F448371

General Info

Members Datasets Scaffolds Average Seq Length
459 221 918 445

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10181521|Ga0207689_101815212
Length 472
Sequence LMAASITPWAPAAFETSPPTAMALPPEAVMAEIAEDTRETVKQKFQLATTAQAAWANTPLEKRIACMETFYKLLNEQKEELAKTLTWEMGKPLQQSYNELNGARSRIKYFIDNSAKYLAEEWVTTDGATKEKIVYEPLGVIANISAWNYPYLVGVNVFIPALIGGNGVLYKPSEYSTLTGLHIQRLLYRSGVPSTIFQVVVGKGAAGEWLLQLPLDGYFFTGSYRTGKYIAEKVASKLVPCQLELGGKDPLYVMDDVEDINKVAGAALEGVVYNNGQSCCAVERIYVQEGIYDAFVASYVEQLKKMVVGDPMTAGTDVGPLSRPGQLEFLLDQVKDAVAKGGKLLYGGQKVNRKGYFIEPAVLVNVDHGMKLMVEESFGPVVGIQKVKGDKEAVDLMADTEYGLTAAVYSKSYERAEQVMKQLNTGTVYWNCCDRVSAGLPWSGRKHSGLGMTLSYQGIRAFVQPKAYHIRP

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
202 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
214 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
217 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
218 2738541283 Pedobacter sp. OK701 Isolate Unclassified
219 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
220 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
221 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 0
Rhizoplane 0.65
Rhizosphere 81.48
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10181521 3300025942 Bacteria 1735
2 JGI25155J39150_1000184 3300002704 Bacteria 26887
3 JGI25156J39149_1000100 3300002705 Bacteria 63565
4 JGI25154J39366_1000121 3300002738 Bacteria 62887
5 JGI25157J39369_1000130 3300002741 Bacteria 63360
6 JGI25159J45721_1000190 3300002987 Bacteria 28606
7 rootH2_10001545 3300003320 Bacteria 30757
8 rootH2_10008359 3300003320 Bacteria 5957
9 rootH2_10087914 3300003320 Bacteria 5372
10 rootL2_10282662 3300003322 Bacteria 1755
11 rootH1_10058312 3300003323 Unclassified 4242
12 JGI25160J50197_1000345 3300003354 Bacteria 30950
13 JGI25160J50197_1000460 3300003354 Bacteria 25318
14 JGI25161J50226_1000007 3300003374 Bacteria 256181
15 Ga0055543_1003104 3300004625 Bacteria 5089
16 Ga0065165_1004588 3300005262 Bacteria 8422
17 Ga0065165_1015129 3300005262 Bacteria 2957
18 Ga0065165_1020665 3300005262 Bacteria 2310
19 Ga0065714_10104769 3300005288 Bacteria 1578
20 Ga0065707_10088964 3300005295 Bacteria 4501
21 Ga0070676_10000604 3300005328 Bacteria 17459
22 Ga0070676_10000943 3300005328 Bacteria 14431
23 Ga0070676_10025846 3300005328 Bacteria 3322
24 Ga0070683_100006446 3300005329 Bacteria 9846
25 Ga0070683_100109031 3300005329 Bacteria 2611
26 Ga0070670_100006486 3300005331 Bacteria 9902
27 Ga0070670_100014031 3300005331 Bacteria 6871
28 Ga0070670_100077274 3300005331 Bacteria 2860
29 Ga0070670_100078925 3300005331 Bacteria 2828
30 Ga0070670_100105275 3300005331 Bacteria 2430
31 Ga0070670_100170987 3300005331 Bacteria 1885
32 Ga0070677_10000715 3300005333 Bacteria 11122
33 Ga0068869_100001799 3300005334 Bacteria 12863
34 Ga0068869_100012846 3300005334 Bacteria 5543
35 Ga0068869_100023329 3300005334 Bacteria 4272
36 Ga0070666_10017819 3300005335 Bacteria 4557
37 Ga0068868_100042168 3300005338 Bacteria 3560
38 Ga0068868_100050912 3300005338 Bacteria 3255
39 Ga0068868_100084714 3300005338 Unclassified 2546
40 Ga0068868_100102600 3300005338 Bacteria 2316
41 Ga0070689_100085536 3300005340 Bacteria 2480
42 Ga0070661_100103760 3300005344 Bacteria 2118
43 Ga0070668_100006289 3300005347 Bacteria 8790
44 Ga0070668_100007201 3300005347 Bacteria 8248
45 Ga0070668_100021056 3300005347 Bacteria 4928
46 Ga0070668_100045462 3300005347 Bacteria 3368
47 Ga0070669_100012560 3300005353 Bacteria 6006
48 Ga0070669_100136673 3300005353 Bacteria 1886
49 Ga0070675_100000127 3300005354 Bacteria 45462
50 Ga0070675_100001971 3300005354 Bacteria 15193
51 Ga0070675_100005037 3300005354 Bacteria 10085
52 Ga0070675_100047277 3300005354 Bacteria 3526
53 Ga0070675_100065577 3300005354 Bacteria 3003
54 Ga0070675_100089761 3300005354 Bacteria 2573
55 Ga0070671_100000385 3300005355 Bacteria 30358
56 Ga0070671_100006204 3300005355 Bacteria 9524
57 Ga0070671_100039970 3300005355 Bacteria 3894
58 Ga0070671_100040716 3300005355 Bacteria 3860
59 Ga0070671_100068752 3300005355 Bacteria 2954
60 Ga0070671_100209509 3300005355 Bacteria 1653
61 Ga0070674_100000721 3300005356 Bacteria 16880
62 Ga0070674_100026393 3300005356 Bacteria 3794
63 Ga0070674_100105969 3300005356 Bacteria 2056
64 Ga0070673_100063953 3300005364 Bacteria 2929
65 Ga0070659_100128926 3300005366 Unclassified 2053
66 Ga0070667_100004836 3300005367 Bacteria 11286
67 Ga0070667_100005678 3300005367 Bacteria 10421
68 Ga0070667_100050033 3300005367 Bacteria 3521
