F448316

General Info

Members Datasets Scaffolds Average Seq Length
459 246 442 139

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100606202|Ga0070694_1006062022
Length 154
Sequence MRQAQHALTVATKGKGLVEITPQVKHWVAEQGIATGLLTLYCRHTSASLLIQENADPDVQRDLQDFFDAIAPESGKYVHDTEGPDDMPAHIRTALTHTSLSIPVRPADERQRVSGGAKSNSSGTLALGTWQGIYLFEHRRAPHQREVVLHLIGE

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
4 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
5 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
6 2831426010 Nostoc sp. 106C Isolate Unclassified
7 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
8 2849660919 Nostoc sp. T09 Isolate Unclassified
9 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
10 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
11 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
12 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
13 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
14 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
15 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
246 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0.44
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0.65
Rhizoplane 3.49
Rhizosphere 89.76
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1010853 3300001915 Bacteria 1613
2 JGI24740J21852_10004737 3300001979 Bacteria 5815
3 JGI24739J22299_10000928 3300001989 Bacteria 10913
4 JGI24739J22299_10081930 3300001989 Bacteria 990
5 JGI24737J22298_10000096 3300001990 Bacteria 25937
6 JGI24737J22298_10028243 3300001990 Bacteria 1764
7 JGI24743J22301_10022773 3300001991 Bacteria 1202
8 JGI24735J21928_10020165 3300002067 Bacteria 2044
9 JGI24735J21928_10021731 3300002067 Bacteria 1957
10 JGI24738J21930_10001101 3300002075 Bacteria 7646
11 JGI24738J21930_10047796 3300002075 Bacteria 871
12 JGI24035J26624_1043476 3300002126 Bacteria 505
13 JGI24034J26672_10092046 3300002239 Bacteria 564
14 Ga0070658_10016606 3300005327 Bacteria 5890
15 Ga0070658_10339125 3300005327 Bacteria 1285
16 Ga0070676_10334718 3300005328 Bacteria 1036
17 Ga0070683_100775499 3300005329 Bacteria 919
18 Ga0070683_101436801 3300005329 Bacteria 663
19 Ga0070690_100009203 3300005330 Bacteria 5717
20 Ga0070670_100009494 3300005331 Bacteria 8304
21 Ga0070670_100299428 3300005331 Bacteria 1406
22 Ga0068869_100005113 3300005334 Bacteria 8228
23 Ga0068869_101060414 3300005334 Bacteria 708
24 Ga0070666_10024820 3300005335 Bacteria 3907
25 Ga0070666_10055418 3300005335 Bacteria 2676
26 Ga0070680_100003978 3300005336 Bacteria 11061
27 Ga0070680_100011452 3300005336 Bacteria 6862
28 Ga0070680_100328020 3300005336 Bacteria 1300
29 Ga0070682_100006846 3300005337 Bacteria 6401
30 Ga0070682_101430856 3300005337 Bacteria 592
31 Ga0068868_100001325 3300005338 Bacteria 17065
32 Ga0070660_100021042 3300005339 Bacteria 4803
33 Ga0070660_100218345 3300005339 Bacteria 1549
34 Ga0070660_100761141 3300005339 Bacteria 813
35 Ga0070689_100076272 3300005340 Bacteria 2626
36 Ga0070661_100037011 3300005344 Bacteria 3549
37 Ga0070661_100236377 3300005344 Bacteria 1405
38 Ga0070661_100258199 3300005344 Bacteria 1346
39 Ga0070661_100295309 3300005344 Bacteria 1260
40 Ga0070661_100461357 3300005344 Bacteria 1012
41 Ga0070692_10168074 3300005345 Bacteria 1262
42 Ga0070668_100009651 3300005347 Bacteria 7160
43 Ga0070669_100017178 3300005353 Bacteria 5162
44 Ga0070675_100217049 3300005354 Bacteria 1664
45 Ga0070671_100007754 3300005355 Bacteria 8576
46 Ga0070671_100017425 3300005355 Bacteria 5818
47 Ga0070671_100100172 3300005355 Bacteria 2431
48 Ga0070674_100164776 3300005356 Bacteria 1685
49 Ga0070673_100000119 3300005364 Bacteria 36566
50 Ga0070673_100094281 3300005364 Bacteria 2453
51 Ga0070673_100256896 3300005364 Bacteria 1525
52 Ga0070688_101483326 3300005365 Bacteria 551
53 Ga0070659_100024422 3300005366 Bacteria 4634
54 Ga0070659_100310179 3300005366 Bacteria 1317
55 Ga0070659_100493067 3300005366 Bacteria 1043
56 Ga0070659_100970080 3300005366 Bacteria 745
57 Ga0070667_100001485 3300005367 Bacteria 21024
58 Ga0070667_100002546 3300005367 Bacteria 15864
59 Ga0070667_100280334 3300005367 Bacteria 1496
60 Ga0070714_101415084 3300005435 Bacteria 679
61 Ga0070705_100057183 3300005440 Bacteria 2300
62 Ga0070694_100606202 3300005444 Bacteria 882
63 Ga0070663_100032317 3300005455 Bacteria 3606
64 Ga0070663_100094109 3300005455 Bacteria 2224
65 Ga0070663_100094678 3300005455 Bacteria 2218
66 Ga0070663_100137542 3300005455 Bacteria 1861
67 Ga0070663_100366980 3300005455 Bacteria 1169
68 Ga0070663_100503963 3300005455 Bacteria 1006
69 Ga0070662_100003418 3300005457 Bacteria 9898
70 Ga0070662_100121110 3300005457 Bacteria 2005
71 Ga0070662_100391760 3300005457 Bacteria 1145
72 Ga0070662_100422339 3300005457 Bacteria 1103
73 Ga0070662_100437245 3300005457 Bacteria 1084
74 Ga0070681_10001207 3300005458 Bacteria 22475
75 Ga0070681_10041401 3300005458 Bacteria 4617
76 Ga0070681_10425088 3300005458 Bacteria 1241
77 Ga0070681_10517913 3300005458 Bacteria 1106
78 Ga0070681_11022165 3300005458 Bacteria 747
79 Ga0068867_100002637 3300005459 Bacteria 12650
80 Ga0068867_100006215 3300005459 Bacteria 8457
81 Ga0068867_100111101 3300005459 Bacteria 2106
82 Ga0070685_10288064 3300005466 Bacteria 1102
83 Ga0070679_100000144 3300005530 Bacteria 57843
84 Ga0070679_100095997 3300005530 Bacteria 2952
85 Ga0070684_100198706 3300005535 Bacteria 1826
86 Ga0070684_100812599 3300005535 Bacteria 874
87 Ga0070697_100001411 3300005536 Bacteria 18247
88 Ga0068853_100000268 3300005539 Bacteria 36709
89 Ga0068853_100001426 3300005539 Bacteria 17252
90 Ga0068853_100001890 3300005539 Bacteria 15430
91 Ga0068853_100083128 3300005539 Bacteria 2805
92 Ga0068853_100210021 3300005539 Bacteria 1774
93 Ga0070672_100000263 3300005543 Bacteria 29693
94 Ga0070695_100115159 3300005545 Bacteria 1831
95 Ga0070695_100149947 3300005545 Bacteria 1626
96 Ga0070696_100053100 3300005546 Bacteria 2820
97 Ga0070693_100006141 3300005547 Bacteria 5820
98 Ga0070693_100135356 3300005547 Bacteria 1545
99 Ga0070693_100206128 3300005547 Bacteria 1280
100 Ga0070665_100072036 3300005548 Bacteria 3463
101 Ga0070665_100123474 3300005548 Bacteria 2591
102 Ga0070665_100338387 3300005548 Bacteria 1509
103 Ga0070665_100443835 3300005548 Bacteria 1307
104 Ga0070665_100914111 3300005548 Bacteria 890
105 Ga0070665_101030624 3300005548 Bacteria 835
106 Ga0070704_100089182 3300005549 Bacteria 2293
