F448377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 459 | 290 | 458 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10397095|Ga0265338_103970952 |
| Length | 248 |
| Sequence | MAPQRDFPDFQTLLTKPRHKGYNYGATLEIEEGIMTQTSGQGAAPGAFTVPPLPYSFDALEPYIDAKTMEIHHDKHHAAYVTNLNKALEGHADLQKLSVEEIISHLDRVPENVRTAVRNNGGGHANHSLFWKIMKKGGGGEPKGELADAIKSTFGSFADFKTKFNQAATTRFGSGWAWLQIAGGKLAIESSANQDSPLMNNAKPVFGLDVWEHAYYLKYQNRRPEYIEAFWNVLNWDELTNNFEHAKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 100 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 197 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 198 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 199 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 272 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 273 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 290 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.8 |
| Metatranscriptomes | 11.98 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0 |
| Rhizoplane | 3.49 |
| Rhizosphere | 93.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006765J45826_114789 | 3300003161 | Bacteria | 687 |
| 2 | Ga0006778J45830_1067745 | 3300003162 | Bacteria | 831 |
| 3 | JGI26145J50221_1008472 | 3300003371 | Bacteria | 883 |
| 4 | Ga0007410J51695_1066582 | 3300003574 | Bacteria | 696 |
| 5 | Ga0007429J51699_1034974 | 3300003579 | Bacteria | 861 |
| 6 | Ga0058859_11304566 | 3300004798 | Bacteria | 740 |
| 7 | Ga0058863_11588021 | 3300004799 | Bacteria | 997 |
| 8 | Ga0058862_12888305 | 3300004803 | Bacteria | 730 |
| 9 | Ga0065704_10015880 | 3300005289 | Bacteria | 1661 |
| 10 | Ga0065704_10019943 | 3300005289 | Bacteria | 1232 |
| 11 | Ga0065712_10084370 | 3300005290 | Bacteria | 2754 |
| 12 | Ga0065715_10003953 | 3300005293 | Bacteria | 5892 |
| 13 | Ga0065707_10009026 | 3300005295 | Bacteria | 3072 |
| 14 | Ga0070683_100122332 | 3300005329 | Bacteria | 2459 |
| 15 | Ga0070670_100030212 | 3300005331 | Bacteria | 4666 |
| 16 | Ga0070666_10426470 | 3300005335 | Bacteria | 956 |
| 17 | Ga0070666_10682042 | 3300005335 | Bacteria | 753 |
| 18 | Ga0070680_100370315 | 3300005336 | Bacteria | 1219 |
| 19 | Ga0070689_100234754 | 3300005340 | Bacteria | 1509 |
| 20 | Ga0070689_100265412 | 3300005340 | Bacteria | 1420 |
| 21 | Ga0070689_100426433 | 3300005340 | Bacteria | 1125 |
| 22 | Ga0070689_100507348 | 3300005340 | Bacteria | 1034 |
| 23 | Ga0070687_100480125 | 3300005343 | Bacteria | 833 |
| 24 | Ga0070669_100032387 | 3300005353 | Bacteria | 3775 |
| 25 | Ga0070669_100236440 | 3300005353 | Bacteria | 1450 |
| 26 | Ga0070675_100015752 | 3300005354 | Bacteria | 5984 |
| 27 | Ga0070675_100704688 | 3300005354 | Bacteria | 920 |
| 28 | Ga0070675_100785736 | 3300005354 | Bacteria | 870 |
| 29 | Ga0070671_100018016 | 3300005355 | Bacteria | 5731 |
| 30 | Ga0070674_100111358 | 3300005356 | Bacteria | 2010 |
| 31 | Ga0070674_100538314 | 3300005356 | Bacteria | 978 |
| 32 | Ga0070688_100052634 | 3300005365 | Bacteria | 2544 |
| 33 | Ga0070688_100512477 | 3300005365 | Bacteria | 906 |
| 34 | Ga0070688_100715258 | 3300005365 | Bacteria | 777 |
| 35 | Ga0070659_100568545 | 3300005366 | Bacteria | 972 |
| 36 | Ga0070667_100701295 | 3300005367 | Bacteria | 937 |
| 37 | Ga0070709_10094221 | 3300005434 | Bacteria | 1981 |
| 38 | Ga0070714_100014046 | 3300005435 | Bacteria | 6425 |
| 39 | Ga0070714_101066680 | 3300005435 | Bacteria | 787 |
| 40 | Ga0070713_100027943 | 3300005436 | Bacteria | 4448 |
| 41 | Ga0070713_100070211 | 3300005436 | Bacteria | 2956 |
| 42 | Ga0070713_100556871 | 3300005436 | Bacteria | 1086 |
| 43 | Ga0070713_100896586 | 3300005436 | Bacteria | 853 |
| 44 | Ga0070700_100256044 | 3300005441 | Bacteria | 1258 |
| 45 | Ga0070694_100179016 | 3300005444 | Bacteria | 1567 |
| 46 | Ga0070694_100371855 | 3300005444 | Bacteria | 1112 |
| 47 | Ga0070662_100301055 | 3300005457 | Bacteria | 1303 |
| 48 | Ga0070681_10082225 | 3300005458 | Bacteria | 3176 |
| 49 | Ga0068867_100104177 | 3300005459 | Bacteria | 2171 |
| 50 | Ga0070706_100084925 | 3300005467 | Bacteria | 2933 |
| 51 | Ga0070698_100286746 | 3300005471 | Bacteria | 1578 |
| 52 | Ga0070698_100830447 | 3300005471 | Bacteria | 869 |
| 53 | Ga0070699_100032009 | 3300005518 | Bacteria | 4541 |
| 54 | Ga0070699_100200396 | 3300005518 | Bacteria | 1775 |
| 55 | Ga0070679_100819179 | 3300005530 | Bacteria | 874 |
| 56 | Ga0070684_100139073 | 3300005535 | Bacteria | 2195 |
| 57 | Ga0070697_100240728 | 3300005536 | Bacteria | 1545 |
| 58 | Ga0068853_100235859 | 3300005539 | Bacteria | 1675 |
| 59 | Ga0070672_100925695 | 3300005543 | Bacteria | 771 |
| 60 | Ga0070695_100105534 | 3300005545 | Bacteria | 1904 |
| 61 | Ga0070665_100017378 | 3300005548 | Bacteria | 7220 |
| 62 | Ga0070665_100046108 | 3300005548 | Bacteria | 4378 |
| 63 | Ga0070665_100660283 | 3300005548 | Bacteria | 1059 |
| 64 | Ga0068855_100082379 | 3300005563 | Bacteria | 3729 |
| 65 | Ga0068855_100130468 | 3300005563 | Bacteria | 2871 |
| 66 | Ga0068855_100202065 | 3300005563 | Bacteria | 2237 |
| 67 | Ga0068855_100854516 | 3300005563 | Bacteria | 964 |
| 68 | Ga0070664_100054805 | 3300005564 | Bacteria | 3384 |
| 69 | Ga0070664_100112402 | 3300005564 | Bacteria | 2379 |
| 70 | Ga0068857_100651978 | 3300005577 | Bacteria | 998 |
| 71 | Ga0068856_100024412 | 3300005614 | Bacteria | 5885 |
| 72 | Ga0068856_100109945 | 3300005614 | Bacteria | 2753 |
| 73 | Ga0070702_100076103 | 3300005615 | Bacteria | 1997 |
| 74 | Ga0068852_100077425 | 3300005616 | Bacteria | 2940 |
| 75 | Ga0068852_100515236 | 3300005616 | Bacteria | 1193 |
| 76 | Ga0068859_100076630 | 3300005617 | Bacteria | 3385 |
| 77 | Ga0068859_100137442 | 3300005617 | Bacteria | 2517 |
| 78 | Ga0068864_100078595 | 3300005618 | Bacteria | 2888 |
| 79 | Ga0068864_100541153 | 3300005618 | Bacteria | 1124 |
| 80 | Ga0068866_10051230 | 3300005718 | Bacteria | 2100 |
| 81 | Ga0068861_100130823 | 3300005719 | Bacteria | 2037 |
| 82 | Ga0068861_100380356 | 3300005719 | Bacteria | 1247 |
| 83 | Ga0068870_10032638 | 3300005840 | Bacteria | 2650 |
| 84 | Ga0068863_100099960 | 3300005841 | Bacteria | 2757 |
| 85 | Ga0068863_100123010 | 3300005841 | Bacteria | 2475 |
| 86 | Ga0068863_100152778 | 3300005841 | Bacteria | 2209 |
| 87 | Ga0068858_100145271 | 3300005842 | Bacteria | 2227 |
| 88 | Ga0068860_100099235 | 3300005843 | Bacteria | 2778 |
| 89 | Ga0068860_100107777 | 3300005843 | Bacteria | 2662 |
| 90 | Ga0068860_100773627 | 3300005843 | Bacteria | 973 |
| 91 | Ga0068862_100001533 | 3300005844 | Bacteria | 21121 |
| 92 | Ga0081455_10018423 | 3300005937 | Bacteria | 6653 |
| 93 | Ga0070717_10024248 | 3300006028 | Bacteria | 4815 |
| 94 | Ga0070717_10322330 | 3300006028 | Bacteria | 1377 |