69 Ga0070667_100079940 3300005367 Bacteria 2796
70 Ga0070667_100147500 3300005367 Bacteria 2064
71 Ga0070700_100111154 3300005441 Bacteria 1822
72 Ga0070663_100140247 3300005455 Bacteria 1845
73 Ga0070678_100001077 3300005456 Bacteria 14291
74 Ga0070678_100006637 3300005456 Bacteria 6808
75 Ga0070678_100018722 3300005456 Bacteria 4495
76 Ga0070678_100028904 3300005456 Bacteria 3788
77 Ga0070678_100039041 3300005456 Bacteria 3346
78 Ga0070678_100053343 3300005456 Bacteria 2940
79 Ga0070662_100092509 3300005457 Bacteria 2273
80 Ga0070681_10084605 3300005458 Bacteria 3124
81 Ga0068867_100000062 3300005459 Bacteria 65188
82 Ga0068867_100004280 3300005459 Bacteria 10043
83 Ga0068867_100008167 3300005459 Bacteria 7394
84 Ga0068867_100008581 3300005459 Bacteria 7213
85 Ga0068867_100028297 3300005459 Bacteria 4035
86 Ga0070679_100018321 3300005530 Bacteria 6793
87 Ga0070679_100046642 3300005530 Bacteria 4319
88 Ga0070684_100028008 3300005535 Bacteria 4762
89 Ga0070684_100095848 3300005535 Bacteria 2644
90 Ga0068853_100003813 3300005539 Bacteria 11550
91 Ga0068853_100010730 3300005539 Bacteria 7419
92 Ga0068853_100106575 3300005539 Bacteria 2484
93 Ga0068853_100132657 3300005539 Bacteria 2231
94 Ga0070672_100006508 3300005543 Bacteria 7850
95 Ga0070672_100028298 3300005543 Bacteria 4191
96 Ga0070672_100056449 3300005543 Bacteria 3080
97 Ga0070672_100064783 3300005543 Bacteria 2889
98 Ga0070672_100111042 3300005543 Bacteria 2234
99 Ga0070665_100000001 3300005548 Bacteria 1083363
100 Ga0068855_100002785 3300005563 Bacteria 21517
101 Ga0068855_100078217 3300005563 Unclassified 3837
102 Ga0068855_100327939 3300005563 Bacteria 1690
103 Ga0070664_100012744 3300005564 Bacteria 6841
104 Ga0070664_100046505 3300005564 Bacteria 3665
105 Ga0070664_100070114 3300005564 Bacteria 3001
106 Ga0070664_100085525 3300005564 Bacteria 2724
107 Ga0068857_100004218 3300005577 Bacteria 12112
108 Ga0068857_100031678 3300005577 Bacteria 4674
109 Ga0068857_100054181 3300005577 Bacteria 3559
110 Ga0068857_100120616 3300005577 Bacteria 2360
111 Ga0068854_100035176 3300005578 Bacteria 3504
112 Ga0068854_100057838 3300005578 Bacteria 2798
113 Ga0068856_100019224 3300005614 Bacteria 6632
114 Ga0068856_100026834 3300005614 Bacteria 5617
115 Ga0068856_100052625 3300005614 Bacteria 4016
116 Ga0068856_100338961 3300005614 Bacteria 1521
117 Ga0068852_100006263 3300005616 Bacteria 8585
118 Ga0068852_100041890 3300005616 Bacteria 3874
119 Ga0068852_100074430 3300005616 Bacteria 2991
120 Ga0068852_100193832 3300005616 Bacteria 1919
121 Ga0068859_100029647 3300005617 Bacteria 5491
122 Ga0068859_100067783 3300005617 Bacteria 3604
123 Ga0068859_100092083 3300005617 Bacteria 3083
124 Ga0068864_100000351 3300005618 Bacteria 40447
125 Ga0068864_100028166 3300005618 Bacteria 4747
126 Ga0068864_100079621 3300005618 Bacteria 2869
127 Ga0068864_100093095 3300005618 Bacteria 2662
128 Ga0068864_100134311 3300005618 Bacteria 2226
129 Ga0068861_100015872 3300005719 Bacteria 5318
130 Ga0068861_100028835 3300005719 Bacteria 4053
131 Ga0068851_10004682 3300005834 Bacteria 6184
132 Ga0068870_10003842 3300005840 Bacteria 6401
133 Ga0068863_100010333 3300005841 Bacteria 9069
134 Ga0068863_100039963 3300005841 Bacteria 4461
135 Ga0068863_100043548 3300005841 Bacteria 4261
136 Ga0068858_100003527 3300005842 Bacteria 15491
137 Ga0068858_100023202 3300005842 Bacteria 5786
138 Ga0068858_100083172 3300005842 Bacteria 2977
139 Ga0068860_100000004 3300005843 Bacteria 506126
140 Ga0068860_100006576 3300005843 Bacteria 11671
141 Ga0068860_100022903 3300005843 Bacteria 6039
142 Ga0068860_100025246 3300005843 Bacteria 5735
143 Ga0068860_100049436 3300005843 Bacteria 4005
144 Ga0068860_100163733 3300005843 Bacteria 2146
145 Ga0068862_100015885 3300005844 Bacteria 6256
146 Ga0068862_100082356 3300005844 Bacteria 2793
147 Ga0081539_10038253 3300005985 Bacteria 2845
148 Ga0075367_10026937 3300006178 Bacteria 3265
149 Ga0097621_100014377 3300006237 Bacteria 5922
150 Ga0097621_100022886 3300006237 Bacteria 4855
151 Ga0097621_100031052 3300006237 Bacteria 4236
152 Ga0097621_100049382 3300006237 Bacteria 3418
153 Ga0097621_100246035 3300006237 Bacteria 1565
154 Ga0075370_10000861 3300006353 Bacteria 12334
155 Ga0075370_10002560 3300006353 Bacteria 8464
156 Ga0075370_10004395 3300006353 Bacteria 6838
157 Ga0068871_100019509 3300006358 Bacteria 5177
158 Ga0068871_100034771 3300006358 Bacteria 4001
159 Ga0068871_100053015 3300006358 Bacteria 3286
