F448366

General Info

Members Datasets Scaffolds Average Seq Length
459 217 918 157

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10076866|Ga0207654_100768662
Length 178
Sequence MTGVGSTEPAGSGGADMRGAGAGNGLYEAIQAERAKYPEGSRSATLHALRLAQEEHGWLSPDALREVADALEVTPAYCKAVATFYDMYHLAPVGTHLVEVCTNLSCALAGAQRVVDAFASELGVAPGETTADGDVTFRTVECLGGCGYATVVAVDHRYRQFVGPDDVAAIVEELRAGS

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 2.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 5.88
Rhizosphere 93.46
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10076866 3300025911 Bacteria 1999
2 JGI25407J50210_10015139 3300003373 Bacteria 1990
3 JGI25407J50210_10027950 3300003373 Bacteria 1463
4 Ga0070658_10015063 3300005327 Bacteria 6188
5 Ga0070658_10070570 3300005327 Bacteria 2860
6 Ga0070658_10116793 3300005327 Bacteria 2214
7 Ga0070683_100022595 3300005329 Bacteria 5624
8 Ga0070683_100075139 3300005329 Bacteria 3157
9 Ga0070683_100099907 3300005329 Bacteria 2731
10 Ga0070683_100316183 3300005329 Bacteria 1486
11 Ga0070683_100815674 3300005329 Bacteria 895
12 Ga0070683_101195209 3300005329 Unclassified 731
13 Ga0070680_100155257 3300005336 Bacteria 1922
14 Ga0070680_100174254 3300005336 Bacteria 1811
15 Ga0070680_100299104 3300005336 Bacteria 1364
16 Ga0070680_100497730 3300005336 Bacteria 1043
17 Ga0070680_100724517 3300005336 Bacteria 856
18 Ga0070682_100015278 3300005337 Bacteria 4447
19 Ga0070682_100154843 3300005337 Bacteria 1577
20 Ga0070682_100348266 3300005337 Bacteria 1103
21 Ga0068868_100590599 3300005338 Bacteria 983
22 Ga0070660_100268369 3300005339 Bacteria 1394
23 Ga0070660_100471732 3300005339 Bacteria 1042
24 Ga0070660_100687506 3300005339 Bacteria 857
25 Ga0070661_100020187 3300005344 Bacteria 4750
26 Ga0070661_100254718 3300005344 Bacteria 1355
27 Ga0070661_100600424 3300005344 Bacteria 890
28 Ga0070659_100014825 3300005366 Bacteria 5828
29 Ga0070659_100045699 3300005366 Bacteria 3430
30 Ga0070659_100075497 3300005366 Bacteria 2686
31 Ga0070659_100588080 3300005366 Bacteria 956
32 Ga0070714_100729994 3300005435 Bacteria 957
33 Ga0070714_101147513 3300005435 Bacteria 758
34 Ga0070711_101641253 3300005439 Bacteria 563
35 Ga0070708_100132828 3300005445 Bacteria 2305
36 Ga0070708_101271884 3300005445 Bacteria 688
37 Ga0070663_100053269 3300005455 Bacteria 2888
38 Ga0070663_101295453 3300005455 Unclassified 643
39 Ga0070678_100046369 3300005456 Bacteria 3116
40 Ga0070681_10001855 3300005458 Bacteria 19089
41 Ga0070681_10027200 3300005458 Bacteria 5751
42 Ga0070681_10094169 3300005458 Bacteria 2944
43 Ga0070681_10145023 3300005458 Bacteria 2303
44 Ga0070681_10496921 3300005458 Bacteria 1133
45 Ga0070707_100002585 3300005468 Bacteria 17201
46 Ga0070707_100380288 3300005468 Bacteria 1372
47 Ga0070698_101780629 3300005471 Bacteria 569
48 Ga0070699_100180237 3300005518 Bacteria 1874
49 Ga0070679_100011004 3300005530 Bacteria 8600
50 Ga0070679_100022714 3300005530 Bacteria 6133
51 Ga0070679_100024040 3300005530 Bacteria 5969
52 Ga0070679_100106302 3300005530 Bacteria 2792
53 Ga0070679_100130876 3300005530 Bacteria 2490
54 Ga0070679_100133301 3300005530 Bacteria 2465
55 Ga0070679_100157859 3300005530 Bacteria 2243
56 Ga0070679_101188708 3300005530 Bacteria 708
57 Ga0070684_100050911 3300005535 Bacteria 3598
58 Ga0070684_100103688 3300005535 Bacteria 2544
59 Ga0070684_100227446 3300005535 Bacteria 1703
60 Ga0070684_100238029 3300005535 Bacteria 1663
61 Ga0068853_100184595 3300005539 Bacteria 1893
62 Ga0068853_100736365 3300005539 Bacteria 942
63 Ga0070693_100032753 3300005547 Bacteria 2861
64 Ga0070665_100090599 3300005548 Bacteria 3064
65 Ga0068855_100182389 3300005563 Bacteria 2372
66 Ga0068855_100808864 3300005563 Bacteria 995
67 Ga0068855_101676490 3300005563 Bacteria 649
68 Ga0070664_100484286 3300005564 Bacteria 1139
69 Ga0068857_100018224 3300005577 Bacteria 6157
70 Ga0068857_100243325 3300005577 Bacteria 1647
71 Ga0068856_100152722 3300005614 Bacteria 2318
72 Ga0068856_100303847 3300005614 Bacteria 1613
73 Ga0068856_100826625 3300005614 Bacteria 946
74 Ga0070702_100664233 3300005615 Bacteria 790
75 Ga0068852_100197160 3300005616 Bacteria 1904
76 Ga0068852_100642962 3300005616 Bacteria 1068
77 Ga0068852_101200015 3300005616 Bacteria 780
78 Ga0068861_100602304 3300005719 Bacteria 1009
79 Ga0081455_10083804 3300005937 Bacteria 2604
