721322
748 Ga0207681_10035367
749 Ga0207694_10174361
750 Ga0207650_10081068
751 Ga0207650_10268459
752 Ga0207659_10032231
753 Ga0207659_10434818
754 Ga0207687_10414331
755 Ga0207687_11632263
756 Ga0207644_10001103
757 Ga0207644_10043002
758 Ga0207644_10122017
759 Ga0207690_10140316
760 Ga0207690_10145882
761 Ga0207690_10335566
762 Ga0207706_10006865
763 Ga0207706_10015694
764 Ga0207706_10049976
765 Ga0207706_10132255
766 Ga0207706_10464456
767 Ga0207706_10783179
768 Ga0207686_10228229
769 Ga0207709_10373253
770 Ga0207669_10007101
771 Ga0207669_10743224
772 Ga0207704_10342826
773 Ga0207691_10014251
774 Ga0207691_10055543
775 Ga0207691_10082960
776 Ga0207711_10007160
777 Ga0207711_10047302
778 Ga0207711_10268578
779 Ga0207679_10183587
780 Ga0207679_10963674
781 Ga0207679_11073854
782 Ga0207651_10008035
783 Ga0207651_10877957
784 Ga0207651_11109267
785 Ga0207668_10013440
786 Ga0207668_10033122
787 Ga0207668_10155558
788 Ga0207640_10141564
789 Ga0207640_10156815
790 Ga0207658_10107463
791 Ga0207658_10177607
792 Ga0207658_10188689
793 Ga0207658_11062805
794 Ga0207677_10066798
795 Ga0207703_10027296
796 Ga0207639_10036739
797 Ga0207639_10583015
798 Ga0207639_11024950
799 Ga0207678_10003992
800 Ga0207678_11259499
801 Ga0207702_10368541
802 Ga0207702_11107425
803 Ga0207702_11501155
804 Ga0207641_10064867
805 Ga0207641_10281454
806 Ga0207648_10020517
807 Ga0207648_10303784
808 Ga0207648_11564487
809 Ga0207674_11389659
810 Ga0207683_10002763
811 Ga0207683_10052050
812 Ga0207683_10629497
813 Ga0207698_10006707
814 Ga0207698_12535580
815 Ga0268265_10003724
816 Ga0268265_11408857
817 Ga0268265_11519237
818 Ga0268264_10444459
819 Ga0268264_10747498
820 Ga0307513_10504345
821 Ga0307408_100331310
822 Ga0307405_10162711
823 Ga0307405_11519128
824 Ga0307413_10081843
825 Ga0307413_10293731
826 Ga0307410_10000365
827 Ga0307410_10246541
828 Ga0307406_10782456
829 Ga0307407_10109875
830 Ga0307407_10296377
831 Ga0307412_12258245
832 Ga0307409_100044755
833 Ga0307409_100459095
834 Ga0307409_101168228
835 Ga0307416_100009695
836 Ga0307416_100017708
837 Ga0307416_100277165
838 Ga0307416_102792994
839 Ga0307414_11597677
840 Ga0307411_10001018
841 Ga0307415_100001082
842 Ga0307415_100129072
843 Ga0307415_100169430
844 Ga0373930_0068565
845 Ga0373940_0140169
846 Ga0373960_0160354
847 Ga0373931_0087294
848 Ga0395899_0038519
849 Ga0395899_0044788
850 Ga0395899_0059381
851 Ga0395899_0458452
852 Ga0395899_0514500
853 Ga0395899_0581002
854 Ga0395900_0016178
855 Ga0395900_0106919
856 Ga0395900_0257566
857 Ga0395898_0064367
858 Ga0395898_0074343
859 Ga0395898_0391213
860 Ga0395905_0006012
861 Ga0395905_0015442
862 Ga0395905_0051705
863 Ga0395905_0056589
864 Ga0395905_0121364
865 Ga0395905_0130362
866 Ga0395905_0154472
867 Ga0395905_0182532
868 Ga0395905_0301272
869 Ga0395905_0363221
870 Ga0395905_0564245
871 Ga0395905_1320953
872 Ga0395905_1518229
873 Ga0395901_0008128
874 Ga0395901_0271280
875 Ga0395901_0468453
876 Ga0395901_0574687
877 Ga0395901_0608213
878 Ga0395901_1498503
879 Ga0451843_0955937
880 Ga0439464_0000350
881 Ga0466972_0080474
882 Ga0466965_0051100
883 Ga0466966_0046090
884 Ga0466961_0068555
885 Ga0466963_0102011
886 Ga0466963_0450937
887 Ga0466963_0707353
888 Ga0466971_0053609
889 Ga0466968_0615518
890 Ga0466970_0128660
891 Ga0466970_0948237
892 Ga0466957_0094016
893 Ga0466959_0377268
894 Ga0466958_0035724
895 Ga0466967_0259618
896 Ga0495668_0050557
897 Ga0495670_0705858
898 Ga0495672_0201175
899 Ga0495677_0047340
900 Ga0496100_0006995
901 Ga0496100_0667662
902 Ga0496102_0144054
903 Ga0496103_0360178
904 Ga0496103_0451750
905 Ga0496106_0111285
906 Ga0496106_1319797
907 Ga0496107_0008263
908 Ga0496107_0144468
909 Ga0496107_0170308
910 Ga0496107_1102636
911 Ga0496108_0148879
912 Ga0496111_0510238
913 Ga0496112_0117027
914 Ga0496113_0098386
915 Ga0496114_0177882
916 Ga0501069_0475559
917 nmdc:mga03683_409252_c1
918 Ga0500658_0000036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map