160 Ga0075434_100211962 3300006871 Bacteria 1957
161 Ga0075429_100005109 3300006880 Bacteria 11288
162 Ga0068865_100100367 3300006881 Bacteria 2118
163 Ga0068865_100141227 3300006881 Bacteria 1816
164 Ga0097620_100029648 3300006931 Bacteria 5491
165 Ga0097620_100067784 3300006931 Bacteria 3604
166 Ga0097620_100092081 3300006931 Bacteria 3083
167 Ga0075435_100105865 3300007076 Bacteria 2335
168 Ga0105240_10000306 3300009093 Bacteria 94696
169 Ga0105240_10004135 3300009093 Bacteria 22246
170 Ga0105240_10004279 3300009093 Bacteria 21805
171 Ga0105240_10005862 3300009093 Bacteria 18213
172 Ga0105240_10026987 3300009093 Bacteria 7528
173 Ga0105248_10010063 3300009177 Bacteria 10418
174 Ga0105248_10017784 3300009177 Bacteria 7844
175 Ga0105248_10045954 3300009177 Bacteria 4895
176 Ga0105248_10074178 3300009177 Bacteria 3824
177 Ga0105248_10255449 3300009177 Bacteria 1973
178 Ga0105248_10416979 3300009177 Bacteria 1512
179 Ga0105237_10000437 3300009545 Bacteria 59394
180 Ga0105237_10002822 3300009545 Bacteria 21126
181 Ga0105237_10007737 3300009545 Bacteria 11732
182 Ga0105237_10009118 3300009545 Bacteria 10660
183 Ga0105237_10013370 3300009545 Bacteria 8610
184 Ga0105237_10022459 3300009545 Bacteria 6473
185 Ga0105238_10031248 3300009551 Bacteria 5421
186 Ga0105238_10129016 3300009551 Unclassified 2507
187 Ga0105249_10049898 3300009553 Bacteria 3816
188 Ga0105249_10095059 3300009553 Bacteria 2794
189 Ga0105239_10004848 3300010375 Bacteria 15917
190 Ga0105239_10039856 3300010375 Bacteria 5146
191 Ga0157373_10026677 3300013100 Bacteria 4170
192 Ga0157370_10000207 3300013104 Bacteria 74451
193 Ga0157370_10007943 3300013104 Bacteria 11491
194 Ga0157369_10062765 3300013105 Bacteria 4003
195 Ga0157374_10000001 3300013296 Bacteria 1077351
196 Ga0157374_10027536 3300013296 Bacteria 5131
197 Ga0157378_10004383 3300013297 Bacteria 12424
198 Ga0157378_10009738 3300013297 Bacteria 8372
199 Ga0157378_10015183 3300013297 Bacteria 6743
200 Ga0163162_10000374 3300013306 Bacteria 40673
201 Ga0163162_10003894 3300013306 Bacteria 14330
202 Ga0163162_10012797 3300013306 Bacteria 8198
203 Ga0163162_10127276 3300013306 Bacteria 2654
204 Ga0163162_10276377 3300013306 Bacteria 1812
205 Ga0157372_10008093 3300013307 Bacteria 11182
206 Ga0157372_10031053 3300013307 Bacteria 5848
207 Ga0157372_10169870 3300013307 Unclassified 2523
208 Ga0157375_10015848 3300013308 Bacteria 6754
209 Ga0157375_10046713 3300013308 Bacteria 4224
210 Ga0157380_10004698 3300014326 Bacteria 9511
211 Ga0157380_10071137 3300014326 Bacteria 2814
212 Ga0157379_10004055 3300014968 Bacteria 12495
213 Ga0157379_10009960 3300014968 Bacteria 8280
214 Ga0157379_10012529 3300014968 Bacteria 7406
215 Ga0157379_10042334 3300014968 Bacteria 4065
216 Ga0157379_10074640 3300014968 Bacteria 3036
217 Ga0157376_10012234 3300014969 Bacteria 6363
218 Ga0182006_1000109 3300015261 Bacteria 89541
219 Ga0163161_10001458 3300017792 Bacteria 17469
220 Ga0163161_10030350 3300017792 Bacteria 3846
221 Ga0163161_10034549 3300017792 Bacteria 3617
222 Ga0209435_100008 3300025206 Bacteria 503644
223 Ga0209646_1000079 3300025246 Bacteria 207677
224 Ga0209026_1000067 3300025250 Bacteria 207677
225 Ga0209759_1000056 3300025256 Bacteria 207677
226 Ga0209565_1001982 3300025263 Bacteria 7988
227 Ga0209130_1000014 3300025284 Bacteria 412039
228 Ga0209025_1008314 3300025294 Bacteria 7489
229 Ga0209025_1022804 3300025294 Bacteria 3302
230 Ga0209564_1009227 3300025295 Bacteria 4729
231 Ga0209758_1003920 3300025297 Bacteria 12989
232 Ga0209050_1008723 3300025298 Bacteria 5343
233 Ga0209050_1015185 3300025298 Bacteria 3255
234 Ga0207426_1000091 3300025302 Bacteria 280561
235 Ga0209257_1008298 3300025304 Bacteria 5954
236 Ga0207682_10000342 3300025893 Bacteria 21268
237 Ga0207642_10025372 3300025899 Bacteria 2397
238 Ga0207680_10001055 3300025903 Bacteria 13024
239 Ga0207680_10183980 3300025903 Bacteria 1415
240 Ga0207645_10000187 3300025907 Bacteria 49829
241 Ga0207645_10001311 3300025907 Bacteria 20435
242 Ga0207645_10008665 3300025907 Bacteria 7085
243 Ga0207645_10049828 3300025907 Bacteria 2674
244 Ga0207645_10120641 3300025907 Bacteria 1702
245 Ga0207643_10014253 3300025908 Bacteria 4317
246 Ga0207707_10187961 3300025912 Bacteria 1802
247 Ga0207695_10000057 3300025913 Bacteria 376090
248 Ga0207695_10000071 3300025913 Bacteria 315568
249 Ga0207695_10000266 3300025913 Bacteria 132163
250 Ga0207695_10000810 3300025913 Bacteria 58183
251 Ga0207695_10036495 3300025913 Bacteria 5314