| 95 | Ga0075364_10138192 | 3300006051 | Bacteria | 1638 |
| 96 | Ga0097621_100074951 | 3300006237 | Bacteria | 2803 |
| 97 | Ga0097621_100122781 | 3300006237 | Bacteria | 2204 |
| 98 | Ga0068871_100010041 | 3300006358 | Bacteria | 6884 |
| 99 | Ga0068871_100472498 | 3300006358 | Bacteria | 1127 |
| 100 | Ga0075428_100000086 | 3300006844 | Bacteria | 77110 |
| 101 | Ga0075428_100377064 | 3300006844 | Bacteria | 1521 |
| 102 | Ga0075430_100000028 | 3300006846 | Bacteria | 74712 |
| 103 | Ga0075430_100149440 | 3300006846 | Bacteria | 1945 |
| 104 | Ga0075430_100293409 | 3300006846 | Bacteria | 1345 |
| 105 | Ga0075431_100002556 | 3300006847 | Bacteria | 17557 |
| 106 | Ga0075431_100168759 | 3300006847 | Bacteria | 2249 |
| 107 | Ga0075431_100231690 | 3300006847 | Bacteria | 1881 |
| 108 | Ga0075431_100792646 | 3300006847 | Bacteria | 921 |
| 109 | Ga0075433_10184613 | 3300006852 | Bacteria | 1855 |
| 110 | Ga0075429_100043206 | 3300006880 | Bacteria | 3922 |
| 111 | Ga0075429_100304350 | 3300006880 | Bacteria | 1396 |
| 112 | Ga0068865_100004448 | 3300006881 | Bacteria | 8453 |
| 113 | Ga0068865_100071133 | 3300006881 | Bacteria | 2466 |
| 114 | Ga0075436_100104708 | 3300006914 | Bacteria | 1972 |
| 115 | Ga0097620_100076628 | 3300006931 | Bacteria | 3385 |
| 116 | Ga0097620_100137444 | 3300006931 | Bacteria | 2517 |
| 117 | Ga0075435_100058538 | 3300007076 | Bacteria | 3121 |
| 118 | Ga0105251_10167034 | 3300009011 | Bacteria | 991 |
| 119 | Ga0105240_10006710 | 3300009093 | Bacteria | 16864 |
| 120 | Ga0105240_10059721 | 3300009093 | Bacteria | 4758 |
| 121 | Ga0105240_10253255 | 3300009093 | Bacteria | 2035 |
| 122 | Ga0111539_10000166 | 3300009094 | Bacteria | 76156 |
| 123 | Ga0111539_10162086 | 3300009094 | Bacteria | 2615 |
| 124 | Ga0111539_10559243 | 3300009094 | Bacteria | 1332 |
| 125 | Ga0111539_10631454 | 3300009094 | Bacteria | 1247 |
| 126 | Ga0105245_10032444 | 3300009098 | Bacteria | 4624 |
| 127 | Ga0105247_10006247 | 3300009101 | Bacteria | 7388 |
| 128 | Ga0105247_10432517 | 3300009101 | Bacteria | 945 |
| 129 | Ga0114129_10000148 | 3300009147 | Bacteria | 74039 |
| 130 | Ga0114129_10015571 | 3300009147 | Bacteria | 10810 |
| 131 | Ga0114129_10045979 | 3300009147 | Bacteria | 6135 |
| 132 | Ga0114129_10430927 | 3300009147 | Bacteria | 1733 |
| 133 | Ga0105242_10077293 | 3300009176 | Bacteria | 2777 |
| 134 | Ga0105242_10158553 | 3300009176 | Bacteria | 1979 |
| 135 | Ga0105242_10449384 | 3300009176 | Bacteria | 1214 |
| 136 | Ga0105242_10766594 | 3300009176 | Bacteria | 951 |
| 137 | Ga0105248_10005840 | 3300009177 | Bacteria | 13528 |
| 138 | Ga0105248_10007216 | 3300009177 | Bacteria | 12192 |
| 139 | Ga0105248_10008141 | 3300009177 | Bacteria | 11510 |
| 140 | Ga0105248_10311456 | 3300009177 | Bacteria | 1773 |
| 141 | Ga0105248_10797059 | 3300009177 | Bacteria | 1066 |
| 142 | Ga0105237_10014985 | 3300009545 | Bacteria | 8079 |
| 143 | Ga0105237_10098887 | 3300009545 | Bacteria | 2909 |
| 144 | Ga0105238_10102032 | 3300009551 | Bacteria | 2851 |
| 145 | Ga0105249_10119508 | 3300009553 | Bacteria | 2503 |
| 146 | Ga0105239_10356510 | 3300010375 | Bacteria | 1651 |
| 147 | Ga0157370_10193003 | 3300013104 | Bacteria | 1890 |
| 148 | Ga0157370_10213244 | 3300013104 | Bacteria | 1789 |
| 149 | Ga0157369_10036186 | 3300013105 | Bacteria | 5410 |
| 150 | Ga0157369_10063056 | 3300013105 | Bacteria | 3994 |
| 151 | Ga0157369_10369414 | 3300013105 | Bacteria | 1489 |
| 152 | Ga0157369_10402488 | 3300013105 | Bacteria | 1420 |
| 153 | Ga0157374_10975487 | 3300013296 | Bacteria | 866 |
| 154 | Ga0163162_10094250 | 3300013306 | Bacteria | 3080 |
| 155 | Ga0157372_10028293 | 3300013307 | Bacteria | 6117 |
| 156 | Ga0157372_10258599 | 3300013307 | Bacteria | 2021 |
| 157 | Ga0157372_10604408 | 3300013307 | Bacteria | 1278 |
| 158 | Ga0157375_11518941 | 3300013308 | Bacteria | 791 |
| 159 | Ga0163163_10061782 | 3300014325 | Bacteria | 3712 |
| 160 | Ga0163163_10084459 | 3300014325 | Bacteria | 3181 |
| 161 | Ga0157377_10165291 | 3300014745 | Bacteria | 1379 |
| 162 | Ga0157379_10009196 | 3300014968 | Bacteria | 8606 |
| 163 | Ga0157379_10038998 | 3300014968 | Bacteria | 4238 |
| 164 | Ga0157379_10152597 | 3300014968 | Bacteria | 2084 |
| 165 | Ga0157376_10027798 | 3300014969 | Bacteria | 4489 |
| 166 | Ga0163161_10106662 | 3300017792 | Bacteria | 2091 |
| 167 | Ga0197907_10009712 | 3300020069 | Bacteria | 838 |
| 168 | Ga0197907_10859286 | 3300020069 | Bacteria | 2159 |
| 169 | Ga0197907_10944230 | 3300020069 | Bacteria | 783 |
| 170 | Ga0197907_11361374 | 3300020069 | Bacteria | 932 |
| 171 | Ga0206356_10064439 | 3300020070 | Bacteria | 947 |
| 172 | Ga0206356_10076381 | 3300020070 | Bacteria | 912 |
| 173 | Ga0206356_11357793 | 3300020070 | Bacteria | 712 |
| 174 | Ga0206349_1119537 | 3300020075 | Bacteria | 713 |
| 175 | Ga0206349_1292317 | 3300020075 | Bacteria | 895 |
| 176 | Ga0206355_1165588 | 3300020076 | Bacteria | 731 |
| 177 | Ga0206355_1589848 | 3300020076 | Bacteria | 1204 |
| 178 | Ga0206351_10100007 | 3300020077 | Bacteria | 661 |
| 179 | Ga0206351_10334331 | 3300020077 | Bacteria | 710 |
| 180 | Ga0206352_10116104 | 3300020078 | Bacteria | 680 |
| 181 | Ga0206352_10726661 | 3300020078 | Bacteria | 668 |
| 182 | Ga0206350_10097771 | 3300020080 | Bacteria | 941 |
| 183 | Ga0206350_10472793 | 3300020080 | Bacteria | 710 |
| 184 | Ga0206350_10703862 | 3300020080 | Bacteria | 827 |
| 185 | Ga0206350_10940339 | 3300020080 | Bacteria | 862 |
| 186 | Ga0206354_10543553 | 3300020081 | Bacteria | 951 |
| 187 | Ga0206354_10666411 | 3300020081 | Bacteria | 711 |
| 188 | Ga0206353_11460749 | 3300020082 | Bacteria | 693 |
| 189 | Ga0154015_1063369 | 3300020610 | Bacteria | 726 |
| 190 | Ga0154015_1585089 | 3300020610 | Bacteria | 714 |
| 191 | Ga0213876_10014747 | 3300021384 | Bacteria | 4141 |
| 192 | Ga0213875_10012340 | 3300021388 | Bacteria | 4226 |
| 193 | Ga0213875_10052109 | 3300021388 | Bacteria | 1916 |
| 194 | Ga0224712_10018737 | 3300022467 | Bacteria | 2320 |
| 195 | Ga0224712_10193622 | 3300022467 | Bacteria | 921 |
| 196 | Ga0224712_10327154 | 3300022467 | Bacteria | 721 |
| 197 | Ga0207642_10145603 | 3300025899 | Bacteria | 1255 |
| 198 | Ga0207710_10050671 | 3300025900 | Bacteria | 1863 |
| 199 | Ga0207688_10607535 | 3300025901 | Bacteria | 689 |
| 200 | Ga0207680_10218528 | 3300025903 | Bacteria | 1305 |
| 201 | Ga0207680_10256499 | 3300025903 | Bacteria | 1209 |
| 202 | Ga0207699_10284860 | 3300025906 | Bacteria | 1149 |
| 203 | Ga0207643_10094057 | 3300025908 | Bacteria | 1750 |
| 204 | Ga0207684_10153320 | 3300025910 | Bacteria | 1983 |
| 205 | Ga0207654_10192446 | 3300025911 | Bacteria | 1338 |
| 206 | Ga0207707_10425414 | 3300025912 | Bacteria | 1138 |