107 Ga0070704_101198513 3300005549 Unclassified 692
108 Ga0068855_100017738 3300005563 Bacteria 8557
109 Ga0070664_100092931 3300005564 Bacteria 2613
110 Ga0070664_100109273 3300005564 Bacteria 2412
111 Ga0070664_100540337 3300005564 Bacteria 1077
112 Ga0068857_100001463 3300005577 Bacteria 18768
113 Ga0068857_100009928 3300005577 Bacteria 8263
114 Ga0068857_100042343 3300005577 Bacteria 4039
115 Ga0068857_100126777 3300005577 Bacteria 2300
116 Ga0068854_100000618 3300005578 Bacteria 21000
117 Ga0068854_100002054 3300005578 Bacteria 12331
118 Ga0068854_100645029 3300005578 Bacteria 908
119 Ga0068856_100018655 3300005614 Bacteria 6724
120 Ga0068856_101266209 3300005614 Bacteria 753
121 Ga0068852_100007297 3300005616 Bacteria 8059
122 Ga0068852_100021777 3300005616 Bacteria 5126
123 Ga0068852_100750571 3300005616 Bacteria 988
124 Ga0068852_100762728 3300005616 Bacteria 980
125 Ga0068859_100003026 3300005617 Bacteria 17047
126 Ga0068859_100035113 3300005617 Bacteria 5030
127 Ga0068864_100000340 3300005618 Bacteria 41244
128 Ga0068864_100003799 3300005618 Bacteria 12449
129 Ga0068864_100292424 3300005618 Bacteria 1523
130 Ga0068866_10065415 3300005718 Bacteria 1902
131 Ga0068861_101688789 3300005719 Bacteria 626
132 Ga0068861_102535773 3300005719 Unclassified 516
133 Ga0068851_10216422 3300005834 Bacteria 1075
134 Ga0068851_10230062 3300005834 Bacteria 1045
135 Ga0068851_10260510 3300005834 Bacteria 986
136 Ga0068851_10409659 3300005834 Bacteria 799
137 Ga0068870_10287428 3300005840 Bacteria 1033
138 Ga0068863_100012356 3300005841 Bacteria 8246
139 Ga0068863_100028286 3300005841 Bacteria 5353
140 Ga0068858_100005497 3300005842 Bacteria 12408
141 Ga0068858_100023339 3300005842 Bacteria 5764
142 Ga0068858_100238871 3300005842 Bacteria 1723
143 Ga0068860_100390053 3300005843 Bacteria 1376
144 Ga0075363_100419993 3300006048 Bacteria 787
145 Ga0075366_10132910 3300006195 Bacteria 1502
146 Ga0097621_100298177 3300006237 Bacteria 1423
147 Ga0097621_101643781 3300006237 Bacteria 611
148 Ga0068871_100075757 3300006358 Bacteria 2778
149 Ga0068871_101377733 3300006358 Unclassified 664
150 Ga0068865_100001589 3300006881 Bacteria 13286
151 Ga0075436_100001197 3300006914 Bacteria 17624
152 Ga0097620_100003026 3300006931 Bacteria 17047
153 Ga0097620_100035116 3300006931 Bacteria 5030
154 Ga0105251_10166644 3300009011 Bacteria 993
155 Ga0105240_10001734 3300009093 Bacteria 36806
156 Ga0105240_11819107 3300009093 Bacteria 634
157 Ga0105245_10000530 3300009098 Bacteria 34999
158 Ga0105247_11177908 3300009101 Unclassified 609
159 Ga0105241_10024296 3300009174 Bacteria 4501
160 Ga0105241_10041837 3300009174 Bacteria 3463
161 Ga0105241_10095451 3300009174 Bacteria 2354
162 Ga0105248_10025485 3300009177 Bacteria 6576
163 Ga0105248_11692198 3300009177 Bacteria 717
164 Ga0105237_10051321 3300009545 Bacteria 4143
165 Ga0105237_10608271 3300009545 Bacteria 1100
166 Ga0105237_12519220 3300009545 Bacteria 525
167 Ga0105238_10305549 3300009551 Bacteria 1575
168 Ga0105238_11173562 3300009551 Bacteria 792
169 Ga0105249_10030552 3300009553 Bacteria 4871
170 Ga0105239_10057077 3300010375 Bacteria 4282
171 Ga0105239_10454330 3300010375 Bacteria 1453
172 Ga0105239_10486155 3300010375 Bacteria 1403
173 Ga0105246_10035492 3300011119 Bacteria 3333
174 Ga0105246_10138529 3300011119 Bacteria 1827
175 Ga0157373_10016795 3300013100 Bacteria 5335
176 Ga0157373_10114878 3300013100 Bacteria 1893
177 Ga0157373_10190203 3300013100 Bacteria 1446
178 Ga0157373_10198513 3300013100 Bacteria 1414
179 Ga0157371_10009244 3300013102 Bacteria 7776
180 Ga0157371_10028204 3300013102 Bacteria 4067
181 Ga0157371_10102836 3300013102 Bacteria 2027
182 Ga0157370_10009046 3300013104 Bacteria 10687
183 Ga0157370_10053187 3300013104 Bacteria 3862
184 Ga0157370_10059136 3300013104 Bacteria 3643
185 Ga0157370_10223704 3300013104 Bacteria 1743
186 Ga0157369_10019284 3300013105 Bacteria 7630
187 Ga0157369_10089584 3300013105 Bacteria 3284
188 Ga0157369_10836569 3300013105 Bacteria 945
189 Ga0157374_10375091 3300013296 Bacteria 1416
190 Ga0157374_10460595 3300013296 Bacteria 1273
191 Ga0157378_10020190 3300013297 Bacteria 5860
192 Ga0157378_10163398 3300013297 Bacteria 2084
193 Ga0163162_10041930 3300013306 Bacteria 4580
194 Ga0157372_10009232 3300013307 Bacteria 10485
195 Ga0157372_10079099 3300013307 Bacteria 3717
196 Ga0157372_10156016 3300013307 Bacteria 2637
197 Ga0157372_10252081 3300013307 Bacteria 2049
198 Ga0157372_10513370 3300013307 Bacteria 1397
199 Ga0157372_10642533 3300013307 Bacteria 1236
200 Ga0157372_10901713 3300013307 Bacteria 1026
201 Ga0157375_10028294 3300013308 Bacteria 5251
202 Ga0157375_11608861 3300013308 Bacteria 768
203 Ga0163163_10104402 3300014325 Bacteria 2859
204 Ga0163163_10140834 3300014325 Bacteria 2454
205 Ga0157380_12302741 3300014326 Bacteria 603
206 Ga0182008_10009329 3300014497 Bacteria 5302
207 Ga0182008_10024073 3300014497 Bacteria 3102
208 Ga0157377_11108234 3300014745 Bacteria 607
209 Ga0157379_10009568 3300014968 Bacteria 8440
210 Ga0163161_11004327 3300017792 Bacteria 712
211 Ga0206356_10628829 3300020070 Bacteria 1300
212 Ga0213872_10069868 3300021361 Bacteria 1584
213 Ga0213874_10002577 3300021377 Bacteria 3919
214 Ga0213874_10004609 3300021377 Bacteria 3164
215 Ga0213875_10004858 3300021388 Bacteria 7298
216 Ga0213875_10027922 3300021388 Bacteria 2684
217 Ga0209455_1000614 3300025272 Bacteria 22641
218 Ga0207697_10000058 3300025315 Bacteria 45446
219 Ga0207656_10006327 3300025321 Bacteria 4245
220 Ga0207656_10140015 3300025321 Bacteria 1140
221 Ga0207656_10668158 3300025321 Bacteria 531
222 Ga0207642_10120077 3300025899 Bacteria 1354
223 Ga0207710_10490277 3300025900 Unclassified 637
224 Ga0207688_10001088 3300025901 Bacteria 13933
225 Ga0207680_10008489 3300025903 Bacteria 5045
226 Ga0207680_10087451 3300025903 Bacteria 1973
227 Ga0207680_10135761 3300025903 Bacteria 1626
228 Ga0207647_10000579 3300025904 Bacteria 28504
229 Ga0207647_10019879 3300025904 Bacteria 4509
230 Ga0207645_10024719 3300025907 Bacteria 3891
231 Ga0207645_10313589 3300025907 Bacteria 1045
232 Ga0207705_10043261 3300025909 Bacteria 3235
233 Ga0207705_10103271 3300025909 Bacteria 2099
234 Ga0207705_10351142 3300025909 Bacteria 1136
235 Ga0207654_10036634 3300025911 Bacteria 2742
236 Ga0207654_10094424 3300025911 Bacteria 1830
237 Ga0207707_10002795 3300025912 Bacteria 15563
238 Ga0207707_10003731 3300025912 Bacteria 13491