252 Ga0207695_10154479 3300025913 Bacteria 2230
253 Ga0207671_10001323 3300025914 Bacteria 29014
254 Ga0207671_10006977 3300025914 Bacteria 9913
255 Ga0207671_10021458 3300025914 Bacteria 4901
256 Ga0207671_10023198 3300025914 Bacteria 4681
257 Ga0207671_10043793 3300025914 Unclassified 3309
258 Ga0207671_10085651 3300025914 Bacteria 2368
259 Ga0207660_10081967 3300025917 Bacteria 2372
260 Ga0207662_10042472 3300025918 Bacteria 2680
261 Ga0207657_10022540 3300025919 Bacteria 5888
262 Ga0207652_10034746 3300025921 Bacteria 4251
263 Ga0207681_10014587 3300025923 Bacteria 4888
264 Ga0207681_10018999 3300025923 Bacteria 4337
265 Ga0207681_10135286 3300025923 Bacteria 1828
266 Ga0207694_10004192 3300025924 Bacteria 11303
267 Ga0207694_10116566 3300025924 Bacteria 2129
268 Ga0207650_10003052 3300025925 Bacteria 11534
269 Ga0207650_10005994 3300025925 Bacteria 8293
270 Ga0207650_10057443 3300025925 Bacteria 2894
271 Ga0207650_10061529 3300025925 Bacteria 2803
272 Ga0207659_10000667 3300025926 Bacteria 20307
273 Ga0207659_10002664 3300025926 Bacteria 10637
274 Ga0207659_10091795 3300025926 Bacteria 2269
275 Ga0207644_10002572 3300025931 Bacteria 11670
276 Ga0207644_10008487 3300025931 Bacteria 6726
277 Ga0207644_10008922 3300025931 Bacteria 6570
278 Ga0207644_10010796 3300025931 Bacteria 6027
279 Ga0207644_10025017 3300025931 Bacteria 4102
280 Ga0207690_10115573 3300025932 Bacteria 1939
281 Ga0207706_10009183 3300025933 Bacteria 9089
282 Ga0207706_10017008 3300025933 Bacteria 6560
283 Ga0207706_10114681 3300025933 Bacteria 2370
284 Ga0207670_10155908 3300025936 Bacteria 1700
285 Ga0207669_10015679 3300025937 Bacteria 3829
286 Ga0207704_10070806 3300025938 Bacteria 2210
287 Ga0207691_10006806 3300025940 Bacteria 11022
288 Ga0207691_10013136 3300025940 Bacteria 7928
289 Ga0207691_10030035 3300025940 Bacteria 5082
290 Ga0207691_10034296 3300025940 Bacteria 4721
291 Ga0207691_10077973 3300025940 Bacteria 2983
292 Ga0207691_10088857 3300025940 Bacteria 2771
293 Ga0207691_10090727 3300025940 Bacteria 2739
294 Ga0207691_10108086 3300025940 Bacteria 2476
295 Ga0207691_10117412 3300025940 Bacteria 2360
296 Ga0207711_10018476 3300025941 Bacteria 5796
297 Ga0207711_10041277 3300025941 Bacteria 3929
298 Ga0207689_10041672 3300025942 Bacteria 3799
299 Ga0207689_10055386 3300025942 Bacteria 3264
300 Ga0207689_10147472 3300025942 Bacteria 1939
301 Ga0207661_10126620 3300025944 Bacteria 2182
302 Ga0207679_10074543 3300025945 Bacteria 2572
303 Ga0207667_10000816 3300025949 Bacteria 40267
304 Ga0207667_10002800 3300025949 Bacteria 21597
305 Ga0207651_10213314 3300025960 Bacteria 1555
306 Ga0207712_10113572 3300025961 Bacteria 2036
307 Ga0207668_10007648 3300025972 Bacteria 6430
308 Ga0207668_10010555 3300025972 Bacteria 5583
309 Ga0207668_10070960 3300025972 Bacteria 2486
310 Ga0207640_10030721 3300025981 Bacteria 3311
311 Ga0207640_10183425 3300025981 Bacteria 1571
312 Ga0207658_10000888 3300025986 Bacteria 24911
313 Ga0207658_10078926 3300025986 Bacteria 2517
314 Ga0207658_10149053 3300025986 Bacteria 1903
315 Ga0207677_10006058 3300026023 Bacteria 6596
316 Ga0207677_10040862 3300026023 Bacteria 3062
317 Ga0207677_10073154 3300026023 Bacteria 2426
318 Ga0207703_10002841 3300026035 Bacteria 14773
319 Ga0207703_10011542 3300026035 Bacteria 6871
320 Ga0207703_10182258 3300026035 Bacteria 1854
321 Ga0207703_10259724 3300026035 Bacteria 1570
322 Ga0207639_10110517 3300026041 Unclassified 2239
323 Ga0207678_10012222 3300026067 Bacteria 7538
324 Ga0207678_10141916 3300026067 Bacteria 2050
325 Ga0207708_10086134 3300026075 Bacteria 2417
326 Ga0207702_10007540 3300026078 Bacteria 9277
327 Ga0207702_10025701 3300026078 Bacteria 4888
328 Ga0207702_10026920 3300026078 Bacteria 4775
329 Ga0207641_10004175 3300026088 Bacteria 12583
330 Ga0207641_10014973 3300026088 Bacteria 6358
331 Ga0207641_10050979 3300026088 Bacteria 3504
332 Ga0207641_10074734 3300026088 Bacteria 2924
333 Ga0207648_10000556 3300026089 Bacteria 41762
334 Ga0207648_10004701 3300026089 Bacteria 13958
335 Ga0207648_10007882 3300026089 Bacteria 10391
336 Ga0207648_10012586 3300026089 Bacteria 7916
337 Ga0207648_10091303 3300026089 Bacteria 2662
338 Ga0207676_10003962 3300026095 Bacteria 10452
339 Ga0207676_10016150 3300026095 Bacteria 5402
340 Ga0207676_10018529 3300026095 Bacteria 5062
341 Ga0207674_10003770 3300026116 Bacteria 18486
342 Ga0207674_10090048 3300026116 Bacteria 3060
343 Ga0207675_100002028 3300026118 Bacteria 20196