| 207 | Ga0207695_10067420 | 3300025913 | Bacteria | 3671 |
| 208 | Ga0207695_10145229 | 3300025913 | Bacteria | 2317 |
| 209 | Ga0207695_10198123 | 3300025913 | Bacteria | 1923 |
| 210 | Ga0207695_10356335 | 3300025913 | Bacteria | 1350 |
| 211 | Ga0207671_10000014 | 3300025914 | Bacteria | 461481 |
| 212 | Ga0207671_10179268 | 3300025914 | Bacteria | 1648 |
| 213 | Ga0207660_10398751 | 3300025917 | Bacteria | 1108 |
| 214 | Ga0207662_10132990 | 3300025918 | Bacteria | 1570 |
| 215 | Ga0207657_10226458 | 3300025919 | Bacteria | 1496 |
| 216 | Ga0207657_10334913 | 3300025919 | Bacteria | 1195 |
| 217 | Ga0207657_10377986 | 3300025919 | Bacteria | 1116 |
| 218 | Ga0207649_10546683 | 3300025920 | Bacteria | 885 |
| 219 | Ga0207652_10725472 | 3300025921 | Bacteria | 886 |
| 220 | Ga0207694_10083433 | 3300025924 | Bacteria | 2513 |
| 221 | Ga0207650_10505929 | 3300025925 | Bacteria | 1010 |
| 222 | Ga0207650_10959862 | 3300025925 | Bacteria | 727 |
| 223 | Ga0207687_10265585 | 3300025927 | Bacteria | 1370 |
| 224 | Ga0207700_10016389 | 3300025928 | Bacteria | 4922 |
| 225 | Ga0207700_10817365 | 3300025928 | Bacteria | 834 |
| 226 | Ga0207664_10010224 | 3300025929 | Bacteria | 6626 |
| 227 | Ga0207644_10248952 | 3300025931 | Bacteria | 1417 |
| 228 | Ga0207644_10275163 | 3300025931 | Bacteria | 1350 |
| 229 | Ga0207706_10237533 | 3300025933 | Bacteria | 1593 |
| 230 | Ga0207686_10095364 | 3300025934 | Bacteria | 1974 |
| 231 | Ga0207686_10104974 | 3300025934 | Bacteria | 1894 |
| 232 | Ga0207709_10335413 | 3300025935 | Bacteria | 1136 |
| 233 | Ga0207670_10069798 | 3300025936 | Bacteria | 2425 |
| 234 | Ga0207670_10689674 | 3300025936 | Bacteria | 845 |
| 235 | Ga0207669_10454483 | 3300025937 | Bacteria | 1016 |
| 236 | Ga0207669_10828558 | 3300025937 | Bacteria | 769 |
| 237 | Ga0207704_10120793 | 3300025938 | Bacteria | 1793 |
| 238 | Ga0207711_10003755 | 3300025941 | Bacteria | 13081 |
| 239 | Ga0207711_10031597 | 3300025941 | Bacteria | 4471 |
| 240 | Ga0207711_10092798 | 3300025941 | Bacteria | 2658 |
| 241 | Ga0207711_10206618 | 3300025941 | Bacteria | 1793 |
| 242 | Ga0207689_10150630 | 3300025942 | Bacteria | 1917 |
| 243 | Ga0207689_10449377 | 3300025942 | Bacteria | 1077 |
| 244 | Ga0207679_10231536 | 3300025945 | Bacteria | 1560 |
| 245 | Ga0207679_10653856 | 3300025945 | Bacteria | 951 |
| 246 | Ga0207667_10062008 | 3300025949 | Bacteria | 3911 |
| 247 | Ga0207667_10328881 | 3300025949 | Bacteria | 1560 |
| 248 | Ga0207651_10534127 | 3300025960 | Bacteria | 1018 |
| 249 | Ga0207712_10076503 | 3300025961 | Bacteria | 2423 |
| 250 | Ga0207668_10879278 | 3300025972 | Bacteria | 797 |
| 251 | Ga0207677_10439421 | 3300026023 | Bacteria | 1115 |
| 252 | Ga0207703_10063242 | 3300026035 | Bacteria | 3034 |
| 253 | Ga0207703_10069505 | 3300026035 | Bacteria | 2904 |
| 254 | Ga0207703_10895054 | 3300026035 | Bacteria | 850 |
| 255 | Ga0207708_10464680 | 3300026075 | Bacteria | 1056 |
| 256 | Ga0207702_10260618 | 3300026078 | Bacteria | 1632 |
| 257 | Ga0207641_10000431 | 3300026088 | Bacteria | 48383 |
| 258 | Ga0207641_10049875 | 3300026088 | Bacteria | 3539 |
| 259 | Ga0207641_10308127 | 3300026088 | Bacteria | 1498 |
| 260 | Ga0207648_10046080 | 3300026089 | Bacteria | 3823 |
| 261 | Ga0207648_10504841 | 3300026089 | Bacteria | 1107 |
| 262 | Ga0207648_10690100 | 3300026089 | Bacteria | 946 |
| 263 | Ga0207676_10608329 | 3300026095 | Bacteria | 1050 |
| 264 | Ga0207674_10594913 | 3300026116 | Bacteria | 1068 |
| 265 | Ga0207675_100148412 | 3300026118 | Bacteria | 2231 |
| 266 | Ga0207675_100239807 | 3300026118 | Bacteria | 1752 |
| 267 | Ga0207683_10309178 | 3300026121 | Bacteria | 1447 |
| 268 | Ga0207698_10462767 | 3300026142 | Bacteria | 1227 |
| 269 | Ga0209999_1004313 | 3300027543 | Bacteria | 2561 |
| 270 | Ga0209998_10013211 | 3300027717 | Bacteria | 1718 |
| 271 | Ga0209974_10002498 | 3300027876 | Bacteria | 6656 |
| 272 | Ga0207428_10000251 | 3300027907 | Bacteria | 73186 |
| 273 | Ga0207428_10049608 | 3300027907 | Bacteria | 3362 |
| 274 | Ga0207428_10350299 | 3300027907 | Bacteria | 1086 |
| 275 | Ga0265357_1011164 | 3300028023 | Bacteria | 912 |
| 276 | Ga0268266_10023052 | 3300028379 | Bacteria | 5299 |
| 277 | Ga0268266_10045377 | 3300028379 | Bacteria | 3760 |
| 278 | Ga0268265_10005741 | 3300028380 | Bacteria | 8472 |
| 279 | Ga0268265_10227742 | 3300028380 | Bacteria | 1636 |
| 280 | Ga0268264_10110664 | 3300028381 | Bacteria | 2405 |
| 281 | Ga0265338_10397095 | 3300028800 | Bacteria | 984 |
| 282 | Ga0265762_1006265 | 3300030760 | Bacteria | 2131 |
| 283 | Ga0307408_100009815 | 3300031548 | Bacteria | 6309 |
| 284 | Ga0307408_100037371 | 3300031548 | Bacteria | 3420 |
| 285 | Ga0307408_100083440 | 3300031548 | Bacteria | 2394 |
| 286 | Ga0307405_10030512 | 3300031731 | Bacteria | 3162 |
| 287 | Ga0307405_10483022 | 3300031731 | Bacteria | 989 |
| 288 | Ga0307413_10166015 | 3300031824 | Bacteria | 1557 |
| 289 | Ga0307410_10097771 | 3300031852 | Bacteria | 2098 |
| 290 | Ga0307410_10332722 | 3300031852 | Bacteria | 1208 |
| 291 | Ga0307406_10671897 | 3300031901 | Bacteria | 862 |
| 292 | Ga0307407_10155701 | 3300031903 | Bacteria | 1490 |
| 293 | Ga0307407_10594098 | 3300031903 | Bacteria | 823 |
| 294 | Ga0307412_10187186 | 3300031911 | Bacteria | 1562 |
| 295 | Ga0307409_100291065 | 3300031995 | Bacteria | 1515 |
| 296 | Ga0307416_100006748 | 3300032002 | Bacteria | 7218 |
| 297 | Ga0307416_100028702 | 3300032002 | Bacteria | 4143 |
| 298 | Ga0307416_100101529 | 3300032002 | Bacteria | 2505 |
| 299 | Ga0307416_100292714 | 3300032002 | Bacteria | 1613 |
| 300 | Ga0307416_100538280 | 3300032002 | Bacteria | 1239 |
| 301 | Ga0307411_10113017 | 3300032005 | Bacteria | 1948 |
| 302 | Ga0307411_10494836 | 3300032005 | Bacteria | 1032 |
| 303 | Ga0307415_100318874 | 3300032126 | Bacteria | 1295 |
| 304 | Ga0307415_100580089 | 3300032126 | Bacteria | 994 |
| 305 | Ga0316593_10234493 | 3300032168 | Bacteria | 684 |
| 306 | Ga0373958_0039432 | 3300034819 | Bacteria | 960 |
| 307 | Ga0373944_0092944 | 3300035089 | Bacteria | 1010 |
| 308 | Ga0373952_0099779 | 3300035092 | Bacteria | 765 |
| 309 | Ga0373936_0222060 | 3300035113 | Bacteria | 838 |
| 310 | Ga0373945_0095938 | 3300035116 | Bacteria | 1155 |
| 311 | Ga0373954_0301977 | 3300035118 | Bacteria | 790 |
| 312 | Ga0373943_0409143 | 3300035170 | Bacteria | 784 |
| 313 | Ga0373946_0054459 | 3300035171 | Bacteria | 1684 |
| 314 | Ga0373946_0065859 | 3300035171 | Bacteria | 1552 |
| 315 | Ga0373962_0019411 | 3300035242 | Bacteria | 1778 |
| 316 | Ga0373931_0377941 | 3300035691 | Bacteria | 892 |
| 317 | Ga0373927_0000552 | 3300035695 | Bacteria | 28516 |
| 318 | Ga0373947_0267151 | 3300035725 | Bacteria | 1135 |