239 Ga0207707_10134424 3300025912 Bacteria 2163
240 Ga0207707_10247824 3300025912 Bacteria 1548
241 Ga0207707_10282255 3300025912 Bacteria 1438
242 Ga0207695_10009746 3300025913 Bacteria 11822
243 Ga0207671_10110310 3300025914 Bacteria 2093
244 Ga0207671_10436616 3300025914 Bacteria 1042
245 Ga0207660_10045377 3300025917 Bacteria 3096
246 Ga0207660_10161477 3300025917 Bacteria 1729
247 Ga0207657_10008413 3300025919 Bacteria 10474
248 Ga0207657_10009319 3300025919 Bacteria 9884
249 Ga0207657_10011086 3300025919 Bacteria 8958
250 Ga0207657_10022457 3300025919 Bacteria 5901
251 Ga0207657_10051001 3300025919 Bacteria 3598
252 Ga0207657_10229727 3300025919 Bacteria 1484
253 Ga0207649_10008803 3300025920 Bacteria 5508
254 Ga0207649_10261288 3300025920 Bacteria 1251
255 Ga0207649_10359086 3300025920 Bacteria 1080
256 Ga0207652_10017613 3300025921 Bacteria 5847
257 Ga0207652_10021328 3300025921 Bacteria 5347
258 Ga0207681_10157621 3300025923 Bacteria 1707
259 Ga0207694_10195234 3300025924 Bacteria 1646
260 Ga0207650_10014407 3300025925 Bacteria 5497
261 Ga0207650_10531759 3300025925 Bacteria 984
262 Ga0207659_10229966 3300025926 Bacteria 1495
263 Ga0207687_10023042 3300025927 Bacteria 4147
264 Ga0207664_10973821 3300025929 Bacteria 760
265 Ga0207644_10071675 3300025931 Bacteria 2535
266 Ga0207644_10149106 3300025931 Bacteria 1808
267 Ga0207690_10014208 3300025932 Bacteria 4805
268 Ga0207690_10050708 3300025932 Bacteria 2772
269 Ga0207690_10150413 3300025932 Bacteria 1725
270 Ga0207706_10000674 3300025933 Bacteria 35850
271 Ga0207706_10006830 3300025933 Bacteria 10548
272 Ga0207706_10214474 3300025933 Bacteria 1686
273 Ga0207706_10332804 3300025933 Bacteria 1321
274 Ga0207706_10559887 3300025933 Bacteria 984
275 Ga0207706_10902806 3300025933 Bacteria 746
276 Ga0207670_10061560 3300025936 Bacteria 2562
277 Ga0207669_10131363 3300025937 Bacteria 1721
278 Ga0207704_10025007 3300025938 Bacteria 3251
279 Ga0207691_10000407 3300025940 Bacteria 43061
280 Ga0207711_10023610 3300025941 Bacteria 5149
281 Ga0207689_10000104 3300025942 Bacteria 69092
282 Ga0207689_10189708 3300025942 Bacteria 1696
283 Ga0207661_10098126 3300025944 Bacteria 2455
284 Ga0207661_10709627 3300025944 Bacteria 925
285 Ga0207679_10113381 3300025945 Bacteria 2144
286 Ga0207679_10268831 3300025945 Bacteria 1457
287 Ga0207667_10106753 3300025949 Bacteria 2888
288 Ga0207667_10700321 3300025949 Bacteria 1015
289 Ga0207667_11190264 3300025949 Bacteria 742
290 Ga0207651_10000929 3300025960 Bacteria 12917
291 Ga0207712_10020628 3300025961 Bacteria 4319
292 Ga0207668_10021827 3300025972 Bacteria 4088
293 Ga0207640_10002948 3300025981 Bacteria 9155
294 Ga0207640_10006040 3300025981 Bacteria 6619
295 Ga0207640_10265937 3300025981 Bacteria 1339
296 Ga0207640_10298802 3300025981 Bacteria 1273
297 Ga0207658_10008279 3300025986 Bacteria 7082
298 Ga0207658_10075801 3300025986 Bacteria 2560
299 Ga0207658_10590289 3300025986 Bacteria 997
300 Ga0207658_11289782 3300025986 Bacteria 668
301 Ga0207677_10010783 3300026023 Bacteria 5182
302 Ga0207677_10045126 3300026023 Bacteria 2942
303 Ga0207703_10032642 3300026035 Bacteria 4121
304 Ga0207703_10090879 3300026035 Bacteria 2566
305 Ga0207639_10025338 3300026041 Bacteria 4300
306 Ga0207639_10180116 3300026041 Bacteria 1797
307 Ga0207639_10257816 3300026041 Bacteria 1524
308 Ga0207639_10654091 3300026041 Bacteria 972
309 Ga0207678_10019594 3300026067 Bacteria 5947
310 Ga0207678_10096685 3300026067 Bacteria 2524
311 Ga0207678_10411331 3300026067 Bacteria 1172
312 Ga0207702_10020524 3300026078 Bacteria 5469
313 Ga0207702_10072048 3300026078 Bacteria 2977
314 Ga0207641_10006935 3300026088 Bacteria 9480
315 Ga0207648_10000141 3300026089 Bacteria 71670
316 Ga0207648_10015692 3300026089 Bacteria 6951
317 Ga0207648_10033965 3300026089 Bacteria 4498
318 Ga0207676_10006604 3300026095 Bacteria 8204
319 Ga0207676_10169312 3300026095 Bacteria 1901
320 Ga0207676_10510815 3300026095 Bacteria 1142
321 Ga0207674_10002371 3300026116 Bacteria 23818
322 Ga0207674_10003499 3300026116 Bacteria 19175
323 Ga0207674_10020667 3300026116 Bacteria 7106
324 Ga0207674_10586071 3300026116 Bacteria 1077
325 Ga0207675_102288410 3300026118 Unclassified 554
326 Ga0207698_10011259 3300026142 Bacteria 5791
327 Ga0207698_10018188 3300026142 Bacteria 4783
328 Ga0207698_10073027 3300026142 Bacteria 2730
329 Ga0207698_10742709 3300026142 Bacteria 980
330 Ga0268266_10044313 3300028379 Bacteria 3803
331 Ga0268266_10132919 3300028379 Bacteria 2227
332 Ga0268266_10171177 3300028379 Bacteria 1971
333 Ga0268266_10350668 3300028379 Bacteria 1387
334 Ga0268266_10698248 3300028379 Bacteria 978
335 Ga0268264_10029006 3300028381 Bacteria 4530
336 Ga0268264_10362726 3300028381 Bacteria 1383
337 Ga0265337_1108842 3300028556 Bacteria 753
338 Ga0265318_10000025 3300028577 Bacteria 159237
339 Ga0265338_10039617 3300028800 Bacteria 4442
340 Ga0265340_10005875 3300031247 Bacteria 6790
341 Ga0307413_10823892 3300031824 Bacteria 782
342 Ga0307409_101586322 3300031995 Bacteria 682
343 Ga0373934_0370605 3300035086 Bacteria 597
344 Ga0373923_0027715 3300035111 Bacteria 2261
345 Ga0373923_0092899 3300035111 Bacteria 1322
346 Ga0373923_0124028 3300035111 Bacteria 1156
347 Ga0373941_0488487 3300035115 Bacteria 522
348 Ga0373945_0092849 3300035116 Bacteria 1171
349 Ga0373943_0010604 3300035170 Bacteria 4134
350 Ga0373946_0062418 3300035171 Bacteria 1589
351 Ga0373946_0063402 3300035171 Bacteria 1578
352 Ga0373935_0025317 3300035692 Bacteria 3657
353 Ga0373933_0166041 3300035724 Bacteria 1403
354 Ga0373947_0019409 3300035725 Bacteria 3920
355 Ga0373937_0025336 3300036401 Bacteria 5354
356 Ga0373937_0106964 3300036401 Bacteria 2600
357 Ga0373937_0133439 3300036401 Bacteria 2320
358 Ga0373925_0018475 3300037068 Bacteria 5067
359 Ga0395899_0000251 3300037312 Bacteria 71228
360 Ga0395899_0055802 3300037312 Bacteria 2921
361 Ga0395900_0000084 3300037418 Bacteria 172593
362 Ga0395900_0004890 3300037418 Bacteria 14112
363 Ga0395900_0007563 3300037418 Bacteria 11220
364 Ga0395900_0309035 3300037418 Bacteria 1564
365 Ga0395900_1245014 3300037418 Bacteria 659
366 Ga0395898_0000021 3300037466 Bacteria 393971
367 Ga0395898_0109758 3300037466 Bacteria 2644
368 Ga0395898_0866631 3300037466 Bacteria 842
369 Ga0395905_0000006 3300037471 Bacteria 549428
370 Ga0395905_0004884 3300037471 Bacteria 13816
371 Ga0395905_0024241 3300037471 Bacteria 5727