344 Ga0207675_100088559 3300026118 Bacteria 2908
345 Ga0207683_10000012 3300026121 Bacteria 134768
346 Ga0207683_10007348 3300026121 Bacteria 9441
347 Ga0207698_10014278 3300026142 Bacteria 5274
348 Ga0207698_10015143 3300026142 Bacteria 5156
349 Ga0207698_10029059 3300026142 Bacteria 3953
350 Ga0207698_10162206 3300026142 Unclassified 1957
351 Ga0268266_10000065 3300028379 Bacteria 246498
352 Ga0268266_10226459 3300028379 Bacteria 1720
353 Ga0268265_10011565 3300028380 Bacteria 5967
354 Ga0268264_10000011 3300028381 Bacteria 580884
355 Ga0268264_10003904 3300028381 Bacteria 12766
356 Ga0268264_10029934 3300028381 Bacteria 4463
357 Ga0307517_10002460 3300028786 Bacteria 29616
358 Ga0307517_10005403 3300028786 Bacteria 19280
359 Ga0307515_10000677 3300028794 Bacteria 78511
360 Ga0307515_10009043 3300028794 Bacteria 19330
361 Ga0307515_10045441 3300028794 Bacteria 6747
362 Ga0307511_10001482 3300030521 Bacteria 24847
363 Ga0307512_10019649 3300030522 Bacteria 6142
364 Ga0307513_10002838 3300031456 Bacteria 23744
365 Ga0307513_10011393 3300031456 Bacteria 11054
366 Ga0307513_10075392 3300031456 Unclassified 3503
367 Ga0307509_10000092 3300031507 Bacteria 124019
368 Ga0307509_10011671 3300031507 Bacteria 10614
369 Ga0307509_10016290 3300031507 Bacteria 8606
370 Ga0307509_10027707 3300031507 Bacteria 6302
371 Ga0307509_10160520 3300031507 Unclassified 2147
372 Ga0307508_10001131 3300031616 Bacteria 30761
373 Ga0307508_10003175 3300031616 Bacteria 16802
374 Ga0307508_10016226 3300031616 Bacteria 6779
375 Ga0307508_10077352 3300031616 Unclassified 2906
376 Ga0307514_10120299 3300031649 Bacteria 1834
377 Ga0307516_10000921 3300031730 Bacteria 40429
378 Ga0307516_10001323 3300031730 Bacteria 34352
379 Ga0307516_10021553 3300031730 Bacteria 6626
380 Ga0307412_10028097 3300031911 Bacteria 3515
381 Ga0307409_100001415 3300031995 Bacteria 11756
382 Ga0307416_100023099 3300032002 Bacteria 4505
383 Ga0307415_100021880 3300032126 Bacteria 3938
384 Ga0307510_10001210 3300033180 Bacteria 27978
385 Ga0307510_10009113 3300033180 Bacteria 11816
386 Ga0307510_10127066 3300033180 Bacteria 2235
387 Ga0307510_10174380 3300033180 Bacteria 1724
388 Ga0373944_0011728 3300035089 Bacteria 2405
389 Ga0373962_0018244 3300035242 Bacteria 1825
390 Ga0373924_0023839 3300035410 Bacteria 2406
391 Ga0373931_0007016 3300035691 Bacteria 5301
392 Ga0373931_0026228 3300035691 Bacteria 2964
393 Ga0373931_0115847 3300035691 Bacteria 1526
394 Ga0373937_0143604 3300036401 Bacteria 2233
395 Ga0373925_0002139 3300037068 Bacteria 16150
396 Ga0439431_0004041 3300041997 Bacteria 3226
397 Ga0466965_0030875 3300044683 Bacteria 2612
398 Ga0466959_0004034 3300045049 Bacteria 9762
399 Ga0451576_0141037 3300045051 Bacteria 2513
400 Ga0451576_0174866 3300045051 Bacteria 2241
401 Ga0495638_0023825 3300046460 Bacteria 3999
402 Ga0495580_0110708 3300046472 Bacteria 1907
403 Ga0495618_0084914 3300046514 Bacteria 2023
404 Ga0495628_0201554 3300046516 Bacteria 1499
405 Ga0495648_0002065 3300046524 Bacteria 19004
406 Ga0495611_0000021 3300046648 Bacteria 123657
407 Ga0495635_0042912 3300046663 Bacteria 3122
408 Ga0495646_0037851 3300046680 Bacteria 2982
409 Ga0495647_0009173 3300046681 Bacteria 3343
410 Ga0495658_0004018 3300046683 Bacteria 7252
411 Ga0495624_0037301 3300046690 Bacteria 3128
412 Ga0495649_0003733 3300046694 Bacteria 10126
413 Ga0495660_0023328 3300046810 Bacteria 3529
414 Ga0495674_0146235 3300047319 Bacteria 1984
415 Ga0495680_0042795 3300047322 Bacteria 3591
416 Ga0495687_000001 3300047443 Bacteria 1215582
417 Ga0495687_001245 3300047443 Bacteria 24266
418 Ga0495686_0000094 3300047472 Bacteria 187720
419 Ga0496108_0014711 3300048911 Bacteria 6385
420 Ga0496108_0024257 3300048911 Bacteria 4994
421 Ga0496115_0050347 3300048918 Bacteria 3337
422 Ga0496122_0001826 3300048925 Bacteria 32453
423 Ga0496123_0013586 3300048926 Bacteria 6817
424 Ga0496125_0117764 3300048928 Unclassified 1904
425 Ga0501033_0028764 3300049570 Bacteria 4176
426 Ga0501034_0008948 3300049571 Bacteria 10526
427 Ga0501036_0011414 3300049572 Bacteria 7354
428 Ga0501037_0001231 3300049573 Bacteria 18888
429 Ga0501038_0027018 3300049574 Bacteria 5108
430 Ga0501043_0011000 3300049579 Bacteria 7087
431 Ga0501043_0015232 3300049579 Bacteria 6022
432 Ga0501047_0002532 3300049581 Bacteria 17427
433 Ga0501198_000035 3300049649 Bacteria 54148
434 Ga0501222_000039 3300049662 Bacteria 50352
435 Ga0501035_0012077 3300049822 Bacteria 7987
436 Ga0501044_0001944 3300049823 Bacteria 23909