80 Ga0081455_10684329 3300005937 Unclassified 656
81 Ga0081538_10000151 3300005981 Bacteria 72583
82 Ga0081538_10001761 3300005981 Bacteria 21920
83 Ga0081538_10002077 3300005981 Bacteria 19957
84 Ga0081538_10002734 3300005981 Bacteria 16934
85 Ga0081538_10007728 3300005981 Bacteria 9259
86 Ga0081539_10062333 3300005985 Bacteria 2038
87 Ga0075430_100455337 3300006846 Bacteria 1056
88 Ga0075431_100051547 3300006847 Bacteria 4243
89 Ga0075434_101341496 3300006871 Bacteria 726
90 Ga0068865_101674768 3300006881 Unclassified 573
91 Ga0075436_100738084 3300006914 Unclassified 731
92 Ga0105240_10076875 3300009093 Bacteria 4114
93 Ga0111539_10480498 3300009094 Bacteria 1447
94 Ga0105245_10250360 3300009098 Bacteria 1721
95 Ga0114129_10583487 3300009147 Bacteria 1450
96 Ga0114129_10596469 3300009147 Bacteria 1432
97 Ga0105241_11184637 3300009174 Bacteria 723
98 Ga0105242_10930539 3300009176 Bacteria 872
99 Ga0105238_10072267 3300009551 Bacteria 3446
100 Ga0105238_11602152 3300009551 Bacteria 681
101 Ga0105238_12438983 3300009551 Unclassified 559
102 Ga0105239_10382721 3300010375 Bacteria 1591
103 Ga0105239_12862474 3300010375 Unclassified 563
104 Ga0105246_10194842 3300011119 Bacteria 1571
105 Ga0157373_10019815 3300013100 Bacteria 4894
106 Ga0157373_10845756 3300013100 Bacteria 677
107 Ga0157373_11199382 3300013100 Unclassified 572
108 Ga0157370_10127851 3300013104 Bacteria 2371
109 Ga0157370_10515046 3300013104 Bacteria 1098
110 Ga0157370_10569794 3300013104 Bacteria 1038
111 Ga0157369_10127560 3300013105 Bacteria 2696
112 Ga0157369_10801573 3300013105 Bacteria 968
113 Ga0157369_11265717 3300013105 Bacteria 752
114 Ga0157374_10980286 3300013296 Bacteria 864
115 Ga0157374_11117628 3300013296 Bacteria 809
116 Ga0157372_10263042 3300013307 Bacteria 2003
117 Ga0157372_11476347 3300013307 Bacteria 783
118 Ga0157375_10121277 3300013308 Bacteria 2724
119 Ga0163163_10306827 3300014325 Bacteria 1640
120 Ga0157376_10395430 3300014969 Bacteria 1335
121 Ga0163161_11093152 3300017792 Bacteria 685
122 Ga0197907_10369962 3300020069 Bacteria 758
123 Ga0197907_10648429 3300020069 Bacteria 1189
124 Ga0206356_11410211 3300020070 Bacteria 1083
125 Ga0206356_11501934 3300020070 Bacteria 1173
126 Ga0206350_10712675 3300020080 Unclassified 649
127 Ga0206354_10247831 3300020081 Bacteria 1506
128 Ga0206354_11183078 3300020081 Bacteria 1230
129 Ga0206353_10885954 3300020082 Bacteria 1018
130 Ga0206353_11089650 3300020082 Bacteria 5165
131 Ga0206353_11647635 3300020082 Bacteria 737
132 Ga0206353_12040689 3300020082 Bacteria 4534
133 Ga0213871_10121145 3300021441 Bacteria 780
134 Ga0207656_10051258 3300025321 Bacteria 1784
135 Ga0207647_10197100 3300025904 Bacteria 1166
136 Ga0207684_10071038 3300025910 Bacteria 2958
137 Ga0207654_10687812 3300025911 Bacteria 734
138 Ga0207707_10002919 3300025912 Bacteria 15249
139 Ga0207707_10051905 3300025912 Bacteria 3571
140 Ga0207707_10065796 3300025912 Bacteria 3156
141 Ga0207707_10122497 3300025912 Bacteria 2274
142 Ga0207707_10384688 3300025912 Bacteria 1206
143 Ga0207695_11418319 3300025913 Unclassified 575
144 Ga0207671_10304417 3300025914 Bacteria 1259
145 Ga0207660_10017699 3300025917 Bacteria 4740
146 Ga0207660_10032985 3300025917 Bacteria 3578
147 Ga0207660_10047469 3300025917 Bacteria 3036
148 Ga0207657_10005284 3300025919 Bacteria 13530
149 Ga0207657_10015154 3300025919 Bacteria 7487
150 Ga0207657_10034499 3300025919 Bacteria 4548
151 Ga0207657_10383365 3300025919 Bacteria 1107
152 Ga0207649_10074133 3300025920 Bacteria 2183
153 Ga0207649_10821488 3300025920 Bacteria 726
154 Ga0207652_10032369 3300025921 Bacteria 4395
155 Ga0207652_10084152 3300025921 Bacteria 2786
156 Ga0207652_10351607 3300025921 Bacteria 1330
157 Ga0207652_10432409 3300025921 Bacteria 1187
158 Ga0207652_10566618 3300025921 Bacteria 1020
159 Ga0207646_10059910 3300025922 Bacteria 3400
160 Ga0207646_11283483 3300025922 Bacteria 640
161 Ga0207694_10060508 3300025924 Bacteria 2947
162 Ga0207694_10078985 3300025924 Bacteria 2580
163 Ga0207687_10008411 3300025927 Bacteria 6747
164 Ga0207664_10359791 3300025929 Bacteria 1289
165 Ga0207664_10735278 3300025929 Bacteria 887
166 Ga0207664_11767126 3300025929 Bacteria 541
167 Ga0207690_10011819 3300025932 Bacteria 5221
168 Ga0207690_10217251 3300025932 Bacteria 1461