372 Ga0395905_0057817 3300037471 Bacteria 3627
373 Ga0395905_0077057 3300037471 Bacteria 3124
374 Ga0395905_0297527 3300037471 Bacteria 1501
375 Ga0436364_1281128 3300037853 Bacteria 12594
376 Ga0395901_0000914 3300038443 Bacteria 32244
377 Ga0395901_0010957 3300038443 Bacteria 9185
378 Ga0395901_0031883 3300038443 Bacteria 5434
379 Ga0395901_0221067 3300038443 Bacteria 1979
380 Ga0395901_0239515 3300038443 Bacteria 1892
381 Ga0436365_0440689 3300039437 Bacteria 723
382 Ga0436365_1028162 3300039437 Bacteria 5098
383 Ga0436365_1264065 3300039437 Bacteria 2193
384 Ga0436363_0983054 3300039450 Bacteria 6450
385 Ga0436363_1255805 3300039450 Bacteria 20109
386 Ga0466969_0009346 3300044656 Bacteria 5197
387 Ga0466969_0025741 3300044656 Bacteria 3022
388 Ga0466966_0164377 3300044684 Bacteria 1350
389 Ga0466961_0054390 3300044693 Bacteria 2553
390 Ga0453684_0050275 3300044712 Bacteria 5486
391 Ga0466968_0602717 3300044735 Bacteria 555
392 Ga0466970_0031121 3300044765 Bacteria 2817
393 Ga0466970_0160226 3300044765 Bacteria 1244
394 Ga0466959_0001061 3300045049 Bacteria 16448
395 Ga0466967_0174346 3300045976 Bacteria 2025
396 Ga0495607_0015619 3300046501 Bacteria 4918
397 Ga0495606_0107113 3300046507 Bacteria 1691
398 Ga0495610_0321201 3300046512 Bacteria 591
399 Ga0495668_0101102 3300046616 Bacteria 1577
400 Ga0495660_0111287 3300046810 Bacteria 1397
401 Ga0495687_041529 3300047443 Bacteria 2017
402 Ga0496101_0154709 3300048904 Bacteria 1756
403 Ga0496102_0009990 3300048905 Bacteria 8159
404 Ga0496103_0021230 3300048906 Bacteria 3906
405 Ga0496105_0142296 3300048908 Bacteria 1974
406 Ga0496106_0076295 3300048909 Bacteria 2569
407 Ga0496107_0093362 3300048910 Bacteria 2200
408 Ga0496108_0001276 3300048911 Bacteria 19719
409 Ga0496109_0003518 3300048912 Bacteria 13080
410 Ga0496109_0162189 3300048912 Bacteria 2095
411 Ga0496109_0948565 3300048912 Bacteria 798
412 Ga0496110_0034170 3300048913 Bacteria 4403
413 Ga0496111_0016034 3300048914 Bacteria 5156
414 Ga0496112_0021889 3300048915 Bacteria 6084
415 Ga0496112_0108685 3300048915 Bacteria 2744
416 Ga0496112_0795418 3300048915 Bacteria 871
417 Ga0496115_0292348 3300048918 Bacteria 1336
418 Ga0496117_0028333 3300048920 Bacteria 4341
419 Ga0496118_0037306 3300048921 Bacteria 3914
420 Ga0501036_1519483 3300049572 Bacteria 541
421 Ga0501037_0088405 3300049573 Bacteria 2242
422 Ga0501038_0203588 3300049574 Bacteria 1587
423 Ga0501038_0485319 3300049574 Bacteria 946
424 Ga0501039_0891707 3300049575 Bacteria 692
425 Ga0501047_0771974 3300049581 Bacteria 776
426 Ga0501048_0157639 3300049582 Bacteria 1606
427 Ga0501067_0000378 3300049583 Bacteria 24283
428 Ga0501067_0666584 3300049583 Bacteria 584
429 Ga0501070_0135609 3300049586 Bacteria 2033
430 Ga0501072_0002246 3300049588 Bacteria 14418
431 Ga0501073_0005770 3300049589 Bacteria 9253
432 Ga0501073_0185990 3300049589 Bacteria 1438
433 Ga0501074_0225265 3300049590 Bacteria 1335
434 Ga0501080_0947426 3300049742 Bacteria 748
435 nmdc:mga0k408_66207_c1 3300050493 Bacteria 2104
436 nmdc:mga07m45_424412_c1 3300050496 Bacteria 771
437 nmdc:mga0rr50_988835_c1 3300050513 Bacteria 717
438 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
439 Ga0500577_0070696 3300053142 Bacteria 1368
440 Ga0500645_000355 3300053730 Bacteria 32606
441 Ga0587111_0115842 3300060346 Unclassified 685
442 Ga0501082_0038414 3300060353 Bacteria 4131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10454330 Ga0105239_104543303 114
2 3300009177 Ga0105248_11692198 Ga0105248_116921981 115
3 3300025909 Ga0207705_10043261 Ga0207705_100432613 117
4 3300005366 Ga0070659_100970080 Ga0070659_1009700802 118
5 3300005458 Ga0070681_10425088 Ga0070681_104250881 118
6 3300005535 Ga0070684_100812599 Ga0070684_1008125992 118
7 3300026078 Ga0207702_10072048 Ga0207702_100720482 118
8 3300009093 Ga0105240_11819107 Ga0105240_118191072 123
9 3300028556 Ga0265337_1108842 Ga0265337_11088422 123
10 3300039437 Ga0436365_0440689 Ga0436365_0440689_137_529 130
11 3300005458 Ga0070681_11022165 Ga0070681_110221651 131
12 iso_pu_bacteria 2617270889 2617916646 133
13 iso_pu_bacteria 2831426010 2831429020 133
14 iso_pu_bacteria 2848694841 2848698584 133
15 iso_pu_bacteria 2849660919 2849666676 133
16 iso_pu_bacteria 2886627955 2886630555 133
17 iso_pu_bacteria 2913844669 2913850070 133
18 iso_pu_bacteria 2913912277 2913913351 133
19 iso_pu_bacteria 2913939268 2913940088 133
20 iso_pu_bacteria 642555144 642600642 133
21 iso_pu_bacteria 2896253425 2896254430 134
22 iso_pu_bacteria 2501025502 2501083079 135
23 iso_pu_bacteria 2510917013 2511090949 135
24 iso_pu_bacteria 2513237082 2513555475 135
25 iso_pu_bacteria 2513237083 2513562750 135
26 iso_pu_bacteria 2856287931 2856287960 135
27 iso_pu_bacteria 2857357740 2857358414 135
28 iso_pu_bacteria 8003955200 8003959851 135
29 3300035111 Ga0373923_0027715 Ga0373923_0027715_1232_1645 137
30 3300035111 Ga0373923_0124028 Ga0373923_0124028_644_1057 137
31 3300035171 Ga0373946_0062418 Ga0373946_0062418_311_724 137
32 3300036401 Ga0373937_0106964 Ga0373937_0106964_1516_1929 137
33 3300036401 Ga0373937_0133439 Ga0373937_0133439_676_1089 137
34 3300044712 Ga0453684_0050275 Ga0453684_0050275_2290_2703 137
35 3300049572 Ga0501036_1519483 Ga0501036_1519483_75_494 137
36 3300049573 Ga0501037_0088405 Ga0501037_0088405_720_1139 137
37 3300049574 Ga0501038_0485319 Ga0501038_0485319_329_748 137
38 3300049575 Ga0501039_0891707 Ga0501039_0891707_53_472 137
39 3300049581 Ga0501047_0771974 Ga0501047_0771974_23_442 137
40 3300049582 Ga0501048_0157639 Ga0501048_0157639_677_1096 137
41 3300049583 Ga0501067_0666584 Ga0501067_0666584_21_440 137
42 3300001979 JGI24740J21852_10004737 JGI24740J21852_100047374 138
43 3300001989 JGI24739J22299_10000928 JGI24739J22299_100009289 138
44 3300001989 JGI24739J22299_10081930 JGI24739J22299_100819303 138
45 3300001990 JGI24737J22298_10000096 JGI24737J22298_100000967 138
46 3300001990 JGI24737J22298_10028243 JGI24737J22298_100282433 138
47 3300001991 JGI24743J22301_10022773 JGI24743J22301_100227733 138
48 3300002067 JGI24735J21928_10020165 JGI24735J21928_100201653 138
49 3300002075 JGI24738J21930_10001101 JGI24738J21930_100011015 138
50 3300002075 JGI24738J21930_10047796 JGI24738J21930_100477962 138
51 3300002126 JGI24035J26624_1043476 JGI24035J26624_10434761 138
52 3300002239 JGI24034J26672_10092046 JGI24034J26672_100920461 138
53 3300005327 Ga0070658_10016606 Ga0070658_100166062 138