| 319 | Ga0373947_0300220 | 3300035725 | Bacteria | 1071 |
| 320 | Ga0373937_0955559 | 3300036401 | Bacteria | 806 |
| 321 | Ga0265778_020135 | 3300036457 | Bacteria | 819 |
| 322 | Ga0373925_0225766 | 3300037068 | Bacteria | 1496 |
| 323 | Ga0373925_0403599 | 3300037068 | Bacteria | 1115 |
| 324 | Ga0373925_0778839 | 3300037068 | Bacteria | 789 |
| 325 | Ga0395905_0010290 | 3300037471 | Bacteria | 9106 |
| 326 | Ga0436364_0305164 | 3300037853 | Bacteria | 13203 |
| 327 | Ga0436364_0867121 | 3300037853 | Bacteria | 1243 |
| 328 | Ga0436364_1091719 | 3300037853 | Bacteria | 4646 |
| 329 | Ga0436365_0767090 | 3300039437 | Bacteria | 11651 |
| 330 | Ga0451802_0086641 | 3300041460 | Bacteria | 1107 |
| 331 | Ga0439441_004453 | 3300042001 | Bacteria | 2125 |
| 332 | Ga0439448_0138727 | 3300042005 | Bacteria | 841 |
| 333 | Ga0439435_0041457 | 3300042436 | Bacteria | 1290 |
| 334 | Ga0439464_0000301 | 3300042439 | Bacteria | 9392 |
| 335 | Ga0451577_0001463 | 3300042876 | Bacteria | 31346 |
| 336 | Ga0453683_0004648 | 3300044673 | Bacteria | 9687 |
| 337 | Ga0466964_0200826 | 3300044706 | Bacteria | 957 |
| 338 | Ga0453684_0000324 | 3300044712 | Bacteria | 201431 |
| 339 | Ga0466957_0109780 | 3300044842 | Bacteria | 1748 |
| 340 | Ga0466957_0298777 | 3300044842 | Bacteria | 1081 |
| 341 | Ga0466959_0020720 | 3300045049 | Bacteria | 4845 |
| 342 | Ga0466959_0055775 | 3300045049 | Bacteria | 2884 |
| 343 | Ga0451576_0019003 | 3300045051 | Bacteria | 7508 |
| 344 | Ga0451576_0536984 | 3300045051 | Bacteria | 1229 |
| 345 | Ga0466958_0056126 | 3300045836 | Bacteria | 2392 |
| 346 | Ga0466958_0113299 | 3300045836 | Bacteria | 1694 |
| 347 | Ga0466967_1046237 | 3300045976 | Bacteria | 813 |
| 348 | Ga0495662_0232856 | 3300046476 | Bacteria | 908 |
| 349 | Ga0495664_0093746 | 3300046477 | Bacteria | 1807 |
| 350 | Ga0495628_0018272 | 3300046516 | Bacteria | 5812 |
| 351 | Ga0495643_0000016 | 3300046522 | Bacteria | 313579 |
| 352 | Ga0495645_0010425 | 3300046543 | Bacteria | 6513 |
| 353 | Ga0495635_0191922 | 3300046663 | Bacteria | 1387 |
| 354 | Ga0495635_0256009 | 3300046663 | Bacteria | 1179 |
| 355 | Ga0495623_0020653 | 3300046679 | Bacteria | 4257 |
| 356 | Ga0495646_0347484 | 3300046680 | Bacteria | 778 |
| 357 | Ga0495647_0013207 | 3300046681 | Bacteria | 2858 |
| 358 | Ga0495658_0265000 | 3300046683 | Bacteria | 1082 |
| 359 | Ga0495604_0555440 | 3300047317 | Bacteria | 740 |
| 360 | Ga0495674_0288415 | 3300047319 | Bacteria | 1343 |
| 361 | Ga0495676_0157657 | 3300047321 | Bacteria | 1609 |
| 362 | Ga0495684_0239068 | 3300047471 | Bacteria | 1325 |
| 363 | Ga0496101_0082063 | 3300048904 | Bacteria | 2386 |
| 364 | Ga0496104_0052271 | 3300048907 | Bacteria | 3859 |
| 365 | Ga0496105_0232078 | 3300048908 | Bacteria | 1499 |
| 366 | Ga0496106_0334681 | 3300048909 | Bacteria | 1215 |
| 367 | Ga0496108_0004433 | 3300048911 | Bacteria | 11301 |
| 368 | Ga0496108_0182514 | 3300048911 | Bacteria | 1817 |
| 369 | Ga0496108_0585910 | 3300048911 | Bacteria | 972 |
| 370 | Ga0496109_0290791 | 3300048912 | Bacteria | 1540 |
| 371 | Ga0496110_0422496 | 3300048913 | Bacteria | 1215 |
| 372 | Ga0496111_0916585 | 3300048914 | Bacteria | 631 |
| 373 | Ga0496112_0005771 | 3300048915 | Bacteria | 10767 |
| 374 | Ga0496112_0008688 | 3300048915 | Bacteria | 9108 |
| 375 | Ga0496113_0119253 | 3300048916 | Bacteria | 2061 |
| 376 | Ga0496114_0051441 | 3300048917 | Bacteria | 3430 |
| 377 | Ga0496114_0266579 | 3300048917 | Bacteria | 1509 |
| 378 | Ga0501299_005645 | 3300049522 | Bacteria | 1932 |
| 379 | Ga0501031_0081232 | 3300049568 | Bacteria | 2113 |
| 380 | Ga0501031_0408831 | 3300049568 | Bacteria | 878 |
| 381 | Ga0501032_0096265 | 3300049569 | Bacteria | 1962 |
| 382 | Ga0501033_0022820 | 3300049570 | Bacteria | 4718 |
| 383 | Ga0501034_0054629 | 3300049571 | Bacteria | 4020 |
| 384 | Ga0501034_0657950 | 3300049571 | Bacteria | 949 |
| 385 | Ga0501036_0052168 | 3300049572 | Bacteria | 3464 |
| 386 | Ga0501036_0166564 | 3300049572 | Bacteria | 1857 |
| 387 | Ga0501037_0004407 | 3300049573 | Bacteria | 10227 |
| 388 | Ga0501037_0030519 | 3300049573 | Bacteria | 3983 |
| 389 | Ga0501038_0045992 | 3300049574 | Bacteria | 3786 |
| 390 | Ga0501039_0261078 | 3300049575 | Bacteria | 1361 |
| 391 | Ga0501040_0135776 | 3300049576 | Bacteria | 1732 |
| 392 | Ga0501041_0548737 | 3300049577 | Bacteria | 736 |
| 393 | Ga0501042_0204941 | 3300049578 | Bacteria | 1422 |
| 394 | Ga0501042_0400690 | 3300049578 | Bacteria | 994 |
| 395 | Ga0501043_0242222 | 3300049579 | Bacteria | 1391 |
| 396 | Ga0501046_0081713 | 3300049580 | Bacteria | 2495 |
| 397 | Ga0501047_0122491 | 3300049581 | Bacteria | 2481 |
| 398 | Ga0501048_0079885 | 3300049582 | Bacteria | 2308 |
| 399 | Ga0501071_1286949 | 3300049587 | Bacteria | 565 |
| 400 | Ga0501072_0128314 | 3300049588 | Bacteria | 2021 |
| 401 | Ga0501073_0083930 | 3300049589 | Bacteria | 2216 |
| 402 | Ga0501073_0189448 | 3300049589 | Bacteria | 1423 |
| 403 | Ga0501075_0045075 | 3300049591 | Bacteria | 3310 |
| 404 | Ga0501075_0057731 | 3300049591 | Bacteria | 2922 |
| 405 | Ga0501075_0899566 | 3300049591 | Bacteria | 673 |
| 406 | Ga0501076_0408389 | 3300049592 | Bacteria | 1117 |
| 407 | Ga0501235_011300 | 3300049669 | Bacteria | 1957 |
| 408 | Ga0501242_027528 | 3300049674 | Bacteria | 756 |
| 409 | Ga0501249_124559 | 3300049679 | Bacteria | 631 |
| 410 | Ga0501080_0047885 | 3300049742 | Bacteria | 3980 |
| 411 | Ga0501081_0036713 | 3300049743 | Bacteria | 3342 |
| 412 | Ga0501044_0534032 | 3300049823 | Bacteria | 1071 |
| 413 | nmdc:mga05p37_100800_c1 | 3300050507 | Bacteria | 3557 |
| 414 | nmdc:mga05p37_221_c1 | 3300050507 | Bacteria | 57542 |
| 415 | nmdc:mga05p37_2609_c1 | 3300050507 | Bacteria | 20981 |
| 416 | nmdc:mga05p37_357126_c1 | 3300050507 | Bacteria | 1719 |
| 417 | nmdc:mga05p37_55812_c1 | 3300050507 | Bacteria | 4863 |
| 418 | nmdc:mga09592_254084_c1 | 3300050508 | Bacteria | 1523 |
| 419 | nmdc:mga09592_39781_c1 | 3300050508 | Bacteria | 3950 |
| 420 | nmdc:mga0qj67_10030_c1 | 3300050509 | Bacteria | 7066 |
| 421 | nmdc:mga0qj67_438056_c1 | 3300050509 | Bacteria | 1053 |
| 422 | nmdc:mga06r32_23101_c1 | 3300050510 | Bacteria | 5754 |
| 423 | nmdc:mga06r32_423739_c1 | 3300050510 | Bacteria | 1312 |
| 424 | nmdc:mga08y16_13158_c1 | 3300050511 | Bacteria | 8705 |
| 425 | nmdc:mga08y16_690310_c1 | 3300050511 | Bacteria | 1022 |
| 426 | nmdc:mga08y16_743486_c1 | 3300050511 | Bacteria | 977 |
| 427 | nmdc:mga08y16_85677_c1 | 3300050511 | Bacteria | 3284 |
| 428 | nmdc:mga0rr50_380486_c1 | 3300050513 | Bacteria | 1190 |
| 429 | nmdc:mga08x19_283782_c1 | 3300050514 | Bacteria | 1148 |
| 430 | nmdc:mga08x19_80356_c1 | 3300050514 | Bacteria | 2139 |
| 431 | nmdc:mga0a205_103917_c1 | 3300050515 | Bacteria | 2740 |