169 Ga0207686_10537649 3300025934 Bacteria 912
170 Ga0207709_10031561 3300025935 Bacteria 3096
171 Ga0207711_11108222 3300025941 Bacteria 732
172 Ga0207661_10005687 3300025944 Bacteria 8794
173 Ga0207661_10022508 3300025944 Bacteria 4749
174 Ga0207661_10113176 3300025944 Bacteria 2299
175 Ga0207661_10198260 3300025944 Bacteria 1764
176 Ga0207679_10959223 3300025945 Bacteria 783
177 Ga0207667_10104673 3300025949 Bacteria 2919
178 Ga0207667_10335556 3300025949 Bacteria 1543
179 Ga0207667_10606328 3300025949 Bacteria 1103
180 Ga0207651_10901898 3300025960 Bacteria 787
181 Ga0207640_10370815 3300025981 Bacteria 1157
182 Ga0207677_10092352 3300026023 Bacteria 2204
183 Ga0207639_10045706 3300026041 Bacteria 3300
184 Ga0207639_10161159 3300026041 Bacteria 1890
185 Ga0207639_10436784 3300026041 Bacteria 1186
186 Ga0207678_10059014 3300026067 Bacteria 3301
187 Ga0207702_10002686 3300026078 Bacteria 16700
188 Ga0207702_10115634 3300026078 Bacteria 2393
189 Ga0207702_10315932 3300026078 Bacteria 1486
190 Ga0207702_11503121 3300026078 Bacteria 667
191 Ga0207648_10406222 3300026089 Bacteria 1235
192 Ga0207674_10060145 3300026116 Bacteria 3843
193 Ga0207675_100832793 3300026118 Bacteria 937
194 Ga0207683_10014446 3300026121 Bacteria 6723
195 Ga0207698_10351092 3300026142 Bacteria 1393
196 Ga0207698_10619671 3300026142 Bacteria 1069
197 Ga0207698_11212422 3300026142 Bacteria 769
198 Ga0209998_10035180 3300027717 Bacteria 1122
199 Ga0207428_10068629 3300027907 Bacteria 2788
200 Ga0268266_10046859 3300028379 Bacteria 3701
201 Ga0265319_1001733 3300028563 Bacteria 12556
202 Ga0265334_10001101 3300028573 Bacteria 13236
203 Ga0265318_10001418 3300028577 Bacteria 14174
204 Ga0265338_10099685 3300028800 Bacteria 2371
205 Ga0265330_10002530 3300031235 Bacteria 9938
206 Ga0265332_10001984 3300031238 Bacteria 10760
207 Ga0265328_10006199 3300031239 Bacteria 5086
208 Ga0265320_10028616 3300031240 Bacteria 2891
209 Ga0265325_10001202 3300031241 Bacteria 18438
210 Ga0265329_10004897 3300031242 Bacteria 5486
211 Ga0265340_10001330 3300031247 Bacteria 14159
212 Ga0265339_10004586 3300031249 Bacteria 9407
213 Ga0265331_10093491 3300031250 Bacteria 1388
214 Ga0265327_10009773 3300031251 Bacteria 6860
215 Ga0265316_10017243 3300031344 Bacteria 6247
216 Ga0307408_100030330 3300031548 Bacteria 3754
217 Ga0307408_101005551 3300031548 Bacteria 769
218 Ga0265313_10004804 3300031595 Bacteria 10176
219 Ga0265314_10008470 3300031711 Bacteria 8804
220 Ga0265342_10023644 3300031712 Bacteria 3886
221 Ga0307405_10664004 3300031731 Bacteria 859
222 Ga0307413_10020673 3300031824 Bacteria 3507
223 Ga0307406_10046866 3300031901 Bacteria 2721
224 Ga0307407_10080901 3300031903 Bacteria 1964
225 Ga0307412_10014671 3300031911 Bacteria 4629
226 Ga0307409_100057589 3300031995 Bacteria 3012
227 Ga0307416_100032245 3300032002 Bacteria 3955
228 Ga0307416_100083306 3300032002 Bacteria 2713
229 Ga0307414_10076757 3300032004 Bacteria 2429
230 Ga0307411_10085169 3300032005 Bacteria 2188
231 Ga0307415_100008441 3300032126 Bacteria 5709
232 Ga0373926_0111316 3300035083 Bacteria 1029
233 Ga0373944_0016874 3300035089 Bacteria 2065
234 Ga0373945_0141972 3300035116 Bacteria 969
235 Ga0373955_0033805 3300035172 Bacteria 2695
236 Ga0373937_0067243 3300036401 Bacteria 3301
237 Ga0373925_0828471 3300037068 Bacteria 763
238 Ga0395899_0006920 3300037312 Bacteria 8784
239 Ga0395899_0290612 3300037312 Bacteria 1109
240 Ga0395900_0025290 3300037418 Bacteria 6078
241 Ga0395900_0300206 3300037418 Bacteria 1592
242 Ga0395900_0343228 3300037418 Bacteria 1468
243 Ga0395900_0356010 3300037418 Bacteria 1436
244 Ga0395898_0001875 3300037466 Bacteria 26866
245 Ga0395898_0003526 3300037466 Bacteria 17447
246 Ga0395898_0080149 3300037466 Bacteria 3149
247 Ga0395898_0155396 3300037466 Bacteria 2188
248 Ga0395905_0021602 3300037471 Bacteria 6086
249 Ga0395905_0628897 3300037471 Bacteria 975
250 Ga0395901_0012794 3300038443 Bacteria 8510
251 Ga0395901_0019001 3300038443 Bacteria 7025
252 Ga0395901_0066637 3300038443 Bacteria 3750
253 Ga0395901_0155817 3300038443 Bacteria 2399
254 Ga0395901_1032395 3300038443 Bacteria 796
255 Ga0436360_0173849 3300039438 Bacteria 1299
256 Ga0451853_0090004 3300041512 Unclassified 590
257 Ga0451853_2478238 3300041512 Unclassified 697
258 Ga0439448_0051420 3300042005 Bacteria 1349