54 3300005327 Ga0070658_10339125 Ga0070658_103391253 138
55 3300005328 Ga0070676_10334718 Ga0070676_103347182 138
56 3300005329 Ga0070683_101436801 Ga0070683_1014368011 138
57 3300005330 Ga0070690_100009203 Ga0070690_1000092035 138
58 3300005331 Ga0070670_100009494 Ga0070670_1000094947 138
59 3300005331 Ga0070670_100299428 Ga0070670_1002994283 138
60 3300005334 Ga0068869_100005113 Ga0068869_1000051134 138
61 3300005334 Ga0068869_101060414 Ga0068869_1010604141 138
62 3300005335 Ga0070666_10024820 Ga0070666_100248202 138
63 3300005335 Ga0070666_10055418 Ga0070666_100554184 138
64 3300005336 Ga0070680_100011452 Ga0070680_1000114529 138
65 3300005337 Ga0070682_100006846 Ga0070682_1000068468 138
66 3300005337 Ga0070682_101430856 Ga0070682_1014308561 138
67 3300005338 Ga0068868_100001325 Ga0068868_10000132514 138
68 3300005339 Ga0070660_100021042 Ga0070660_1000210425 138
69 3300005339 Ga0070660_100761141 Ga0070660_1007611412 138
70 3300005340 Ga0070689_100076272 Ga0070689_1000762722 138
71 3300005344 Ga0070661_100037011 Ga0070661_1000370114 138
72 3300005344 Ga0070661_100236377 Ga0070661_1002363772 138
73 3300005344 Ga0070661_100258199 Ga0070661_1002581991 138
74 3300005344 Ga0070661_100295309 Ga0070661_1002953092 138
75 3300005344 Ga0070661_100461357 Ga0070661_1004613571 138
76 3300005347 Ga0070668_100009651 Ga0070668_1000096515 138
77 3300005353 Ga0070669_100017178 Ga0070669_1000171786 138
78 3300005354 Ga0070675_100217049 Ga0070675_1002170493 138
79 3300005355 Ga0070671_100007754 Ga0070671_1000077544 138
80 3300005355 Ga0070671_100017425 Ga0070671_1000174252 138
81 3300005355 Ga0070671_100100172 Ga0070671_1001001722 138
82 3300005356 Ga0070674_100164776 Ga0070674_1001647763 138
83 3300005364 Ga0070673_100000119 Ga0070673_10000011933 138
84 3300005364 Ga0070673_100094281 Ga0070673_1000942813 138
85 3300005364 Ga0070673_100256896 Ga0070673_1002568962 138
86 3300005365 Ga0070688_101483326 Ga0070688_1014833261 138
87 3300005366 Ga0070659_100024422 Ga0070659_1000244223 138
88 3300005366 Ga0070659_100310179 Ga0070659_1003101792 138
89 3300005366 Ga0070659_100493067 Ga0070659_1004930671 138
90 3300005367 Ga0070667_100001485 Ga0070667_10000148521 138
91 3300005367 Ga0070667_100002546 Ga0070667_1000025466 138
92 3300005367 Ga0070667_100280334 Ga0070667_1002803342 138
93 3300005435 Ga0070714_101415084 Ga0070714_1014150841 138
94 3300005440 Ga0070705_100057183 Ga0070705_1000571832 138
95 3300005444 Ga0070694_100606202 Ga0070694_1006062022 138
96 3300005455 Ga0070663_100032317 Ga0070663_1000323174 138
97 3300005455 Ga0070663_100094109 Ga0070663_1000941092 138
98 3300005455 Ga0070663_100137542 Ga0070663_1001375421 138
99 3300005455 Ga0070663_100366980 Ga0070663_1003669801 138
100 3300005455 Ga0070663_100503963 Ga0070663_1005039632 138
101 3300005457 Ga0070662_100003418 Ga0070662_1000034185 138
102 3300005457 Ga0070662_100121110 Ga0070662_1001211103 138
103 3300005457 Ga0070662_100391760 Ga0070662_1003917602 138
104 3300005457 Ga0070662_100422339 Ga0070662_1004223392 138
105 3300005457 Ga0070662_100437245 Ga0070662_1004372452 138
106 3300005458 Ga0070681_10041401 Ga0070681_100414018 138
107 3300005459 Ga0068867_100002637 Ga0068867_1000026372 138
108 3300005459 Ga0068867_100006215 Ga0068867_1000062156 138
109 3300005459 Ga0068867_100111101 Ga0068867_1001111013 138
110 3300005466 Ga0070685_10288064 Ga0070685_102880642 138
111 3300005530 Ga0070679_100095997 Ga0070679_1000959971 138
112 3300005535 Ga0070684_100198706 Ga0070684_1001987063 138
113 3300005536 Ga0070697_100001411 Ga0070697_1000014112 138
114 3300005539 Ga0068853_100001426 Ga0068853_10000142619 138
115 3300005539 Ga0068853_100001890 Ga0068853_10000189013 138
116 3300005539 Ga0068853_100083128 Ga0068853_1000831283 138
117 3300005539 Ga0068853_100210021 Ga0068853_1002100212 138
118 3300005543 Ga0070672_100000263 Ga0070672_1000002639 138
119 3300005545 Ga0070695_100115159 Ga0070695_1001151592 138
120 3300005545 Ga0070695_100149947 Ga0070695_1001499473 138
121 3300005546 Ga0070696_100053100 Ga0070696_1000531003 138
122 3300005547 Ga0070693_100006141 Ga0070693_1000061418 138
123 3300005547 Ga0070693_100206128 Ga0070693_1002061282 138
124 3300005548 Ga0070665_100072036 Ga0070665_1000720362 138
125 3300005548 Ga0070665_100123474 Ga0070665_1001234743 138
126 3300005548 Ga0070665_100338387 Ga0070665_1003383873 138
127 3300005548 Ga0070665_100914111 Ga0070665_1009141111 138
128 3300005548 Ga0070665_101030624 Ga0070665_1010306242 138
129 3300005549 Ga0070704_100089182 Ga0070704_1000891822 138
130 3300005549 Ga0070704_101198513 Ga0070704_1011985132 138
131 3300005563 Ga0068855_100017738 Ga0068855_1000177386 138
132 3300005564 Ga0070664_100092931 Ga0070664_1000929312 138
133 3300005564 Ga0070664_100109273 Ga0070664_1001092733 138
134 3300005564 Ga0070664_100540337 Ga0070664_1005403371 138
135 3300005577 Ga0068857_100001463 Ga0068857_10000146313 138
136 3300005577 Ga0068857_100042343 Ga0068857_1000423434 138
137 3300005577 Ga0068857_100126777 Ga0068857_1001267773 138
138 3300005578 Ga0068854_100000618 Ga0068854_10000061810 138
139 3300005578 Ga0068854_100002054 Ga0068854_10000205411 138
140 3300005578 Ga0068854_100645029 Ga0068854_1006450292 138
141 3300005614 Ga0068856_100018655 Ga0068856_1000186553 138
142 3300005616 Ga0068852_100007297 Ga0068852_1000072975 138
143 3300005616 Ga0068852_100021777 Ga0068852_1000217775 138
144 3300005616 Ga0068852_100750571 Ga0068852_1007505712 138
145 3300005616 Ga0068852_100762728 Ga0068852_1007627281 138
146 3300005617 Ga0068859_100003026 Ga0068859_1000030267 138
147 3300005617 Ga0068859_100035113 Ga0068859_1000351133 138
148 3300005618 Ga0068864_100000340 Ga0068864_10000034013 138
149 3300005618 Ga0068864_100003799 Ga0068864_1000037993 138
150 3300005618 Ga0068864_100292424 Ga0068864_1002924242 138
151 3300005718 Ga0068866_10065415 Ga0068866_100654152 138
152 3300005719 Ga0068861_101688789 Ga0068861_1016887892 138
153 3300005719 Ga0068861_102535773 Ga0068861_1025357731 138
154 3300005834 Ga0068851_10216422 Ga0068851_102164222 138
155 3300005834 Ga0068851_10230062 Ga0068851_102300622 138
156 3300005834 Ga0068851_10260510 Ga0068851_102605102 138
157 3300005834 Ga0068851_10409659 Ga0068851_104096591 138
158 3300005840 Ga0068870_10287428 Ga0068870_102874281 138
159 3300005841 Ga0068863_100012356 Ga0068863_1000123567 138
160 3300005841 Ga0068863_100028286 Ga0068863_1000282862 138