437 nmdc:mga03n38_59742_c1 3300050490 Bacteria 1731
438 nmdc:mga0yw44_60145_c1 3300050492 Bacteria 2326
439 nmdc:mga0k408_16228_c1 3300050493 Bacteria 4130
440 nmdc:mga0k408_19374_c1 3300050493 Bacteria 3802
441 nmdc:mga0k408_22130_c1 3300050493 Bacteria 3578
442 nmdc:mga07m45_10524_c1 3300050496 Bacteria 4834
443 nmdc:mga07m45_30447_c1 3300050496 Bacteria 2989
444 nmdc:mga07m45_3285_c1 3300050496 Bacteria 7780
445 nmdc:mga07m45_5492_c1 3300050496 Bacteria 6315
446 nmdc:mga09592_4095_c1 3300050508 Bacteria 11773
447 Ga0495612_0019907 3300053078 Bacteria 2689
448 Ga0500658_0069182 3300053134 Bacteria 1485
449 Ga0500568_0005576 3300053139 Bacteria 6484
450 Ga0500619_026941 3300053154 Bacteria 1717
451 Ga0500645_000333 3300053730 Bacteria 33591
452 Ga0500645_003356 3300053730 Bacteria 6556
453 Ga0466962_0050914 3300061719 Unclassified 1980
454 2511245446 2511231002 Bacteria 5042903
455 2644305158 2643221654 Bacteria 5273570
456 2738757150 2738541283 Bacteria 7222293
457 2929182684 2929177148 Bacteria 7883697
458 2945978610 2945977869 Bacteria 7777518
459 2946015527 2946013367 Bacteria 7766675
460 Ga0207689_10181521
461 JGI25155J39150_1000184
462 JGI25156J39149_1000100
463 JGI25154J39366_1000121
464 JGI25157J39369_1000130
465 JGI25159J45721_1000190
466 rootH2_10001545
467 rootH2_10008359
468 rootH2_10087914
469 rootL2_10282662
470 rootH1_10058312
471 JGI25160J50197_1000345
472 JGI25160J50197_1000460
473 JGI25161J50226_1000007
474 Ga0055543_1003104
475 Ga0065165_1004588
476 Ga0065165_1015129
477 Ga0065165_1020665
478 Ga0065714_10104769
479 Ga0065707_10088964
480 Ga0070676_10000604
481 Ga0070676_10000943
482 Ga0070676_10025846
483 Ga0070683_100006446
484 Ga0070683_100109031
485 Ga0070670_100006486
486 Ga0070670_100014031
487 Ga0070670_100077274
488 Ga0070670_100078925
489 Ga0070670_100105275
490 Ga0070670_100170987
491 Ga0070677_10000715
492 Ga0068869_100001799
493 Ga0068869_100012846
494 Ga0068869_100023329
495 Ga0070666_10017819
496 Ga0068868_100042168
497 Ga0068868_100050912
498 Ga0068868_100084714
499 Ga0068868_100102600
500 Ga0070689_100085536
501 Ga0070661_100103760
502 Ga0070668_100006289
503 Ga0070668_100007201
504 Ga0070668_100021056
505 Ga0070668_100045462
506 Ga0070669_100012560
507 Ga0070669_100136673
508 Ga0070675_100000127
509 Ga0070675_100001971
510 Ga0070675_100005037
511 Ga0070675_100047277
512 Ga0070675_100065577
513 Ga0070675_100089761
514 Ga0070671_100000385
515 Ga0070671_100006204
516 Ga0070671_100039970
517 Ga0070671_100040716
518 Ga0070671_100068752
519 Ga0070671_100209509
520 Ga0070674_100000721
521 Ga0070674_100026393
522 Ga0070674_100105969
523 Ga0070673_100063953
524 Ga0070659_100128926
525 Ga0070667_100004836
526 Ga0070667_100005678
527 Ga0070667_100050033
528 Ga0070667_100079940
529 Ga0070667_100147500
530 Ga0070700_100111154
531 Ga0070663_100140247
532 Ga0070678_100001077
533 Ga0070678_100006637
534 Ga0070678_100018722
535 Ga0070678_100028904
536 Ga0070678_100039041
537 Ga0070678_100053343
538 Ga0070662_100092509
539 Ga0070681_10084605
540 Ga0068867_100000062
541 Ga0068867_100004280
542 Ga0068867_100008167
543 Ga0068867_100008581
544 Ga0068867_100028297
545 Ga0070679_100018321
546 Ga0070679_100046642
547 Ga0070684_100028008
548 Ga0070684_100095848
549 Ga0068853_100003813
550 Ga0068853_100010730
551 Ga0068853_100106575
552 Ga0068853_100132657
553 Ga0070672_100006508
554 Ga0070672_100028298
555 Ga0070672_100056449
556 Ga0070672_100064783
557 Ga0070672_100111042
558 Ga0070665_100000001
559 Ga0068855_100002785
560 Ga0068855_100078217
561 Ga0068855_100327939
562 Ga0070664_100012744
563 Ga0070664_100046505
564 Ga0070664_100070114
565 Ga0070664_100085525
566 Ga0068857_100004218
567 Ga0068857_100031678
568 Ga0068857_100054181
569 Ga0068857_100120616
570 Ga0068854_100035176
571 Ga0068854_100057838
572 Ga0068856_100019224
573 Ga0068856_100026834
574 Ga0068856_100052625
575 Ga0068856_100338961
576 Ga0068852_100006263
577 Ga0068852_100041890
578 Ga0068852_100074430
579 Ga0068852_100193832
580 Ga0068859_100029647
581 Ga0068859_100067783
582 Ga0068859_100092083
583 Ga0068864_100000351
584 Ga0068864_100028166
585 Ga0068864_100079621
586 Ga0068864_100093095
587 Ga0068864_100134311
588 Ga0068861_100015872
589 Ga0068861_100028835
590 Ga0068851_10004682
591 Ga0068870_10003842
592 Ga0068863_100010333
593 Ga0068863_100039963
594 Ga0068863_100043548
595 Ga0068858_100003527
596 Ga0068858_100023202
597 Ga0068858_100083172
598 Ga0068860_100000004
599 Ga0068860_100006576