259 Ga0439458_0036027 3300042157 Bacteria 1191
260 Ga0450918_013821 3300042531 Bacteria 1404
261 Ga0439440_0103540 3300042993 Bacteria 777
262 Ga0466964_0005916 3300044706 Bacteria 4554
263 Ga0451576_0383249 3300045051 Bacteria 1474
264 Ga0466967_0000455 3300045976 Bacteria 19649
265 Ga0466967_0033564 3300045976 Bacteria 4345
266 Ga0466967_0121143 3300045976 Bacteria 2417
267 Ga0466967_0170297 3300045976 Bacteria 2048
268 Ga0466967_0722821 3300045976 Bacteria 987
269 Ga0495641_0004211 3300046461 Bacteria 10314
270 Ga0495653_0050259 3300046463 Bacteria 3207
271 Ga0495664_0711981 3300046477 Bacteria 593
272 Ga0495608_0042731 3300046511 Bacteria 3030
273 Ga0495665_0151413 3300046531 Bacteria 1211
274 Ga0495588_0001142 3300046674 Bacteria 11413
275 Ga0495657_0010689 3300046675 Bacteria 6901
276 Ga0495613_0289669 3300046689 Bacteria 1135
277 Ga0495676_0013121 3300047321 Bacteria 7454
278 Ga0495680_0046294 3300047322 Bacteria 3430
279 Ga0495684_0112963 3300047471 Bacteria 2048
280 Ga0496100_0473039 3300048903 Bacteria 963
281 Ga0496101_0093846 3300048904 Bacteria 2235
282 Ga0496101_0453226 3300048904 Bacteria 1012
283 Ga0496102_0005080 3300048905 Bacteria 11145
284 Ga0496102_1517015 3300048905 Bacteria 589
285 Ga0496103_0033886 3300048906 Bacteria 3121
286 Ga0496104_0154373 3300048907 Bacteria 2203
287 Ga0496105_0136468 3300048908 Bacteria 2021
288 Ga0496106_0003838 3300048909 Bacteria 11200
289 Ga0496107_0013209 3300048910 Bacteria 5770
290 Ga0496107_0701207 3300048910 Bacteria 744
291 Ga0496109_0039250 3300048912 Bacteria 4285
292 Ga0496109_0146832 3300048912 Bacteria 2207
293 Ga0496110_0061466 3300048913 Bacteria 3315
294 Ga0496110_0111935 3300048913 Bacteria 2454
295 Ga0496110_0338388 3300048913 Bacteria 1371
296 Ga0496110_0666983 3300048913 Bacteria 940
297 Ga0496111_0008012 3300048914 Bacteria 6968
298 Ga0496111_0034932 3300048914 Bacteria 3591
299 Ga0496111_0332872 3300048914 Bacteria 1124
300 Ga0496112_0125902 3300048915 Bacteria 2533
301 Ga0496112_0493546 3300048915 Bacteria 1160
302 Ga0496112_0648810 3300048915 Bacteria 985
303 Ga0496113_0609380 3300048916 Bacteria 874
304 Ga0496114_0000177 3300048917 Bacteria 45143
305 Ga0496114_0820429 3300048917 Unclassified 809
306 Ga0496115_0087488 3300048918 Bacteria 2542
307 Ga0501031_0000033 3300049568 Bacteria 76506
308 Ga0501031_0006310 3300049568 Bacteria 7730
309 Ga0501031_0073116 3300049568 Bacteria 2232
310 Ga0501032_0002047 3300049569 Bacteria 15929
311 Ga0501032_0047232 3300049569 Bacteria 2907
312 Ga0501032_0076317 3300049569 Bacteria 2231
313 Ga0501032_0845823 3300049569 Unclassified 577
314 Ga0501033_0000388 3300049570 Bacteria 42262
315 Ga0501033_0069261 3300049570 Bacteria 2593
316 Ga0501033_0190336 3300049570 Bacteria 1468
317 Ga0501033_0353193 3300049570 Bacteria 1029
318 Ga0501034_0074710 3300049571 Bacteria 3397
319 Ga0501036_0000462 3300049572 Bacteria 29122
320 Ga0501036_0020687 3300049572 Bacteria 5527
321 Ga0501036_0068778 3300049572 Bacteria 2996
322 Ga0501036_0134907 3300049572 Bacteria 2083
323 Ga0501037_0000915 3300049573 Bacteria 21941
324 Ga0501037_0519385 3300049573 Bacteria 806
325 Ga0501037_0580775 3300049573 Bacteria 754
326 Ga0501038_0001345 3300049574 Bacteria 22388
327 Ga0501038_0075570 3300049574 Bacteria 2847
328 Ga0501038_0515859 3300049574 Bacteria 912
329 Ga0501039_0000528 3300049575 Bacteria 27658
330 Ga0501039_0002890 3300049575 Bacteria 12850
331 Ga0501039_0054320 3300049575 Bacteria 3100
332 Ga0501039_0065473 3300049575 Bacteria 2819
333 Ga0501040_0000234 3300049576 Bacteria 32549
334 Ga0501040_0004493 3300049576 Bacteria 9062
335 Ga0501040_0040484 3300049576 Bacteria 3171
336 Ga0501040_0061569 3300049576 Bacteria 2581
337 Ga0501040_0187434 3300049576 Bacteria 1467
338 Ga0501040_0305540 3300049576 Bacteria 1137
339 Ga0501041_0000176 3300049577 Bacteria 28688
340 Ga0501041_0001613 3300049577 Bacteria 12589
341 Ga0501041_0022646 3300049577 Bacteria 3762
342 Ga0501042_0001987 3300049578 Bacteria 12329
343 Ga0501042_0007569 3300049578 Bacteria 7126
344 Ga0501042_0031348 3300049578 Bacteria 3760
345 Ga0501042_0177439 3300049578 Bacteria 1536
346 Ga0501043_0000798 3300049579 Bacteria 27990
347 Ga0501043_0104980 3300049579 Bacteria 2220
348 Ga0501043_0164777 3300049579 Bacteria 1731
349 Ga0501043_0575287 3300049579 Bacteria 834