| 432 | Ga0495612_0069383 | 3300053078 | Bacteria | 1468 |
| 433 | Ga0495619_0203943 | 3300053085 | Bacteria | 1369 |
| 434 | Ga0500646_0017397 | 3300053090 | Bacteria | 1885 |
| 435 | Ga0500641_0039509 | 3300053096 | Bacteria | 1901 |
| 436 | Ga0500658_0131929 | 3300053134 | Bacteria | 1115 |
| 437 | Ga0501084_0783230 | 3300054114 | Bacteria | 803 |
| 438 | Ga0587066_062786 | 3300059490 | Bacteria | 763 |
| 439 | Ga0587070_089158 | 3300059491 | Bacteria | 691 |
| 440 | Ga0587073_0033314 | 3300059492 | Bacteria | 1079 |
| 441 | Ga0587073_0065283 | 3300059492 | Bacteria | 865 |
| 442 | Ga0587073_0097839 | 3300059492 | Bacteria | 758 |
| 443 | Ga0587082_069661 | 3300059504 | Bacteria | 712 |
| 444 | Ga0587083_0091806 | 3300059505 | Bacteria | 742 |
| 445 | Ga0587085_058415 | 3300059506 | Bacteria | 723 |
| 446 | Ga0587088_049681 | 3300059508 | Bacteria | 817 |
| 447 | Ga0587088_075278 | 3300059508 | Bacteria | 712 |
| 448 | Ga0587090_037498 | 3300059510 | Bacteria | 839 |
| 449 | Ga0587090_038616 | 3300059510 | Bacteria | 831 |
| 450 | Ga0587091_060842 | 3300059511 | Bacteria | 802 |
| 451 | Ga0587091_099496 | 3300059511 | Bacteria | 680 |
| 452 | Ga0587094_038943 | 3300059513 | Bacteria | 767 |
| 453 | Ga0587076_074511 | 3300059645 | Bacteria | 712 |
| 454 | Ga0587079_091388 | 3300059647 | Bacteria | 713 |
| 455 | Ga0587107_029224 | 3300059652 | Bacteria | 828 |
| 456 | Ga0501082_0230136 | 3300060353 | Bacteria | 1613 |
| 457 | Ga0501082_0624221 | 3300060353 | Bacteria | 943 |
| 458 | Ga0530510_0081982 | 3300061734 | Bacteria | 2349 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_1286949 | Ga0501071_1286949_40_537 | 164 |
| 2 | 3300036401 | Ga0373937_0955559 | Ga0373937_0955559_194_742 | 180 |
| 3 | 3300013104 | Ga0157370_10213244 | Ga0157370_102132441 | 182 |
| 4 | 3300005289 | Ga0065704_10019943 | Ga0065704_100199431 | 197 |
| 5 | 3300005295 | Ga0065707_10009026 | Ga0065707_100090263 | 197 |
| 6 | 3300005354 | Ga0070675_100704688 | Ga0070675_1007046882 | 197 |
| 7 | 3300005436 | Ga0070713_100070211 | Ga0070713_1000702112 | 197 |
| 8 | 3300005543 | Ga0070672_100925695 | Ga0070672_1009256952 | 197 |
| 9 | 3300006051 | Ga0075364_10138192 | Ga0075364_101381922 | 197 |
| 10 | 3300013308 | Ga0157375_11518941 | Ga0157375_115189411 | 197 |
| 11 | 3300014745 | Ga0157377_10165291 | Ga0157377_101652912 | 197 |
| 12 | 3300039437 | Ga0436365_0767090 | Ga0436365_0767090_9434_10033 | 197 |
| 13 | 3300005289 | Ga0065704_10015880 | Ga0065704_100158802 | 198 |
| 14 | 3300005335 | Ga0070666_10426470 | Ga0070666_104264701 | 198 |
| 15 | 3300005335 | Ga0070666_10682042 | Ga0070666_106820422 | 198 |
| 16 | 3300005340 | Ga0070689_100234754 | Ga0070689_1002347542 | 198 |
| 17 | 3300005340 | Ga0070689_100265412 | Ga0070689_1002654123 | 198 |
| 18 | 3300005340 | Ga0070689_100426433 | Ga0070689_1004264332 | 198 |
| 19 | 3300005340 | Ga0070689_100507348 | Ga0070689_1005073482 | 198 |
| 20 | 3300005343 | Ga0070687_100480125 | Ga0070687_1004801251 | 198 |
| 21 | 3300005353 | Ga0070669_100032387 | Ga0070669_1000323872 | 198 |
| 22 | 3300005355 | Ga0070671_100018016 | Ga0070671_1000180164 | 198 |
| 23 | 3300005365 | Ga0070688_100512477 | Ga0070688_1005124772 | 198 |
| 24 | 3300005366 | Ga0070659_100568545 | Ga0070659_1005685451 | 198 |
| 25 | 3300005367 | Ga0070667_100701295 | Ga0070667_1007012952 | 198 |
| 26 | 3300005458 | Ga0070681_10082225 | Ga0070681_100822255 | 198 |
| 27 | 3300005459 | Ga0068867_100104177 | Ga0068867_1001041772 | 198 |
| 28 | 3300005471 | Ga0070698_100286746 | Ga0070698_1002867462 | 198 |
| 29 | 3300005471 | Ga0070698_100830447 | Ga0070698_1008304471 | 198 |
| 30 | 3300005518 | Ga0070699_100200396 | Ga0070699_1002003961 | 198 |
| 31 | 3300005539 | Ga0068853_100235859 | Ga0068853_1002358592 | 198 |
| 32 | 3300005548 | Ga0070665_100046108 | Ga0070665_1000461083 | 198 |
| 33 | 3300005548 | Ga0070665_100660283 | Ga0070665_1006602832 | 198 |
| 34 | 3300005563 | Ga0068855_100202065 | Ga0068855_1002020652 | 198 |
| 35 | 3300005564 | Ga0070664_100054805 | Ga0070664_1000548053 | 198 |
| 36 | 3300005564 | Ga0070664_100112402 | Ga0070664_1001124021 | 198 |
| 37 | 3300005577 | Ga0068857_100651978 | Ga0068857_1006519782 | 198 |
| 38 | 3300005615 | Ga0070702_100076103 | Ga0070702_1000761032 | 198 |
| 39 | 3300005616 | Ga0068852_100515236 | Ga0068852_1005152362 | 198 |
| 40 | 3300005617 | Ga0068859_100137442 | Ga0068859_1001374422 | 198 |
| 41 | 3300005618 | Ga0068864_100541153 | Ga0068864_1005411532 | 198 |
| 42 | 3300005718 | Ga0068866_10051230 | Ga0068866_100512302 | 198 |
| 43 | 3300005841 | Ga0068863_100123010 | Ga0068863_1001230102 | 198 |
| 44 | 3300005841 | Ga0068863_100152778 | Ga0068863_1001527783 | 198 |
| 45 | 3300005842 | Ga0068858_100145271 | Ga0068858_1001452711 | 198 |
| 46 | 3300005843 | Ga0068860_100107777 | Ga0068860_1001077772 | 198 |
| 47 | 3300005843 | Ga0068860_100773627 | Ga0068860_1007736272 | 198 |
| 48 | 3300005844 | Ga0068862_100001533 | Ga0068862_1000015336 | 198 |
| 49 | 3300005937 | Ga0081455_10018423 | Ga0081455_100184236 | 198 |
| 50 | 3300006237 | Ga0097621_100074951 | Ga0097621_1000749513 | 198 |
| 51 | 3300006237 | Ga0097621_100122781 | Ga0097621_1001227811 | 198 |
| 52 | 3300006358 | Ga0068871_100010041 | Ga0068871_1000100416 | 198 |
| 53 | 3300006844 | Ga0075428_100000086 | Ga0075428_10000008666 | 198 |
| 54 | 3300006844 | Ga0075428_100377064 | Ga0075428_1003770642 | 198 |
| 55 | 3300006846 | Ga0075430_100000028 | Ga0075430_10000002869 | 198 |
| 56 | 3300006846 | Ga0075430_100149440 | Ga0075430_1001494401 | 198 |
| 57 | 3300006846 | Ga0075430_100293409 | Ga0075430_1002934091 | 198 |
| 58 | 3300006847 | Ga0075431_100002556 | Ga0075431_1000025564 | 198 |
| 59 | 3300006847 | Ga0075431_100168759 | Ga0075431_1001687592 | 198 |
| 60 | 3300006847 | Ga0075431_100231690 | Ga0075431_1002316902 | 198 |
| 61 | 3300006847 | Ga0075431_100792646 | Ga0075431_1007926461 | 198 |
| 62 | 3300006852 | Ga0075433_10184613 | Ga0075433_101846132 | 198 |
| 63 | 3300006880 | Ga0075429_100043206 | Ga0075429_1000432062 | 198 |
| 64 | 3300006881 | Ga0068865_100004448 | Ga0068865_1000044487 | 198 |
| 65 | 3300006931 | Ga0097620_100137444 | Ga0097620_1001374442 | 198 |
| 66 | 3300009011 | Ga0105251_10167034 | Ga0105251_101670342 | 198 |
| 67 | 3300009093 | Ga0105240_10006710 | Ga0105240_1000671019 | 198 |
| 68 | 3300009093 | Ga0105240_10059721 | Ga0105240_100597211 | 198 |
| 69 | 3300009093 | Ga0105240_10253255 | Ga0105240_102532552 | 198 |
| 70 | 3300009094 | Ga0111539_10000166 | Ga0111539_100001669 | 198 |
| 71 | 3300009094 | Ga0111539_10162086 | Ga0111539_101620862 | 198 |
| 72 | 3300009094 | Ga0111539_10559243 | Ga0111539_105592432 | 198 |