161 3300005842 Ga0068858_100005497 Ga0068858_1000054975 138
162 3300005842 Ga0068858_100023339 Ga0068858_1000233392 138
163 3300005842 Ga0068858_100238871 Ga0068858_1002388713 138
164 3300005843 Ga0068860_100390053 Ga0068860_1003900533 138
165 3300006048 Ga0075363_100419993 Ga0075363_1004199932 138
166 3300006195 Ga0075366_10132910 Ga0075366_101329102 138
167 3300006237 Ga0097621_100298177 Ga0097621_1002981773 138
168 3300006237 Ga0097621_101643781 Ga0097621_1016437812 138
169 3300006358 Ga0068871_100075757 Ga0068871_1000757573 138
170 3300006358 Ga0068871_101377733 Ga0068871_1013777332 138
171 3300006881 Ga0068865_100001589 Ga0068865_10000158913 138
172 3300006914 Ga0075436_100001197 Ga0075436_1000011974 138
173 3300006931 Ga0097620_100003026 Ga0097620_1000030267 138
174 3300006931 Ga0097620_100035116 Ga0097620_1000351164 138
175 3300009011 Ga0105251_10166644 Ga0105251_101666442 138
176 3300009098 Ga0105245_10000530 Ga0105245_1000053013 138
177 3300009101 Ga0105247_11177908 Ga0105247_111779082 138
178 3300009174 Ga0105241_10024296 Ga0105241_100242964 138
179 3300009174 Ga0105241_10041837 Ga0105241_100418372 138
180 3300009174 Ga0105241_10095451 Ga0105241_100954512 138
181 3300009177 Ga0105248_10025485 Ga0105248_100254855 138
182 3300009545 Ga0105237_10051321 Ga0105237_100513212 138
183 3300009545 Ga0105237_10608271 Ga0105237_106082712 138
184 3300009551 Ga0105238_10305549 Ga0105238_103055493 138
185 3300009551 Ga0105238_11173562 Ga0105238_111735621 138
186 3300009553 Ga0105249_10030552 Ga0105249_100305524 138
187 3300010375 Ga0105239_10057077 Ga0105239_100570775 138
188 3300010375 Ga0105239_10486155 Ga0105239_104861552 138
189 3300011119 Ga0105246_10035492 Ga0105246_100354924 138
190 3300011119 Ga0105246_10138529 Ga0105246_101385292 138
191 3300013100 Ga0157373_10016795 Ga0157373_100167955 138
192 3300013100 Ga0157373_10114878 Ga0157373_101148783 138
193 3300013100 Ga0157373_10198513 Ga0157373_101985133 138
194 3300013102 Ga0157371_10009244 Ga0157371_100092444 138
195 3300013102 Ga0157371_10028204 Ga0157371_100282043 138
196 3300013102 Ga0157371_10102836 Ga0157371_101028362 138
197 3300013104 Ga0157370_10053187 Ga0157370_100531872 138
198 3300013104 Ga0157370_10059136 Ga0157370_100591364 138
199 3300013105 Ga0157369_10019284 Ga0157369_100192846 138
200 3300013296 Ga0157374_10460595 Ga0157374_104605952 138
201 3300013297 Ga0157378_10020190 Ga0157378_100201903 138
202 3300013297 Ga0157378_10163398 Ga0157378_101633982 138
203 3300013306 Ga0163162_10041930 Ga0163162_100419304 138
204 3300013307 Ga0157372_10009232 Ga0157372_1000923210 138
205 3300013307 Ga0157372_10513370 Ga0157372_105133702 138
206 3300013307 Ga0157372_10642533 Ga0157372_106425332 138
207 3300013307 Ga0157372_10901713 Ga0157372_109017132 138
208 3300013308 Ga0157375_10028294 Ga0157375_100282945 138
209 3300013308 Ga0157375_11608861 Ga0157375_116088612 138
210 3300014325 Ga0163163_10104402 Ga0163163_101044023 138
211 3300014325 Ga0163163_10140834 Ga0163163_101408342 138
212 3300014326 Ga0157380_12302741 Ga0157380_123027411 138
213 3300014497 Ga0182008_10024073 Ga0182008_100240734 138
214 3300014745 Ga0157377_11108234 Ga0157377_111082341 138
215 3300014968 Ga0157379_10009568 Ga0157379_100095686 138
216 3300017792 Ga0163161_11004327 Ga0163161_110043271 138
217 3300025315 Ga0207697_10000058 Ga0207697_1000005814 138
218 3300025321 Ga0207656_10006327 Ga0207656_100063276 138
219 3300025321 Ga0207656_10140015 Ga0207656_101400152 138
220 3300025321 Ga0207656_10668158 Ga0207656_106681581 138
221 3300025899 Ga0207642_10120077 Ga0207642_101200773 138
222 3300025900 Ga0207710_10490277 Ga0207710_104902772 138
223 3300025901 Ga0207688_10001088 Ga0207688_100010882 138
224 3300025903 Ga0207680_10008489 Ga0207680_100084895 138
225 3300025903 Ga0207680_10087451 Ga0207680_100874513 138
226 3300025903 Ga0207680_10135761 Ga0207680_101357611 138
227 3300025904 Ga0207647_10000579 Ga0207647_100005795 138
228 3300025904 Ga0207647_10019879 Ga0207647_100198794 138
229 3300025907 Ga0207645_10024719 Ga0207645_100247193 138
230 3300025907 Ga0207645_10313589 Ga0207645_103135892 138
231 3300025909 Ga0207705_10103271 Ga0207705_101032713 138
232 3300025909 Ga0207705_10351142 Ga0207705_103511422 138
233 3300025911 Ga0207654_10036634 Ga0207654_100366343 138
234 3300025911 Ga0207654_10094424 Ga0207654_100944243 138
235 3300025912 Ga0207707_10282255 Ga0207707_102822553 138
236 3300025914 Ga0207671_10110310 Ga0207671_101103102 138
237 3300025914 Ga0207671_10436616 Ga0207671_104366162 138
238 3300025917 Ga0207660_10045377 Ga0207660_100453772 138
239 3300025919 Ga0207657_10008413 Ga0207657_100084135 138
240 3300025919 Ga0207657_10011086 Ga0207657_100110867 138
241 3300025919 Ga0207657_10022457 Ga0207657_100224573 138
242 3300025919 Ga0207657_10051001 Ga0207657_100510013 138
243 3300025919 Ga0207657_10229727 Ga0207657_102297272 138
244 3300025920 Ga0207649_10008803 Ga0207649_100088032 138
245 3300025920 Ga0207649_10261288 Ga0207649_102612882 138
246 3300025920 Ga0207649_10359086 Ga0207649_103590862 138
247 3300025921 Ga0207652_10017613 Ga0207652_100176134 138
248 3300025923 Ga0207681_10157621 Ga0207681_101576213 138
249 3300025924 Ga0207694_10195234 Ga0207694_101952342 138
250 3300025925 Ga0207650_10014407 Ga0207650_100144073 138
251 3300025925 Ga0207650_10531759 Ga0207650_105317593 138
252 3300025926 Ga0207659_10229966 Ga0207659_102299663 138
253 3300025927 Ga0207687_10023042 Ga0207687_100230423 138
254 3300025929 Ga0207664_10973821 Ga0207664_109738212 138
255 3300025931 Ga0207644_10071675 Ga0207644_100716754 138
256 3300025931 Ga0207644_10149106 Ga0207644_101491063 138
257 3300025932 Ga0207690_10014208 Ga0207690_100142083 138
258 3300025932 Ga0207690_10050708 Ga0207690_100507084 138
259 3300025932 Ga0207690_10150413 Ga0207690_101504133 138
260 3300025933 Ga0207706_10000674 Ga0207706_1000067422 138
261 3300025933 Ga0207706_10006830 Ga0207706_1000683013 138
262 3300025933 Ga0207706_10214474 Ga0207706_102144742 138
263 3300025933 Ga0207706_10332804 Ga0207706_103328042 138
264 3300025933 Ga0207706_10559887 Ga0207706_105598872 138
265 3300025933 Ga0207706_10902806 Ga0207706_109028062 138
266 3300025936 Ga0207670_10061560 Ga0207670_100615603 138
267 3300025937 Ga0207669_10131363 Ga0207669_101313633 138
268 3300025938 Ga0207704_10025007 Ga0207704_100250072 138
269 3300025940 Ga0207691_10000407 Ga0207691_1000040730 138
270 3300025941 Ga0207711_10023610 Ga0207711_100236106 138