600 Ga0068860_100022903
601 Ga0068860_100025246
602 Ga0068860_100049436
603 Ga0068860_100163733
604 Ga0068862_100015885
605 Ga0068862_100082356
606 Ga0081539_10038253
607 Ga0075367_10026937
608 Ga0097621_100014377
609 Ga0097621_100022886
610 Ga0097621_100031052
611 Ga0097621_100049382
612 Ga0097621_100246035
613 Ga0075370_10000861
614 Ga0075370_10002560
615 Ga0075370_10004395
616 Ga0068871_100019509
617 Ga0068871_100034771
618 Ga0068871_100053015
619 Ga0075434_100211962
620 Ga0075429_100005109
621 Ga0068865_100100367
622 Ga0068865_100141227
623 Ga0097620_100029648
624 Ga0097620_100067784
625 Ga0097620_100092081
626 Ga0075435_100105865
627 Ga0105240_10000306
628 Ga0105240_10004135
629 Ga0105240_10004279
630 Ga0105240_10005862
631 Ga0105240_10026987
632 Ga0105248_10010063
633 Ga0105248_10017784
634 Ga0105248_10045954
635 Ga0105248_10074178
636 Ga0105248_10255449
637 Ga0105248_10416979
638 Ga0105237_10000437
639 Ga0105237_10002822
640 Ga0105237_10007737
641 Ga0105237_10009118
642 Ga0105237_10013370
643 Ga0105237_10022459
644 Ga0105238_10031248
645 Ga0105238_10129016
646 Ga0105249_10049898
647 Ga0105249_10095059
648 Ga0105239_10004848
649 Ga0105239_10039856
650 Ga0157373_10026677
651 Ga0157370_10000207
652 Ga0157370_10007943
653 Ga0157369_10062765
654 Ga0157374_10000001
655 Ga0157374_10027536
656 Ga0157378_10004383
657 Ga0157378_10009738
658 Ga0157378_10015183
659 Ga0163162_10000374
660 Ga0163162_10003894
661 Ga0163162_10012797
662 Ga0163162_10127276
663 Ga0163162_10276377
664 Ga0157372_10008093
665 Ga0157372_10031053
666 Ga0157372_10169870
667 Ga0157375_10015848
668 Ga0157375_10046713
669 Ga0157380_10004698
670 Ga0157380_10071137
671 Ga0157379_10004055
672 Ga0157379_10009960
673 Ga0157379_10012529
674 Ga0157379_10042334
675 Ga0157379_10074640
676 Ga0157376_10012234
677 Ga0182006_1000109
678 Ga0163161_10001458
679 Ga0163161_10030350
680 Ga0163161_10034549
681 Ga0209435_100008
682 Ga0209646_1000079
683 Ga0209026_1000067
684 Ga0209759_1000056
685 Ga0209565_1001982
686 Ga0209130_1000014
687 Ga0209025_1008314
688 Ga0209025_1022804
689 Ga0209564_1009227
690 Ga0209758_1003920
691 Ga0209050_1008723
692 Ga0209050_1015185
693 Ga0207426_1000091
694 Ga0209257_1008298
695 Ga0207682_10000342
696 Ga0207642_10025372
697 Ga0207680_10001055
698 Ga0207680_10183980
699 Ga0207645_10000187
700 Ga0207645_10001311
701 Ga0207645_10008665
702 Ga0207645_10049828
703 Ga0207645_10120641
704 Ga0207643_10014253
705 Ga0207707_10187961
706 Ga0207695_10000057
707 Ga0207695_10000071
708 Ga0207695_10000266
709 Ga0207695_10000810
710 Ga0207695_10036495
711 Ga0207695_10154479
712 Ga0207671_10001323
713 Ga0207671_10006977
714 Ga0207671_10021458
715 Ga0207671_10023198
716 Ga0207671_10043793
717 Ga0207671_10085651
718 Ga0207660_10081967
719 Ga0207662_10042472
720 Ga0207657_10022540
721 Ga0207652_10034746
722 Ga0207681_10014587
723 Ga0207681_10018999
724 Ga0207681_10135286
725 Ga0207694_10004192
726 Ga0207694_10116566
727 Ga0207650_10003052
728 Ga0207650_10005994
729 Ga0207650_10057443
730 Ga0207650_10061529
731 Ga0207659_10000667
732 Ga0207659_10002664
733 Ga0207659_10091795
734 Ga0207644_10002572
735 Ga0207644_10008487
736 Ga0207644_10008922
737 Ga0207644_10010796
738 Ga0207644_10025017
739 Ga0207690_10115573
740 Ga0207706_10009183
741 Ga0207706_10017008
742 Ga0207706_10114681
743 Ga0207670_10155908
744 Ga0207669_10015679
745 Ga0207704_10070806
746 Ga0207691_10006806
747 Ga0207691_10013136
748 Ga0207691_10030035
749 Ga0207691_10034296
750 Ga0207691_10077973
751 Ga0207691_10088857
752 Ga0207691_10090727
753 Ga0207691_10108086
754 Ga0207691_10117412
755 Ga0207711_10018476
756 Ga0207711_10041277
757 Ga0207689_10041672
758 Ga0207689_10055386
759 Ga0207689_10147472
760 Ga0207661_10126620
761 Ga0207679_10074543
762 Ga0207667_10000816
763 Ga0207667_10002800
764 Ga0207651_10213314
765 Ga0207712_10113572
766 Ga0207668_10007648
767 Ga0207668_10010555
768 Ga0207668_10070960
769 Ga0207640_10030721
770 Ga0207640_10183425
771 Ga0207658_10000888
772 Ga0207658_10078926
773 Ga0207658_10149053
774 Ga0207677_10006058
775 Ga0207677_10040862
776 Ga0207677_10073154
777 Ga0207703_10002841
778 Ga0207703_10011542
779 Ga0207703_10182258
780 Ga0207703_10259724
781 Ga0207639_10110517
782 Ga0207678_10012222
783 Ga0207678_10141916
784 Ga0207708_10086134
785 Ga0207702_10007540
786 Ga0207702_10025701
787 Ga0207702_10026920
788 Ga0207641_10004175
789 Ga0207641_10014973
790 Ga0207641_10050979
791 Ga0207641_10074734
792 Ga0207648_10000556
793 Ga0207648_10004701