| 73 | 3300009094 | Ga0111539_10631454 | Ga0111539_106314541 | 198 |
| 74 | 3300009101 | Ga0105247_10006247 | Ga0105247_100062473 | 198 |
| 75 | 3300009101 | Ga0105247_10432517 | Ga0105247_104325171 | 198 |
| 76 | 3300009147 | Ga0114129_10000148 | Ga0114129_100001489 | 198 |
| 77 | 3300009147 | Ga0114129_10015571 | Ga0114129_100155712 | 198 |
| 78 | 3300009147 | Ga0114129_10045979 | Ga0114129_100459792 | 198 |
| 79 | 3300009147 | Ga0114129_10430927 | Ga0114129_104309271 | 198 |
| 80 | 3300009176 | Ga0105242_10158553 | Ga0105242_101585532 | 198 |
| 81 | 3300009176 | Ga0105242_10766594 | Ga0105242_107665942 | 198 |
| 82 | 3300009177 | Ga0105248_10005840 | Ga0105248_100058406 | 198 |
| 83 | 3300009177 | Ga0105248_10007216 | Ga0105248_100072162 | 198 |
| 84 | 3300009545 | Ga0105237_10014985 | Ga0105237_1001498512 | 198 |
| 85 | 3300009551 | Ga0105238_10102032 | Ga0105238_101020324 | 198 |
| 86 | 3300013105 | Ga0157369_10063056 | Ga0157369_100630563 | 198 |
| 87 | 3300013307 | Ga0157372_10258599 | Ga0157372_102585992 | 198 |
| 88 | 3300013307 | Ga0157372_10604408 | Ga0157372_106044082 | 198 |
| 89 | 3300014325 | Ga0163163_10084459 | Ga0163163_100844591 | 198 |
| 90 | 3300014968 | Ga0157379_10009196 | Ga0157379_100091966 | 198 |
| 91 | 3300014968 | Ga0157379_10038998 | Ga0157379_100389985 | 198 |
| 92 | 3300014968 | Ga0157379_10152597 | Ga0157379_101525972 | 198 |
| 93 | 3300014969 | Ga0157376_10027798 | Ga0157376_100277983 | 198 |
| 94 | 3300025900 | Ga0207710_10050671 | Ga0207710_100506712 | 198 |
| 95 | 3300025901 | Ga0207688_10607535 | Ga0207688_106075351 | 198 |
| 96 | 3300025903 | Ga0207680_10218528 | Ga0207680_102185281 | 198 |
| 97 | 3300025912 | Ga0207707_10425414 | Ga0207707_104254142 | 198 |
| 98 | 3300025913 | Ga0207695_10067420 | Ga0207695_100674206 | 198 |
| 99 | 3300025913 | Ga0207695_10198123 | Ga0207695_101981232 | 198 |
| 100 | 3300025913 | Ga0207695_10356335 | Ga0207695_103563352 | 198 |
| 101 | 3300025914 | Ga0207671_10000014 | Ga0207671_10000014290 | 198 |
| 102 | 3300025918 | Ga0207662_10132990 | Ga0207662_101329901 | 198 |
| 103 | 3300025919 | Ga0207657_10226458 | Ga0207657_102264581 | 198 |
| 104 | 3300025919 | Ga0207657_10377986 | Ga0207657_103779862 | 198 |
| 105 | 3300025920 | Ga0207649_10546683 | Ga0207649_105466831 | 198 |
| 106 | 3300025924 | Ga0207694_10083433 | Ga0207694_100834332 | 198 |
| 107 | 3300025925 | Ga0207650_10959862 | Ga0207650_109598622 | 198 |
| 108 | 3300025931 | Ga0207644_10275163 | Ga0207644_102751632 | 198 |
| 109 | 3300025934 | Ga0207686_10095364 | Ga0207686_100953642 | 198 |
| 110 | 3300025935 | Ga0207709_10335413 | Ga0207709_103354132 | 198 |
| 111 | 3300025936 | Ga0207670_10069798 | Ga0207670_100697982 | 198 |
| 112 | 3300025941 | Ga0207711_10003755 | Ga0207711_100037555 | 198 |
| 113 | 3300025941 | Ga0207711_10031597 | Ga0207711_100315974 | 198 |
| 114 | 3300025941 | Ga0207711_10206618 | Ga0207711_102066182 | 198 |
| 115 | 3300025942 | Ga0207689_10150630 | Ga0207689_101506302 | 198 |
| 116 | 3300025945 | Ga0207679_10231536 | Ga0207679_102315361 | 198 |
| 117 | 3300025945 | Ga0207679_10653856 | Ga0207679_106538561 | 198 |
| 118 | 3300025949 | Ga0207667_10328881 | Ga0207667_103288812 | 198 |
| 119 | 3300025972 | Ga0207668_10879278 | Ga0207668_108792781 | 198 |
| 120 | 3300026035 | Ga0207703_10063242 | Ga0207703_100632421 | 198 |
| 121 | 3300026035 | Ga0207703_10069505 | Ga0207703_100695052 | 198 |
| 122 | 3300026088 | Ga0207641_10000431 | Ga0207641_1000043140 | 198 |
| 123 | 3300026088 | Ga0207641_10308127 | Ga0207641_103081272 | 198 |
| 124 | 3300026089 | Ga0207648_10504841 | Ga0207648_105048411 | 198 |
| 125 | 3300026089 | Ga0207648_10690100 | Ga0207648_106901002 | 198 |
| 126 | 3300026095 | Ga0207676_10608329 | Ga0207676_106083292 | 198 |
| 127 | 3300026116 | Ga0207674_10594913 | Ga0207674_105949132 | 198 |
| 128 | 3300026121 | Ga0207683_10309178 | Ga0207683_103091781 | 198 |
| 129 | 3300027907 | Ga0207428_10000251 | Ga0207428_100002519 | 198 |
| 130 | 3300027907 | Ga0207428_10049608 | Ga0207428_100496083 | 198 |
| 131 | 3300028379 | Ga0268266_10045377 | Ga0268266_100453773 | 198 |
| 132 | 3300028380 | Ga0268265_10005741 | Ga0268265_100057416 | 198 |
| 133 | 3300028381 | Ga0268264_10110664 | Ga0268264_101106642 | 198 |
| 134 | 3300031548 | Ga0307408_100009815 | Ga0307408_1000098152 | 198 |
| 135 | 3300031548 | Ga0307408_100037371 | Ga0307408_1000373712 | 198 |
| 136 | 3300031548 | Ga0307408_100083440 | Ga0307408_1000834403 | 198 |
| 137 | 3300031731 | Ga0307405_10030512 | Ga0307405_100305123 | 198 |
| 138 | 3300031731 | Ga0307405_10483022 | Ga0307405_104830221 | 198 |
| 139 | 3300031824 | Ga0307413_10166015 | Ga0307413_101660152 | 198 |
| 140 | 3300031852 | Ga0307410_10097771 | Ga0307410_100977714 | 198 |
| 141 | 3300031901 | Ga0307406_10671897 | Ga0307406_106718972 | 198 |
| 142 | 3300031903 | Ga0307407_10594098 | Ga0307407_105940981 | 198 |
| 143 | 3300031911 | Ga0307412_10187186 | Ga0307412_101871863 | 198 |
| 144 | 3300031995 | Ga0307409_100291065 | Ga0307409_1002910652 | 198 |
| 145 | 3300032002 | Ga0307416_100006748 | Ga0307416_1000067484 | 198 |
| 146 | 3300032002 | Ga0307416_100028702 | Ga0307416_1000287022 | 198 |
| 147 | 3300032002 | Ga0307416_100101529 | Ga0307416_1001015292 | 198 |
| 148 | 3300032005 | Ga0307411_10494836 | Ga0307411_104948362 | 198 |
| 149 | 3300032126 | Ga0307415_100318874 | Ga0307415_1003188742 | 198 |
| 150 | 3300032126 | Ga0307415_100580089 | Ga0307415_1005800892 | 198 |
| 151 | 3300034819 | Ga0373958_0039432 | Ga0373958_0039432_283_882 | 198 |
| 152 | 3300035089 | Ga0373944_0092944 | Ga0373944_0092944_274_873 | 198 |
| 153 | 3300035092 | Ga0373952_0099779 | Ga0373952_0099779_119_718 | 198 |
| 154 | 3300035113 | Ga0373936_0222060 | Ga0373936_0222060_208_807 | 198 |
| 155 | 3300035116 | Ga0373945_0095938 | Ga0373945_0095938_64_663 | 198 |
| 156 | 3300035118 | Ga0373954_0301977 | Ga0373954_0301977_142_741 | 198 |
| 157 | 3300035170 | Ga0373943_0409143 | Ga0373943_0409143_31_630 | 198 |
| 158 | 3300035171 | Ga0373946_0054459 | Ga0373946_0054459_255_854 | 198 |
| 159 | 3300035171 | Ga0373946_0065859 | Ga0373946_0065859_355_954 | 198 |
| 160 | 3300035242 | Ga0373962_0019411 | Ga0373962_0019411_421_1020 | 198 |
| 161 | 3300035691 | Ga0373931_0377941 | Ga0373931_0377941_89_688 | 198 |
| 162 | 3300035725 | Ga0373947_0267151 | Ga0373947_0267151_175_774 | 198 |
| 163 | 3300035725 | Ga0373947_0300220 | Ga0373947_0300220_227_907 | 198 |
| 164 | 3300037068 | Ga0373925_0225766 | Ga0373925_0225766_326_925 | 198 |
| 165 | 3300037068 | Ga0373925_0403599 | Ga0373925_0403599_494_1093 | 198 |
| 166 | 3300042001 | Ga0439441_004453 | Ga0439441_004453_209_808 | 198 |
| 167 | 3300042439 | Ga0439464_0000301 | Ga0439464_0000301_6014_6613 | 198 |