271 3300025942 Ga0207689_10000104 Ga0207689_1000010446 138
272 3300025942 Ga0207689_10189708 Ga0207689_101897083 138
273 3300025944 Ga0207661_10098126 Ga0207661_100981263 138
274 3300025945 Ga0207679_10113381 Ga0207679_101133813 138
275 3300025945 Ga0207679_10268831 Ga0207679_102688312 138
276 3300025949 Ga0207667_10106753 Ga0207667_101067534 138
277 3300025949 Ga0207667_10700321 Ga0207667_107003212 138
278 3300025960 Ga0207651_10000929 Ga0207651_1000092910 138
279 3300025961 Ga0207712_10020628 Ga0207712_100206286 138
280 3300025972 Ga0207668_10021827 Ga0207668_100218274 138
281 3300025981 Ga0207640_10002948 Ga0207640_100029484 138
282 3300025981 Ga0207640_10006040 Ga0207640_100060402 138
283 3300025981 Ga0207640_10265937 Ga0207640_102659372 138
284 3300025981 Ga0207640_10298802 Ga0207640_102988021 138
285 3300025986 Ga0207658_10008279 Ga0207658_100082794 138
286 3300025986 Ga0207658_10075801 Ga0207658_100758013 138
287 3300025986 Ga0207658_11289782 Ga0207658_112897821 138
288 3300026023 Ga0207677_10010783 Ga0207677_100107836 138
289 3300026023 Ga0207677_10045126 Ga0207677_100451262 138
290 3300026035 Ga0207703_10032642 Ga0207703_100326423 138
291 3300026035 Ga0207703_10090879 Ga0207703_100908792 138
292 3300026041 Ga0207639_10025338 Ga0207639_100253382 138
293 3300026041 Ga0207639_10180116 Ga0207639_101801162 138
294 3300026041 Ga0207639_10257816 Ga0207639_102578163 138
295 3300026041 Ga0207639_10654091 Ga0207639_106540912 138
296 3300026067 Ga0207678_10019594 Ga0207678_100195944 138
297 3300026067 Ga0207678_10096685 Ga0207678_100966852 138
298 3300026067 Ga0207678_10411331 Ga0207678_104113313 138
299 3300026078 Ga0207702_10020524 Ga0207702_100205242 138
300 3300026088 Ga0207641_10006935 Ga0207641_100069356 138
301 3300026089 Ga0207648_10000141 Ga0207648_1000014122 138
302 3300026089 Ga0207648_10015692 Ga0207648_100156923 138
303 3300026089 Ga0207648_10033965 Ga0207648_100339652 138
304 3300026095 Ga0207676_10006604 Ga0207676_100066047 138
305 3300026095 Ga0207676_10169312 Ga0207676_101693123 138
306 3300026095 Ga0207676_10510815 Ga0207676_105108151 138
307 3300026116 Ga0207674_10002371 Ga0207674_1000237112 138
308 3300026116 Ga0207674_10003499 Ga0207674_100034998 138
309 3300026116 Ga0207674_10020667 Ga0207674_100206673 138
310 3300026116 Ga0207674_10586071 Ga0207674_105860711 138
311 3300026118 Ga0207675_102288410 Ga0207675_1022884101 138
312 3300026142 Ga0207698_10011259 Ga0207698_100112592 138
313 3300026142 Ga0207698_10018188 Ga0207698_100181883 138
314 3300026142 Ga0207698_10073027 Ga0207698_100730273 138
315 3300026142 Ga0207698_10742709 Ga0207698_107427091 138
316 3300028379 Ga0268266_10044313 Ga0268266_100443135 138
317 3300028379 Ga0268266_10132919 Ga0268266_101329192 138
318 3300028379 Ga0268266_10171177 Ga0268266_101711773 138
319 3300028379 Ga0268266_10698248 Ga0268266_106982481 138
320 3300028381 Ga0268264_10029006 Ga0268264_100290065 138
321 3300028381 Ga0268264_10362726 Ga0268264_103627261 138
322 3300035111 Ga0373923_0092899 Ga0373923_0092899_792_1220 138
323 3300035115 Ga0373941_0488487 Ga0373941_0488487_29_505 138
324 3300035116 Ga0373945_0092849 Ga0373945_0092849_378_797 138
325 3300035170 Ga0373943_0010604 Ga0373943_0010604_1701_2120 138
326 3300035171 Ga0373946_0063402 Ga0373946_0063402_205_624 138
327 3300035692 Ga0373935_0025317 Ga0373935_0025317_416_835 138
328 3300035725 Ga0373947_0019409 Ga0373947_0019409_3451_3870 138
329 3300037068 Ga0373925_0018475 Ga0373925_0018475_4422_4841 138
330 3300037312 Ga0395899_0000251 Ga0395899_0000251_50808_51227 138
331 3300037312 Ga0395899_0055802 Ga0395899_0055802_71_490 138
332 3300037418 Ga0395900_0000084 Ga0395900_0000084_133891_134310 138
333 3300037418 Ga0395900_0004890 Ga0395900_0004890_13107_13526 138
334 3300037418 Ga0395900_0007563 Ga0395900_0007563_2004_2423 138
335 3300037418 Ga0395900_0309035 Ga0395900_0309035_1069_1488 138
336 3300037466 Ga0395898_0000021 Ga0395898_0000021_198995_199414 138
337 3300037466 Ga0395898_0109758 Ga0395898_0109758_1841_2260 138
338 3300037471 Ga0395905_0000006 Ga0395905_0000006_415247_415666 138
339 3300037471 Ga0395905_0004884 Ga0395905_0004884_6901_7320 138
340 3300037471 Ga0395905_0057817 Ga0395905_0057817_520_939 138
341 3300037471 Ga0395905_0077057 Ga0395905_0077057_1363_1779 138
342 3300037471 Ga0395905_0297527 Ga0395905_0297527_993_1409 138
343 3300038443 Ga0395901_0000914 Ga0395901_0000914_3191_3610 138
344 3300038443 Ga0395901_0010957 Ga0395901_0010957_586_1005 138
345 3300038443 Ga0395901_0031883 Ga0395901_0031883_2396_2815 138
346 3300038443 Ga0395901_0221067 Ga0395901_0221067_911_1330 138
347 3300038443 Ga0395901_0239515 Ga0395901_0239515_254_673 138
348 3300039437 Ga0436365_1028162 Ga0436365_1028162_3212_3631 138
349 3300044765 Ga0466970_0160226 Ga0466970_0160226_537_956 138
350 3300046501 Ga0495607_0015619 Ga0495607_0015619_950_1366 138
351 3300046507 Ga0495606_0107113 Ga0495606_0107113_113_529 138
352 3300046512 Ga0495610_0321201 Ga0495610_0321201_42_461 138
353 3300046616 Ga0495668_0101102 Ga0495668_0101102_1005_1424 138
354 3300048904 Ga0496101_0154709 Ga0496101_0154709_613_1029 138
355 3300048905 Ga0496102_0009990 Ga0496102_0009990_6040_6456 138
356 3300048906 Ga0496103_0021230 Ga0496103_0021230_470_886 138
357 3300048908 Ga0496105_0142296 Ga0496105_0142296_954_1370 138
358 3300048909 Ga0496106_0076295 Ga0496106_0076295_1585_2001 138
359 3300048910 Ga0496107_0093362 Ga0496107_0093362_1241_1657 138
360 3300048911 Ga0496108_0001276 Ga0496108_0001276_11404_11820 138
361 3300048912 Ga0496109_0003518 Ga0496109_0003518_5991_6407 138
362 3300048912 Ga0496109_0162189 Ga0496109_0162189_900_1319 138
363 3300048912 Ga0496109_0948565 Ga0496109_0948565_365_784 138
364 3300048913 Ga0496110_0034170 Ga0496110_0034170_3412_3828 138
365 3300048914 Ga0496111_0016034 Ga0496111_0016034_4314_4730 138
366 3300048915 Ga0496112_0021889 Ga0496112_0021889_5242_5658 138
367 3300048915 Ga0496112_0108685 Ga0496112_0108685_1562_1981 138
368 3300048915 Ga0496112_0795418 Ga0496112_0795418_210_629 138
369 3300048920 Ga0496117_0028333 Ga0496117_0028333_1680_2096 138
370 3300048921 Ga0496118_0037306 Ga0496118_0037306_675_1091 138
371 3300049574 Ga0501038_0203588 Ga0501038_0203588_361_780 138
372 3300050513 nmdc:mga0rr50_988835_c1 nmdc:mga0rr50_988835_c1_91_555 138
373 3300050514 nmdc:mga08x19_4_c1 nmdc:mga08x19_4_c1_54325_54789 138