350 Ga0501046_0000577 3300049580 Bacteria 36233
351 Ga0501046_0001998 3300049580 Bacteria 19348
352 Ga0501046_0057511 3300049580 Bacteria 3050
353 Ga0501046_0074882 3300049580 Bacteria 2625
354 Ga0501046_0135535 3300049580 Bacteria 1865
355 Ga0501047_0001088 3300049581 Bacteria 27110
356 Ga0501048_0000440 3300049582 Bacteria 29199
357 Ga0501048_0080873 3300049582 Bacteria 2292
358 Ga0501048_0212642 3300049582 Bacteria 1371
359 Ga0501048_0311063 3300049582 Bacteria 1121
360 Ga0501067_0000470 3300049583 Bacteria 21961
361 Ga0501067_0008570 3300049583 Bacteria 5671
362 Ga0501067_0017132 3300049583 Bacteria 4004
363 Ga0501067_0434521 3300049583 Bacteria 733
364 Ga0501068_0000344 3300049584 Bacteria 23396
365 Ga0501068_0047509 3300049584 Bacteria 2589
366 Ga0501068_0053171 3300049584 Bacteria 2451
367 Ga0501068_0456851 3300049584 Bacteria 826
368 Ga0501069_0003245 3300049585 Bacteria 8341
369 Ga0501069_0021717 3300049585 Bacteria 3486
370 Ga0501070_0002078 3300049586 Bacteria 17588
371 Ga0501070_0031201 3300049586 Bacteria 4464
372 Ga0501070_0180268 3300049586 Bacteria 1738
373 Ga0501070_1298992 3300049586 Unclassified 555
374 Ga0501071_0000054 3300049587 Bacteria 38443
375 Ga0501071_0001775 3300049587 Bacteria 12713
376 Ga0501071_0048976 3300049587 Bacteria 3040
377 Ga0501071_0111669 3300049587 Bacteria 2020
378 Ga0501071_0697620 3300049587 Bacteria 781
379 Ga0501072_0001204 3300049588 Bacteria 19296
380 Ga0501072_0017146 3300049588 Bacteria 5564
381 Ga0501072_0251476 3300049588 Bacteria 1407
382 Ga0501073_0006519 3300049589 Bacteria 8684
383 Ga0501073_0008654 3300049589 Bacteria 7540
384 Ga0501073_0380895 3300049589 Bacteria 974
385 Ga0501073_0389563 3300049589 Bacteria 963
386 Ga0501074_0000008 3300049590 Bacteria 105048
387 Ga0501074_0041006 3300049590 Bacteria 3351
388 Ga0501074_0074220 3300049590 Bacteria 2442
389 Ga0501074_0532376 3300049590 Bacteria 832
390 Ga0501075_0000096 3300049591 Bacteria 40796
391 Ga0501075_0000800 3300049591 Bacteria 19695
392 Ga0501075_0053142 3300049591 Bacteria 3046
393 Ga0501075_0196259 3300049591 Bacteria 1539
394 Ga0501076_0000020 3300049592 Bacteria 86221
395 Ga0501076_0000459 3300049592 Bacteria 25828
396 Ga0501076_0075018 3300049592 Bacteria 2710
397 Ga0501076_0100313 3300049592 Bacteria 2332
398 Ga0501076_0385669 3300049592 Bacteria 1152
399 Ga0501076_0551321 3300049592 Bacteria 950
400 Ga0501077_0001221 3300049593 Bacteria 15525
401 Ga0501077_0011129 3300049593 Bacteria 5613
402 Ga0501077_0021332 3300049593 Bacteria 4098
403 Ga0501077_0348023 3300049593 Bacteria 945
404 Ga0501079_0000001 3300049741 Bacteria 121247
405 Ga0501079_0003968 3300049741 Bacteria 10931
406 Ga0501079_0017178 3300049741 Bacteria 5524
407 Ga0501079_0057524 3300049741 Bacteria 3000
408 Ga0501079_0328032 3300049741 Bacteria 1198
409 Ga0501080_0002158 3300049742 Bacteria 17095
410 Ga0501080_0032227 3300049742 Bacteria 4886
411 Ga0501080_0497006 3300049742 Bacteria 1090
412 Ga0501081_0000001 3300049743 Bacteria 115059
413 Ga0501081_0003671 3300049743 Bacteria 9825
414 Ga0501081_0005491 3300049743 Bacteria 8184
415 Ga0501081_0208814 3300049743 Bacteria 1418
416 Ga0501081_0390330 3300049743 Bacteria 1029
417 Ga0501081_0601616 3300049743 Bacteria 823
418 Ga0501083_0000490 3300049744 Bacteria 25303
419 Ga0501083_0002293 3300049744 Bacteria 13098
420 Ga0501035_0001281 3300049822 Bacteria 25975
421 Ga0501035_0014222 3300049822 Bacteria 7344
422 Ga0501035_0149812 3300049822 Bacteria 2025
423 Ga0501035_0215516 3300049822 Bacteria 1641
424 Ga0501044_0004690 3300049823 Bacteria 15285
425 Ga0501045_0000736 3300049824 Bacteria 20879
426 Ga0501045_0000928 3300049824 Bacteria 19139
427 Ga0501045_0009428 3300049824 Bacteria 6828
428 Ga0501045_0032587 3300049824 Bacteria 3776
429 Ga0501045_0164385 3300049824 Bacteria 1652
430 Ga0501045_0636770 3300049824 Bacteria 788
431 nmdc:mga0yw44_504283_c1 3300050492 Bacteria 821
432 nmdc:mga05p37_2318_c1 3300050507 Bacteria 22162
433 nmdc:mga05p37_386806_c1 3300050507 Bacteria 1637
434 nmdc:mga05p37_803500_c1 3300050507 Bacteria 1029
435 nmdc:mga0qj67_106600_c1 3300050509 Bacteria 2261
436 nmdc:mga0qj67_26573_c1 3300050509 Bacteria 4480
437 nmdc:mga0qj67_283040_c1 3300050509 Bacteria 1344
438 nmdc:mga06r32_51930_c1 3300050510 Bacteria 3925
439 nmdc:mga08y16_115456_c1 3300050511 Bacteria 2795