| 168 | 3300046476 | Ga0495662_0232856 | Ga0495662_0232856_260_859 | 198 |
| 169 | 3300046477 | Ga0495664_0093746 | Ga0495664_0093746_1192_1791 | 198 |
| 170 | 3300046543 | Ga0495645_0010425 | Ga0495645_0010425_5187_5786 | 198 |
| 171 | 3300046663 | Ga0495635_0191922 | Ga0495635_0191922_659_1339 | 198 |
| 172 | 3300046663 | Ga0495635_0256009 | Ga0495635_0256009_62_661 | 198 |
| 173 | 3300046681 | Ga0495647_0013207 | Ga0495647_0013207_1202_1801 | 198 |
| 174 | 3300046683 | Ga0495658_0265000 | Ga0495658_0265000_313_993 | 198 |
| 175 | 3300047319 | Ga0495674_0288415 | Ga0495674_0288415_92_691 | 198 |
| 176 | 3300047321 | Ga0495676_0157657 | Ga0495676_0157657_707_1306 | 198 |
| 177 | 3300047471 | Ga0495684_0239068 | Ga0495684_0239068_676_1275 | 198 |
| 178 | 3300048911 | Ga0496108_0004433 | Ga0496108_0004433_10468_11067 | 198 |
| 179 | 3300048911 | Ga0496108_0585910 | Ga0496108_0585910_255_854 | 198 |
| 180 | 3300048913 | Ga0496110_0422496 | Ga0496110_0422496_422_1021 | 198 |
| 181 | 3300048914 | Ga0496111_0916585 | Ga0496111_0916585_14_613 | 198 |
| 182 | 3300048915 | Ga0496112_0005771 | Ga0496112_0005771_7800_8399 | 198 |
| 183 | 3300048917 | Ga0496114_0051441 | Ga0496114_0051441_2398_2997 | 198 |
| 184 | 3300048917 | Ga0496114_0266579 | Ga0496114_0266579_86_685 | 198 |
| 185 | 3300049522 | Ga0501299_005645 | Ga0501299_005645_334_933 | 198 |
| 186 | 3300049669 | Ga0501235_011300 | Ga0501235_011300_571_1170 | 198 |
| 187 | 3300049674 | Ga0501242_027528 | Ga0501242_027528_117_716 | 198 |
| 188 | 3300049679 | Ga0501249_124559 | Ga0501249_124559_11_610 | 198 |
| 189 | 3300050507 | nmdc:mga05p37_100800_c1 | nmdc:mga05p37_100800_c1_1725_2324 | 198 |
| 190 | 3300050507 | nmdc:mga05p37_221_c1 | nmdc:mga05p37_221_c1_8435_9034 | 198 |
| 191 | 3300050507 | nmdc:mga05p37_2609_c1 | nmdc:mga05p37_2609_c1_2800_3399 | 198 |
| 192 | 3300050507 | nmdc:mga05p37_357126_c1 | nmdc:mga05p37_357126_c1_208_807 | 198 |
| 193 | 3300050507 | nmdc:mga05p37_55812_c1 | nmdc:mga05p37_55812_c1_917_1516 | 198 |
| 194 | 3300050508 | nmdc:mga09592_254084_c1 | nmdc:mga09592_254084_c1_18_617 | 198 |
| 195 | 3300050508 | nmdc:mga09592_39781_c1 | nmdc:mga09592_39781_c1_2268_2867 | 198 |
| 196 | 3300050509 | nmdc:mga0qj67_10030_c1 | nmdc:mga0qj67_10030_c1_3305_3904 | 198 |
| 197 | 3300050509 | nmdc:mga0qj67_438056_c1 | nmdc:mga0qj67_438056_c1_116_715 | 198 |
| 198 | 3300050510 | nmdc:mga06r32_23101_c1 | nmdc:mga06r32_23101_c1_652_1251 | 198 |
| 199 | 3300050510 | nmdc:mga06r32_423739_c1 | nmdc:mga06r32_423739_c1_156_755 | 198 |
| 200 | 3300050511 | nmdc:mga08y16_13158_c1 | nmdc:mga08y16_13158_c1_3829_4428 | 198 |
| 201 | 3300050511 | nmdc:mga08y16_690310_c1 | nmdc:mga08y16_690310_c1_277_876 | 198 |
| 202 | 3300050515 | nmdc:mga0a205_103917_c1 | nmdc:mga0a205_103917_c1_1167_1766 | 198 |
| 203 | 3300053085 | Ga0495619_0203943 | Ga0495619_0203943_347_1027 | 198 |
| 204 | 3300053134 | Ga0500658_0131929 | Ga0500658_0131929_91_690 | 198 |
| 205 | iso_pu_bacteria | 8057632132 | 8057634774 | 198 |
| 206 | 3300005290 | Ga0065712_10084370 | Ga0065712_100843703 | 199 |
| 207 | 3300005293 | Ga0065715_10003953 | Ga0065715_100039535 | 199 |
| 208 | 3300005331 | Ga0070670_100030212 | Ga0070670_1000302123 | 199 |
| 209 | 3300005353 | Ga0070669_100236440 | Ga0070669_1002364402 | 199 |
| 210 | 3300005354 | Ga0070675_100015752 | Ga0070675_1000157522 | 199 |
| 211 | 3300005354 | Ga0070675_100785736 | Ga0070675_1007857361 | 199 |
| 212 | 3300005356 | Ga0070674_100111358 | Ga0070674_1001113582 | 199 |
| 213 | 3300005356 | Ga0070674_100538314 | Ga0070674_1005383141 | 199 |
| 214 | 3300005365 | Ga0070688_100052634 | Ga0070688_1000526342 | 199 |
| 215 | 3300005365 | Ga0070688_100715258 | Ga0070688_1007152581 | 199 |
| 216 | 3300005441 | Ga0070700_100256044 | Ga0070700_1002560441 | 199 |
| 217 | 3300005457 | Ga0070662_100301055 | Ga0070662_1003010553 | 199 |
| 218 | 3300005548 | Ga0070665_100017378 | Ga0070665_1000173786 | 199 |
| 219 | 3300005616 | Ga0068852_100077425 | Ga0068852_1000774252 | 199 |
| 220 | 3300005617 | Ga0068859_100076630 | Ga0068859_1000766302 | 199 |
| 221 | 3300005618 | Ga0068864_100078595 | Ga0068864_1000785954 | 199 |
| 222 | 3300005719 | Ga0068861_100130823 | Ga0068861_1001308232 | 199 |
| 223 | 3300005719 | Ga0068861_100380356 | Ga0068861_1003803561 | 199 |
| 224 | 3300005840 | Ga0068870_10032638 | Ga0068870_100326381 | 199 |
| 225 | 3300005841 | Ga0068863_100099960 | Ga0068863_1000999602 | 199 |
| 226 | 3300005843 | Ga0068860_100099235 | Ga0068860_1000992352 | 199 |
| 227 | 3300006358 | Ga0068871_100472498 | Ga0068871_1004724981 | 199 |
| 228 | 3300006881 | Ga0068865_100071133 | Ga0068865_1000711334 | 199 |
| 229 | 3300006931 | Ga0097620_100076628 | Ga0097620_1000766284 | 199 |
| 230 | 3300009098 | Ga0105245_10032444 | Ga0105245_100324443 | 199 |
| 231 | 3300009176 | Ga0105242_10077293 | Ga0105242_100772934 | 199 |
| 232 | 3300009176 | Ga0105242_10449384 | Ga0105242_104493842 | 199 |
| 233 | 3300009177 | Ga0105248_10008141 | Ga0105248_100081417 | 199 |
| 234 | 3300009177 | Ga0105248_10311456 | Ga0105248_103114562 | 199 |
| 235 | 3300009553 | Ga0105249_10119508 | Ga0105249_101195082 | 199 |
| 236 | 3300010375 | Ga0105239_10356510 | Ga0105239_103565102 | 199 |
| 237 | 3300013104 | Ga0157370_10193003 | Ga0157370_101930032 | 199 |
| 238 | 3300013306 | Ga0163162_10094250 | Ga0163162_100942503 | 199 |
| 239 | 3300014325 | Ga0163163_10061782 | Ga0163163_100617822 | 199 |
| 240 | 3300017792 | Ga0163161_10106662 | Ga0163161_101066622 | 199 |
| 241 | 3300025899 | Ga0207642_10145603 | Ga0207642_101456031 | 199 |
| 242 | 3300025903 | Ga0207680_10256499 | Ga0207680_102564992 | 199 |
| 243 | 3300025908 | Ga0207643_10094057 | Ga0207643_100940571 | 199 |
| 244 | 3300025919 | Ga0207657_10334913 | Ga0207657_103349133 | 199 |
| 245 | 3300025925 | Ga0207650_10505929 | Ga0207650_105059292 | 199 |
| 246 | 3300025927 | Ga0207687_10265585 | Ga0207687_102655851 | 199 |
| 247 | 3300025931 | Ga0207644_10248952 | Ga0207644_102489521 | 199 |
| 248 | 3300025933 | Ga0207706_10237533 | Ga0207706_102375334 | 199 |
| 249 | 3300025934 | Ga0207686_10104974 | Ga0207686_101049742 | 199 |
| 250 | 3300025936 | Ga0207670_10689674 | Ga0207670_106896741 | 199 |
| 251 | 3300025937 | Ga0207669_10454483 | Ga0207669_104544832 | 199 |
| 252 | 3300025937 | Ga0207669_10828558 | Ga0207669_108285582 | 199 |
| 253 | 3300025938 | Ga0207704_10120793 | Ga0207704_101207932 | 199 |
| 254 | 3300025941 | Ga0207711_10092798 | Ga0207711_100927982 | 199 |
| 255 | 3300025942 | Ga0207689_10449377 | Ga0207689_104493771 | 199 |
| 256 | 3300025960 | Ga0207651_10534127 | Ga0207651_105341272 | 199 |
| 257 | 3300025961 | Ga0207712_10076503 | Ga0207712_100765032 | 199 |