794 Ga0207648_10007882
795 Ga0207648_10012586
796 Ga0207648_10091303
797 Ga0207676_10003962
798 Ga0207676_10016150
799 Ga0207676_10018529
800 Ga0207674_10003770
801 Ga0207674_10090048
802 Ga0207675_100002028
803 Ga0207675_100088559
804 Ga0207683_10000012
805 Ga0207683_10007348
806 Ga0207698_10014278
807 Ga0207698_10015143
808 Ga0207698_10029059
809 Ga0207698_10162206
810 Ga0268266_10000065
811 Ga0268266_10226459
812 Ga0268265_10011565
813 Ga0268264_10000011
814 Ga0268264_10003904
815 Ga0268264_10029934
816 Ga0307517_10002460
817 Ga0307517_10005403
818 Ga0307515_10000677
819 Ga0307515_10009043
820 Ga0307515_10045441
821 Ga0307511_10001482
822 Ga0307512_10019649
823 Ga0307513_10002838
824 Ga0307513_10011393
825 Ga0307513_10075392
826 Ga0307509_10000092
827 Ga0307509_10011671
828 Ga0307509_10016290
829 Ga0307509_10027707
830 Ga0307509_10160520
831 Ga0307508_10001131
832 Ga0307508_10003175
833 Ga0307508_10016226
834 Ga0307508_10077352
835 Ga0307514_10120299
836 Ga0307516_10000921
837 Ga0307516_10001323
838 Ga0307516_10021553
839 Ga0307412_10028097
840 Ga0307409_100001415
841 Ga0307416_100023099
842 Ga0307415_100021880
843 Ga0307510_10001210
844 Ga0307510_10009113
845 Ga0307510_10127066
846 Ga0307510_10174380
847 Ga0373944_0011728
848 Ga0373962_0018244
849 Ga0373924_0023839
850 Ga0373931_0007016
851 Ga0373931_0026228
852 Ga0373931_0115847
853 Ga0373937_0143604
854 Ga0373925_0002139
855 Ga0439431_0004041
856 Ga0466965_0030875
857 Ga0466959_0004034
858 Ga0451576_0141037
859 Ga0451576_0174866
860 Ga0495638_0023825
861 Ga0495580_0110708
862 Ga0495618_0084914
863 Ga0495628_0201554
864 Ga0495648_0002065
865 Ga0495611_0000021
866 Ga0495635_0042912
867 Ga0495646_0037851
868 Ga0495647_0009173
869 Ga0495658_0004018
870 Ga0495624_0037301
871 Ga0495649_0003733
872 Ga0495660_0023328
873 Ga0495674_0146235
874 Ga0495680_0042795
875 Ga0495687_000001
876 Ga0495687_001245
877 Ga0495686_0000094
878 Ga0496108_0014711
879 Ga0496108_0024257
880 Ga0496115_0050347
881 Ga0496122_0001826
882 Ga0496123_0013586
883 Ga0496125_0117764
884 Ga0501033_0028764
885 Ga0501034_0008948
886 Ga0501036_0011414
887 Ga0501037_0001231
888 Ga0501038_0027018
889 Ga0501043_0011000
890 Ga0501043_0015232
891 Ga0501047_0002532
892 Ga0501198_000035
893 Ga0501222_000039
894 Ga0501035_0012077
895 Ga0501044_0001944
896 nmdc:mga03n38_59742_c1
897 nmdc:mga0yw44_60145_c1
898 nmdc:mga0k408_16228_c1
899 nmdc:mga0k408_19374_c1
900 nmdc:mga0k408_22130_c1
901 nmdc:mga07m45_10524_c1
902 nmdc:mga07m45_30447_c1
903 nmdc:mga07m45_3285_c1
904 nmdc:mga07m45_5492_c1
905 nmdc:mga09592_4095_c1
906 Ga0495612_0019907
907 Ga0500658_0069182
908 Ga0500568_0005576
909 Ga0500619_026941
910 Ga0500645_000333
911 Ga0500645_003356
912 Ga0466962_0050914
913 2511245446
914 2644305158
915 2738757150
916 2929182684
917 2945978610
918 2946015527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

18

468

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q71-assembly1.cif.gz_A-2 crystal structure of bradyrhizobium japonicum proline utilization a (puta) mutant d779w 0.9218 23 440
3haz-assembly1.cif.gz_A-2 crystal structure of bifunctional proline utilization a (puta) protein 0.9206 23 440
6bsn-assembly1.cif.gz_A-2 structure of proline utilization a (puta) with proline bound in remote sites 0.9203 23 440
6bsn-assembly1.cif.gz_B-2 structure of proline utilization a (puta) with proline bound in remote sites 0.9203 23 440
3haz-assembly1.cif.gz_B-2 crystal structure of bifunctional proline utilization a (puta) protein 0.9202 23 440
ID Description Score Start End Superfamily
af_P76149_240_424_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9828 221 397 3.40.309.10
5vbfG02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9765 218 397 3.40.309.10
af_A4IDE7_286_468_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9762 221 397 3.40.309.10
af_Q9UTM8_272_454_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9732 224 397 3.40.309.10
af_P25526_261_445_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9693 221 397 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A531JR08-F1-model_v4 Aldehyde dehydrogenase family protein 0.9774 187 298 GO:0004777
GO:0009450
AF-A0A2V7WNS8-F1-model_v4 Aldehyde dehydrogenase 0.9757 149 397 GO:0016620
AF-A0A1B6DJS2-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9727 162 399 GO:0016620
AF-A0A833KN20-F1-model_v4 deleted 0.9718 237 393
AF-A0A528BDC6-F1-model_v4 Aldehyde dehydrogenase family protein 0.9714 186 378 GO:0016620

Map