440 nmdc:mga08y16_362862_c1 3300050511 Bacteria 1487
441 nmdc:mga0a205_160329_c1 3300050515 Bacteria 2146
442 Ga0501084_0000283 3300054114 Bacteria 38382
443 Ga0501084_0000615 3300054114 Bacteria 27138
444 Ga0501084_0051727 3300054114 Bacteria 3438
445 Ga0501084_0072393 3300054114 Bacteria 2886
446 Ga0501084_0445689 3300054114 Bacteria 1094
447 Ga0501084_0589230 3300054114 Bacteria 939
448 Ga0501084_0604087 3300054114 Bacteria 927
449 Ga0590074_003965 3300059423 Bacteria 2447
450 Ga0590077_005658 3300059426 Bacteria 2554
451 Ga0501082_0000620 3300060353 Bacteria 31200
452 Ga0501082_0458768 3300060353 Bacteria 1113
453 Ga0530510_0001002 3300061734 Bacteria 18761
454 Ga0530510_0001060 3300061734 Bacteria 18252
455 Ga0530510_0006705 3300061734 Bacteria 8028
456 Ga0530510_0018790 3300061734 Bacteria 4902
457 Ga0530510_0068560 3300061734 Bacteria 2573
458 Ga0530510_0124087 3300061734 Bacteria 1897
459 Ga0530510_0427301 3300061734 Bacteria 1000
460 Ga0207654_10076866
461 JGI25407J50210_10015139
462 JGI25407J50210_10027950
463 Ga0070658_10015063
464 Ga0070658_10070570
465 Ga0070658_10116793
466 Ga0070683_100022595
467 Ga0070683_100075139
468 Ga0070683_100099907
469 Ga0070683_100316183
470 Ga0070683_100815674
471 Ga0070683_101195209
472 Ga0070680_100155257
473 Ga0070680_100174254
474 Ga0070680_100299104
475 Ga0070680_100497730
476 Ga0070680_100724517
477 Ga0070682_100015278
478 Ga0070682_100154843
479 Ga0070682_100348266
480 Ga0068868_100590599
481 Ga0070660_100268369
482 Ga0070660_100471732
483 Ga0070660_100687506
484 Ga0070661_100020187
485 Ga0070661_100254718
486 Ga0070661_100600424
487 Ga0070659_100014825
488 Ga0070659_100045699
489 Ga0070659_100075497
490 Ga0070659_100588080
491 Ga0070714_100729994
492 Ga0070714_101147513
493 Ga0070711_101641253
494 Ga0070708_100132828
495 Ga0070708_101271884
496 Ga0070663_100053269
497 Ga0070663_101295453
498 Ga0070678_100046369
499 Ga0070681_10001855
500 Ga0070681_10027200
501 Ga0070681_10094169
502 Ga0070681_10145023
503 Ga0070681_10496921
504 Ga0070707_100002585
505 Ga0070707_100380288
506 Ga0070698_101780629
507 Ga0070699_100180237
508 Ga0070679_100011004
509 Ga0070679_100022714
510 Ga0070679_100024040
511 Ga0070679_100106302
512 Ga0070679_100130876
513 Ga0070679_100133301
514 Ga0070679_100157859
515 Ga0070679_101188708
516 Ga0070684_100050911
517 Ga0070684_100103688
518 Ga0070684_100227446
519 Ga0070684_100238029
520 Ga0068853_100184595
521 Ga0068853_100736365
522 Ga0070693_100032753
523 Ga0070665_100090599
524 Ga0068855_100182389
525 Ga0068855_100808864
526 Ga0068855_101676490
527 Ga0070664_100484286
528 Ga0068857_100018224
529 Ga0068857_100243325
530 Ga0068856_100152722
531 Ga0068856_100303847
532 Ga0068856_100826625
533 Ga0070702_100664233
534 Ga0068852_100197160
535 Ga0068852_100642962
536 Ga0068852_101200015
537 Ga0068861_100602304
538 Ga0081455_10083804
539 Ga0081455_10684329
540 Ga0081538_10000151
541 Ga0081538_10001761
542 Ga0081538_10002077
543 Ga0081538_10002734
544 Ga0081538_10007728
545 Ga0081539_10062333
546 Ga0075430_100455337
547 Ga0075431_100051547
548 Ga0075434_101341496
549 Ga0068865_101674768
550 Ga0075436_100738084
551 Ga0105240_10076875
552 Ga0111539_10480498
553 Ga0105245_10250360
554 Ga0114129_10583487
555 Ga0114129_10596469
556 Ga0105241_11184637
557 Ga0105242_10930539
558 Ga0105238_10072267
559 Ga0105238_11602152
560 Ga0105238_12438983
561 Ga0105239_10382721
562 Ga0105239_12862474
563 Ga0105246_10194842
564 Ga0157373_10019815
565 Ga0157373_10845756
566 Ga0157373_11199382
567 Ga0157370_10127851
568 Ga0157370_10515046
569 Ga0157370_10569794
570 Ga0157369_10127560
571 Ga0157369_10801573
572 Ga0157369_11265717
573 Ga0157374_10980286
574 Ga0157374_11117628
575 Ga0157372_10263042
576 Ga0157372_11476347
577 Ga0157375_10121277
578 Ga0163163_10306827
579 Ga0157376_10395430
580 Ga0163161_11093152
581 Ga0197907_10369962
582 Ga0197907_10648429
583 Ga0206356_11410211
584 Ga0206356_11501934
585 Ga0206350_10712675
586 Ga0206354_10247831
587 Ga0206354_11183078
588 Ga0206353_10885954
589 Ga0206353_11089650
590 Ga0206353_11647635
591 Ga0206353_12040689
592 Ga0213871_10121145
593 Ga0207656_10051258
594 Ga0207647_10197100
595 Ga0207684_10071038
596 Ga0207654_10687812
597 Ga0207707_10002919
598 Ga0207707_10051905
599 Ga0207707_10065796
600 Ga0207707_10122497
601 Ga0207707_10384688