374 3300053142 Ga0500577_0070696 Ga0500577_0070696_216_632 138
375 3300053730 Ga0500645_000355 Ga0500645_000355_27271_27687 138
376 3300060346 Ga0587111_0115842 Ga0587111_0115842_50_472 138
377 3300060353 Ga0501082_0038414 Ga0501082_0038414_3669_4085 138
378 3300001915 JGI24741J21665_1010853 JGI24741J21665_10108532 139
379 3300002067 JGI24735J21928_10021731 JGI24735J21928_100217313 139
380 3300005329 Ga0070683_100775499 Ga0070683_1007754992 139
381 3300005336 Ga0070680_100003978 Ga0070680_1000039787 139
382 3300005336 Ga0070680_100328020 Ga0070680_1003280202 139
383 3300005339 Ga0070660_100218345 Ga0070660_1002183452 139
384 3300005345 Ga0070692_10168074 Ga0070692_101680742 139
385 3300005455 Ga0070663_100094678 Ga0070663_1000946782 139
386 3300005458 Ga0070681_10001207 Ga0070681_1000120713 139
387 3300005458 Ga0070681_10517913 Ga0070681_105179132 139
388 3300005530 Ga0070679_100000144 Ga0070679_10000014456 139
389 3300005539 Ga0068853_100000268 Ga0068853_1000002685 139
390 3300005547 Ga0070693_100135356 Ga0070693_1001353562 139
391 3300005548 Ga0070665_100443835 Ga0070665_1004438352 139
392 3300005577 Ga0068857_100009928 Ga0068857_1000099283 139
393 3300005614 Ga0068856_101266209 Ga0068856_1012662092 139
394 3300009093 Ga0105240_10001734 Ga0105240_100017342 139
395 3300009545 Ga0105237_12519220 Ga0105237_125192201 139
396 3300013100 Ga0157373_10190203 Ga0157373_101902032 139
397 3300013104 Ga0157370_10009046 Ga0157370_100090465 139
398 3300013104 Ga0157370_10223704 Ga0157370_102237043 139
399 3300013105 Ga0157369_10089584 Ga0157369_100895843 139
400 3300013105 Ga0157369_10836569 Ga0157369_108365691 139
401 3300013296 Ga0157374_10375091 Ga0157374_103750912 139
402 3300013307 Ga0157372_10079099 Ga0157372_100790992 139
403 3300013307 Ga0157372_10156016 Ga0157372_101560162 139
404 3300013307 Ga0157372_10252081 Ga0157372_102520813 139
405 3300014497 Ga0182008_10009329 Ga0182008_100093294 139
406 3300020070 Ga0206356_10628829 Ga0206356_106288292 139
407 3300021361 Ga0213872_10069868 Ga0213872_100698682 139
408 3300021377 Ga0213874_10002577 Ga0213874_100025774 139
409 3300021377 Ga0213874_10004609 Ga0213874_100046096 139
410 3300021388 Ga0213875_10004858 Ga0213875_100048582 139
411 3300021388 Ga0213875_10027922 Ga0213875_100279223 139
412 3300025272 Ga0209455_1000614 Ga0209455_10006146 139
413 3300025912 Ga0207707_10002795 Ga0207707_100027953 139
414 3300025912 Ga0207707_10003731 Ga0207707_1000373110 139
415 3300025912 Ga0207707_10134424 Ga0207707_101344242 139
416 3300025912 Ga0207707_10247824 Ga0207707_102478242 139
417 3300025913 Ga0207695_10009746 Ga0207695_100097469 139
418 3300025917 Ga0207660_10161477 Ga0207660_101614772 139
419 3300025919 Ga0207657_10009319 Ga0207657_100093193 139
420 3300025921 Ga0207652_10021328 Ga0207652_100213284 139
421 3300025944 Ga0207661_10709627 Ga0207661_107096272 139
422 3300025949 Ga0207667_11190264 Ga0207667_111902642 139
423 3300025986 Ga0207658_10590289 Ga0207658_105902892 139
424 3300028379 Ga0268266_10350668 Ga0268266_103506682 139
425 3300028577 Ga0265318_10000025 Ga0265318_10000025115 139
426 3300028800 Ga0265338_10039617 Ga0265338_100396173 139
427 3300031247 Ga0265340_10005875 Ga0265340_100058755 139
428 3300031824 Ga0307413_10823892 Ga0307413_108238922 139
429 3300031995 Ga0307409_101586322 Ga0307409_1015863222 139
430 3300035086 Ga0373934_0370605 Ga0373934_0370605_22_441 139
431 3300035724 Ga0373933_0166041 Ga0373933_0166041_594_1013 139
432 3300036401 Ga0373937_0025336 Ga0373937_0025336_1207_1626 139
433 3300037418 Ga0395900_1245014 Ga0395900_1245014_102_521 139
434 3300037466 Ga0395898_0866631 Ga0395898_0866631_50_469 139
435 3300037471 Ga0395905_0024241 Ga0395905_0024241_4927_5352 139
436 3300037853 Ga0436364_1281128 Ga0436364_1281128_6356_6775 139
437 3300039437 Ga0436365_1264065 Ga0436365_1264065_38_478 139
438 3300039450 Ga0436363_0983054 Ga0436363_0983054_2271_2690 139
439 3300039450 Ga0436363_1255805 Ga0436363_1255805_19350_19769 139
440 3300044656 Ga0466969_0009346 Ga0466969_0009346_1093_1512 139
441 3300044656 Ga0466969_0025741 Ga0466969_0025741_2325_2747 139
442 3300044684 Ga0466966_0164377 Ga0466966_0164377_380_799 139
443 3300044693 Ga0466961_0054390 Ga0466961_0054390_968_1387 139
444 3300044735 Ga0466968_0602717 Ga0466968_0602717_20_439 139
445 3300044765 Ga0466970_0031121 Ga0466970_0031121_824_1243 139
446 3300045049 Ga0466959_0001061 Ga0466959_0001061_10634_11053 139
447 3300045976 Ga0466967_0174346 Ga0466967_0174346_808_1227 139
448 3300046810 Ga0495660_0111287 Ga0495660_0111287_817_1236 139
449 3300047443 Ga0495687_041529 Ga0495687_041529_695_1114 139
450 3300048918 Ga0496115_0292348 Ga0496115_0292348_409_828 139
451 3300049583 Ga0501067_0000378 Ga0501067_0000378_23303_23722 139
452 3300049586 Ga0501070_0135609 Ga0501070_0135609_398_817 139
453 3300049588 Ga0501072_0002246 Ga0501072_0002246_11289_11708 139
454 3300049589 Ga0501073_0005770 Ga0501073_0005770_6382_6801 139
455 3300049589 Ga0501073_0185990 Ga0501073_0185990_991_1410 139
456 3300049590 Ga0501074_0225265 Ga0501074_0225265_260_679 139
457 3300049742 Ga0501080_0947426 Ga0501080_0947426_30_449 139
458 3300050493 nmdc:mga0k408_66207_c1 nmdc:mga0k408_66207_c1_1546_1965 139
459 3300050496 nmdc:mga07m45_424412_c1 nmdc:mga07m45_424412_c1_112_531 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

19

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9527 4 137
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9456 6 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9375 4 137
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9315 6 137
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.929 6 137
ID Description Score Start End Superfamily
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9335 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9323 1 138 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9278 4 138 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9271 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9258 1 138 2.60.120.460
ID Description Score Start End GO Terms
AF-D0RNC5-F1-model_v4 YjbQ family protein 0.9962 1 139
AF-A0A0D6MWM4-F1-model_v4 deleted 0.995 1 139
AF-A0A558RAN1-F1-model_v4 YjbQ family protein 0.9944 19 139
AF-A0A1U9RI80-F1-model_v4 deleted 0.9939 1 139
AF-A0A2T1CNU5-F1-model_v4 YjbQ family protein 0.9939 1 139

Feature Viewer

pLDDT pTM Quality
94.68 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map