602 Ga0207695_11418319
603 Ga0207671_10304417
604 Ga0207660_10017699
605 Ga0207660_10032985
606 Ga0207660_10047469
607 Ga0207657_10005284
608 Ga0207657_10015154
609 Ga0207657_10034499
610 Ga0207657_10383365
611 Ga0207649_10074133
612 Ga0207649_10821488
613 Ga0207652_10032369
614 Ga0207652_10084152
615 Ga0207652_10351607
616 Ga0207652_10432409
617 Ga0207652_10566618
618 Ga0207646_10059910
619 Ga0207646_11283483
620 Ga0207694_10060508
621 Ga0207694_10078985
622 Ga0207687_10008411
623 Ga0207664_10359791
624 Ga0207664_10735278
625 Ga0207664_11767126
626 Ga0207690_10011819
627 Ga0207690_10217251
628 Ga0207686_10537649
629 Ga0207709_10031561
630 Ga0207711_11108222
631 Ga0207661_10005687
632 Ga0207661_10022508
633 Ga0207661_10113176
634 Ga0207661_10198260
635 Ga0207679_10959223
636 Ga0207667_10104673
637 Ga0207667_10335556
638 Ga0207667_10606328
639 Ga0207651_10901898
640 Ga0207640_10370815
641 Ga0207677_10092352
642 Ga0207639_10045706
643 Ga0207639_10161159
644 Ga0207639_10436784
645 Ga0207678_10059014
646 Ga0207702_10002686
647 Ga0207702_10115634
648 Ga0207702_10315932
649 Ga0207702_11503121
650 Ga0207648_10406222
651 Ga0207674_10060145
652 Ga0207675_100832793
653 Ga0207683_10014446
654 Ga0207698_10351092
655 Ga0207698_10619671
656 Ga0207698_11212422
657 Ga0209998_10035180
658 Ga0207428_10068629
659 Ga0268266_10046859
660 Ga0265319_1001733
661 Ga0265334_10001101
662 Ga0265318_10001418
663 Ga0265338_10099685
664 Ga0265330_10002530
665 Ga0265332_10001984
666 Ga0265328_10006199
667 Ga0265320_10028616
668 Ga0265325_10001202
669 Ga0265329_10004897
670 Ga0265340_10001330
671 Ga0265339_10004586
672 Ga0265331_10093491
673 Ga0265327_10009773
674 Ga0265316_10017243
675 Ga0307408_100030330
676 Ga0307408_101005551
677 Ga0265313_10004804
678 Ga0265314_10008470
679 Ga0265342_10023644
680 Ga0307405_10664004
681 Ga0307413_10020673
682 Ga0307406_10046866
683 Ga0307407_10080901
684 Ga0307412_10014671
685 Ga0307409_100057589
686 Ga0307416_100032245
687 Ga0307416_100083306
688 Ga0307414_10076757
689 Ga0307411_10085169
690 Ga0307415_100008441
691 Ga0373926_0111316
692 Ga0373944_0016874
693 Ga0373945_0141972
694 Ga0373955_0033805
695 Ga0373937_0067243
696 Ga0373925_0828471
697 Ga0395899_0006920
698 Ga0395899_0290612
699 Ga0395900_0025290
700 Ga0395900_0300206
701 Ga0395900_0343228
702 Ga0395900_0356010
703 Ga0395898_0001875
704 Ga0395898_0003526
705 Ga0395898_0080149
706 Ga0395898_0155396
707 Ga0395905_0021602
708 Ga0395905_0628897
709 Ga0395901_0012794
710 Ga0395901_0019001
711 Ga0395901_0066637
712 Ga0395901_0155817
713 Ga0395901_1032395
714 Ga0436360_0173849
715 Ga0451853_0090004
716 Ga0451853_2478238
717 Ga0439448_0051420
718 Ga0439458_0036027
719 Ga0450918_013821
720 Ga0439440_0103540
721 Ga0466964_0005916
722 Ga0451576_0383249
723 Ga0466967_0000455
724 Ga0466967_0033564
725 Ga0466967_0121143
726 Ga0466967_0170297
727 Ga0466967_0722821
728 Ga0495641_0004211
729 Ga0495653_0050259
730 Ga0495664_0711981
731 Ga0495608_0042731
732 Ga0495665_0151413
733 Ga0495588_0001142
734 Ga0495657_0010689
735 Ga0495613_0289669
736 Ga0495676_0013121
737 Ga0495680_0046294
738 Ga0495684_0112963
739 Ga0496100_0473039
740 Ga0496101_0093846
741 Ga0496101_0453226
742 Ga0496102_0005080
743 Ga0496102_1517015
744 Ga0496103_0033886
745 Ga0496104_0154373
746 Ga0496105_0136468
747 Ga0496106_0003838
748 Ga0496107_0013209
749 Ga0496107_0701207
750 Ga0496109_0039250
751 Ga0496109_0146832
752 Ga0496110_0061466
753 Ga0496110_0111935
754 Ga0496110_0338388
755 Ga0496110_0666983
756 Ga0496111_0008012
757 Ga0496111_0034932
758 Ga0496111_0332872
759 Ga0496112_0125902
760 Ga0496112_0493546
761 Ga0496112_0648810
762 Ga0496113_0609380
763 Ga0496114_0000177
764 Ga0496114_0820429
765 Ga0496115_0087488
766 Ga0501031_0000033
767 Ga0501031_0006310
768 Ga0501031_0073116
769 Ga0501032_0002047
770 Ga0501032_0047232
771 Ga0501032_0076317
772 Ga0501032_0845823
773 Ga0501033_0000388
774 Ga0501033_0069261
775 Ga0501033_0190336
776 Ga0501033_0353193
777 Ga0501034_0074710
778 Ga0501036_0000462
779 Ga0501036_0020687
780 Ga0501036_0068778
781 Ga0501036_0134907
782 Ga0501037_0000915
783 Ga0501037_0519385
784 Ga0501037_0580775
785 Ga0501038_0001345
786 Ga0501038_0075570
787 Ga0501038_0515859
788 Ga0501039_0000528
789 Ga0501039_0002890
790 Ga0501039_0054320
791 Ga0501039_0065473
792 Ga0501040_0000234
793 Ga0501040_0004493
794 Ga0501040_0040484
795 Ga0501040_0061569
796 Ga0501040_0187434
797 Ga0501040_0305540
798 Ga0501041_0000176
799 Ga0501041_0001613
800 Ga0501041_0022646
801 Ga0501042_0001987
802 Ga0501042_0007569
803 Ga0501042_0031348
804 Ga0501042_0177439
805 Ga0501043_0000798
806 Ga0501043_0104980
807 Ga0501043_0164777
808 Ga0501043_0575287
809 Ga0501046_0000577
810 Ga0501046_0001998
811 Ga0501046_0057511
812 Ga0501046_0074882
813 Ga0501046_0135535
814 Ga0501047_0001088
815 Ga0501048_0000440
816 Ga0501048_0080873
817 Ga0501048_0212642
818 Ga0501048_0311063
819 Ga0501067_0000470
820 Ga0501067_0008570
821 Ga0501067_0017132
822 Ga0501067_0434521
823 Ga0501068_0000344
824 Ga0501068_0047509
825 Ga0501068_0053171
826 Ga0501068_0456851
827 Ga0501069_0003245
828 Ga0501069_0021717
829 Ga0501070_0002078
830 Ga0501070_0031201
831 Ga0501070_0180268
832 Ga0501070_1298992
833 Ga0501071_0000054
834 Ga0501071_0001775
835 Ga0501071_0048976
836 Ga0501071_0111669
837 Ga0501071_0697620
838 Ga0501072_0001204
839 Ga0501072_0017146
840 Ga0501072_0251476
841 Ga0501073_0006519
842 Ga0501073_0008654
843 Ga0501073_0380895
844 Ga0501073_0389563
845 Ga0501074_0000008
846 Ga0501074_0041006
847 Ga0501074_0074220
848 Ga0501074_0532376
849 Ga0501075_0000096
850 Ga0501075_0000800
851 Ga0501075_0053142
852 Ga0501075_0196259
853 Ga0501076_0000020
854 Ga0501076_0000459
855 Ga0501076_0075018
856 Ga0501076_0100313
857 Ga0501076_0385669
858 Ga0501076_0551321
859 Ga0501077_0001221
860 Ga0501077_0011129
861 Ga0501077_0021332
862 Ga0501077_0348023
863 Ga0501079_0000001
864 Ga0501079_0003968
865 Ga0501079_0017178
866 Ga0501079_0057524
867 Ga0501079_0328032
868 Ga0501080_0002158
869 Ga0501080_0032227
870 Ga0501080_0497006
871 Ga0501081_0000001
872 Ga0501081_0003671
873 Ga0501081_0005491
874 Ga0501081_0208814
875 Ga0501081_0390330
876 Ga0501081_0601616
877 Ga0501083_0000490
878 Ga0501083_0002293
879 Ga0501035_0001281
880 Ga0501035_0014222
881 Ga0501035_0149812
882 Ga0501035_0215516
883 Ga0501044_0004690
884 Ga0501045_0000736
885 Ga0501045_0000928
886 Ga0501045_0009428
887 Ga0501045_0032587
888 Ga0501045_0164385
889 Ga0501045_0636770
890 nmdc:mga0yw44_504283_c1
891 nmdc:mga05p37_2318_c1
892 nmdc:mga05p37_386806_c1
893 nmdc:mga05p37_803500_c1
894 nmdc:mga0qj67_106600_c1
895 nmdc:mga0qj67_26573_c1
896 nmdc:mga0qj67_283040_c1
897 nmdc:mga06r32_51930_c1
898 nmdc:mga08y16_115456_c1
899 nmdc:mga08y16_362862_c1
900 nmdc:mga0a205_160329_c1
901 Ga0501084_0000283
902 Ga0501084_0000615
903 Ga0501084_0051727
904 Ga0501084_0072393
905 Ga0501084_0445689
906 Ga0501084_0589230
907 Ga0501084_0604087
908 Ga0590074_003965
909 Ga0590077_005658
910 Ga0501082_0000620
911 Ga0501082_0458768
912 Ga0530510_0001002
913 Ga0530510_0001060
914 Ga0530510_0006705
915 Ga0530510_0018790
916 Ga0530510_0068560
917 Ga0530510_0124087
918 Ga0530510_0427301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

30

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8521 77 153
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.838 77 159
8bew-assembly1.cif.gz_B cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the oxidised state 0.8321 75 159
7p5h-assembly1.cif.gz_C tmhydabc- d2 map 0.8042 10 157
7q4v-assembly1.cif.gz_B electron bifurcating hydrogenase - hydabc from a. woodii 0.8025 72 159
ID Description Score Start End Superfamily
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9664 73 154 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9621 74 158 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9441 73 154 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9381 74 158 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9367 74 157 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2M7JZR8-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.8728 18 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F6PF55-F1-model_v4 Ferredoxin 0.8594 7 156 GO:0005506
GO:0008137
GO:0008901
GO:0016020
GO:0042773
GO:0051539
AF-A0A653A7F6-F1-model_v4 Respiratory-chain NADH dehydrogenase 24 Kd subunit 0.8584 7 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A3N5QQK3-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.8571 13 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A661PR46-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.8546 7 157 GO:0016491
GO:0046872
GO:0051537

Map