| 258 | 3300026035 | Ga0207703_10895054 | Ga0207703_108950541 | 199 |
| 259 | 3300026075 | Ga0207708_10464680 | Ga0207708_104646802 | 199 |
| 260 | 3300026088 | Ga0207641_10049875 | Ga0207641_100498754 | 199 |
| 261 | 3300026089 | Ga0207648_10046080 | Ga0207648_100460803 | 199 |
| 262 | 3300026118 | Ga0207675_100148412 | Ga0207675_1001484123 | 199 |
| 263 | 3300026118 | Ga0207675_100239807 | Ga0207675_1002398072 | 199 |
| 264 | 3300026142 | Ga0207698_10462767 | Ga0207698_104627672 | 199 |
| 265 | 3300027907 | Ga0207428_10350299 | Ga0207428_103502992 | 199 |
| 266 | 3300028379 | Ga0268266_10023052 | Ga0268266_100230526 | 199 |
| 267 | 3300028380 | Ga0268265_10227742 | Ga0268265_102277422 | 199 |
| 268 | 3300031852 | Ga0307410_10332722 | Ga0307410_103327222 | 199 |
| 269 | 3300031903 | Ga0307407_10155701 | Ga0307407_101557012 | 199 |
| 270 | 3300032002 | Ga0307416_100538280 | Ga0307416_1005382802 | 199 |
| 271 | 3300032005 | Ga0307411_10113017 | Ga0307411_101130172 | 199 |
| 272 | 3300041460 | Ga0451802_0086641 | Ga0451802_0086641_290_892 | 199 |
| 273 | 3300042436 | Ga0439435_0041457 | Ga0439435_0041457_26_628 | 199 |
| 274 | 3300048904 | Ga0496101_0082063 | Ga0496101_0082063_1223_1825 | 199 |
| 275 | 3300048907 | Ga0496104_0052271 | Ga0496104_0052271_924_1526 | 199 |
| 276 | 3300048908 | Ga0496105_0232078 | Ga0496105_0232078_576_1178 | 199 |
| 277 | 3300048909 | Ga0496106_0334681 | Ga0496106_0334681_255_857 | 199 |
| 278 | 3300048911 | Ga0496108_0182514 | Ga0496108_0182514_648_1250 | 199 |
| 279 | 3300048912 | Ga0496109_0290791 | Ga0496109_0290791_473_1075 | 199 |
| 280 | 3300048915 | Ga0496112_0008688 | Ga0496112_0008688_434_1036 | 199 |
| 281 | 3300048916 | Ga0496113_0119253 | Ga0496113_0119253_879_1481 | 199 |
| 282 | 3300049568 | Ga0501031_0408831 | Ga0501031_0408831_202_804 | 199 |
| 283 | 3300049569 | Ga0501032_0096265 | Ga0501032_0096265_645_1247 | 199 |
| 284 | 3300049570 | Ga0501033_0022820 | Ga0501033_0022820_2485_3087 | 199 |
| 285 | 3300049571 | Ga0501034_0054629 | Ga0501034_0054629_475_1077 | 199 |
| 286 | 3300049572 | Ga0501036_0166564 | Ga0501036_0166564_43_645 | 199 |
| 287 | 3300049573 | Ga0501037_0030519 | Ga0501037_0030519_2853_3455 | 199 |
| 288 | 3300049575 | Ga0501039_0261078 | Ga0501039_0261078_19_621 | 199 |
| 289 | 3300049578 | Ga0501042_0400690 | Ga0501042_0400690_307_909 | 199 |
| 290 | 3300049580 | Ga0501046_0081713 | Ga0501046_0081713_579_1181 | 199 |
| 291 | 3300049581 | Ga0501047_0122491 | Ga0501047_0122491_1154_1756 | 199 |
| 292 | 3300049589 | Ga0501073_0083930 | Ga0501073_0083930_411_1013 | 199 |
| 293 | 3300049589 | Ga0501073_0189448 | Ga0501073_0189448_741_1343 | 199 |
| 294 | 3300049591 | Ga0501075_0045075 | Ga0501075_0045075_68_679 | 199 |
| 295 | 3300049591 | Ga0501075_0899566 | Ga0501075_0899566_24_626 | 199 |
| 296 | 3300049592 | Ga0501076_0408389 | Ga0501076_0408389_133_744 | 199 |
| 297 | 3300049823 | Ga0501044_0534032 | Ga0501044_0534032_19_621 | 199 |
| 298 | 3300050511 | nmdc:mga08y16_743486_c1 | nmdc:mga08y16_743486_c1_230_832 | 199 |
| 299 | 3300050511 | nmdc:mga08y16_85677_c1 | nmdc:mga08y16_85677_c1_1753_2355 | 199 |
| 300 | 3300053090 | Ga0500646_0017397 | Ga0500646_0017397_965_1567 | 199 |
| 301 | 3300053096 | Ga0500641_0039509 | Ga0500641_0039509_927_1529 | 199 |
| 302 | 3300054114 | Ga0501084_0783230 | Ga0501084_0783230_166_777 | 199 |
| 303 | 3300060353 | Ga0501082_0624221 | Ga0501082_0624221_21_623 | 199 |
| 304 | 3300005444 | Ga0070694_100179016 | Ga0070694_1001790161 | 200 |
| 305 | 3300005444 | Ga0070694_100371855 | Ga0070694_1003718552 | 200 |
| 306 | 3300005518 | Ga0070699_100032009 | Ga0070699_1000320095 | 200 |
| 307 | 3300006914 | Ga0075436_100104708 | Ga0075436_1001047082 | 200 |
| 308 | 3300007076 | Ga0075435_100058538 | Ga0075435_1000585382 | 200 |
| 309 | 3300020070 | Ga0206356_10064439 | Ga0206356_100644391 | 200 |
| 310 | 3300020077 | Ga0206351_10100007 | Ga0206351_101000071 | 200 |
| 311 | 3300020610 | Ga0154015_1063369 | Ga0154015_10633691 | 200 |
| 312 | 3300020610 | Ga0154015_1585089 | Ga0154015_15850891 | 200 |
| 313 | 3300022467 | Ga0224712_10018737 | Ga0224712_100187371 | 200 |
| 314 | 3300037068 | Ga0373925_0778839 | Ga0373925_0778839_149_754 | 200 |
| 315 | 3300050513 | nmdc:mga0rr50_380486_c1 | nmdc:mga0rr50_380486_c1_124_729 | 200 |
| 316 | 3300050514 | nmdc:mga08x19_283782_c1 | nmdc:mga08x19_283782_c1_323_928 | 200 |
| 317 | 3300059511 | Ga0587091_099496 | Ga0587091_099496_21_629 | 200 |
| 318 | 3300003371 | JGI26145J50221_1008472 | JGI26145J50221_10084721 | 201 |
| 319 | 3300004799 | Ga0058863_11588021 | Ga0058863_115880211 | 201 |
| 320 | 3300005329 | Ga0070683_100122332 | Ga0070683_1001223322 | 201 |
| 321 | 3300005336 | Ga0070680_100370315 | Ga0070680_1003703152 | 201 |
| 322 | 3300005434 | Ga0070709_10094221 | Ga0070709_100942212 | 201 |
| 323 | 3300005530 | Ga0070679_100819179 | Ga0070679_1008191792 | 201 |
| 324 | 3300005536 | Ga0070697_100240728 | Ga0070697_1002407281 | 201 |
| 325 | 3300005545 | Ga0070695_100105534 | Ga0070695_1001055342 | 201 |
| 326 | 3300005563 | Ga0068855_100130468 | Ga0068855_1001304683 | 201 |
| 327 | 3300006880 | Ga0075429_100304350 | Ga0075429_1003043502 | 201 |
| 328 | 3300009177 | Ga0105248_10797059 | Ga0105248_107970591 | 201 |
| 329 | 3300009545 | Ga0105237_10098887 | Ga0105237_100988872 | 201 |
| 330 | 3300013105 | Ga0157369_10369414 | Ga0157369_103694142 | 201 |
| 331 | 3300013296 | Ga0157374_10975487 | Ga0157374_109754872 | 201 |
| 332 | 3300020069 | Ga0197907_10859286 | Ga0197907_108592861 | 201 |
| 333 | 3300020076 | Ga0206355_1589848 | Ga0206355_15898481 | 201 |
| 334 | 3300020080 | Ga0206350_10703862 | Ga0206350_107038621 | 201 |
| 335 | 3300021384 | Ga0213876_10014747 | Ga0213876_100147473 | 201 |
| 336 | 3300021388 | Ga0213875_10012340 | Ga0213875_100123402 | 201 |
| 337 | 3300021388 | Ga0213875_10052109 | Ga0213875_100521092 | 201 |
| 338 | 3300025906 | Ga0207699_10284860 | Ga0207699_102848601 | 201 |
| 339 | 3300025910 | Ga0207684_10153320 | Ga0207684_101533202 | 201 |
| 340 | 3300025914 | Ga0207671_10179268 | Ga0207671_101792682 | 201 |
| 341 | 3300025917 | Ga0207660_10398751 | Ga0207660_103987511 | 201 |
| 342 | 3300025921 | Ga0207652_10725472 | Ga0207652_107254721 | 201 |
| 343 | 3300026023 | Ga0207677_10439421 | Ga0207677_104394212 | 201 |
| 344 | 3300027543 | Ga0209999_1004313 | Ga0209999_10043135 | 201 |
| 345 | 3300027717 | Ga0209998_10013211 | Ga0209998_100132112 | 201 |
| 346 | 3300027876 | Ga0209974_10002498 | Ga0209974_100024981 | 201 |
| 347 | 3300028800 | Ga0265338_10397095 | Ga0265338_103970952 | 201 |
| 348 | 3300032168 | Ga0316593_10234493 | Ga0316593_102344931 | 201 |
| 349 | 3300037471 | Ga0395905_0010290 | Ga0395905_0010290_1661_2269 | 201 |
| 350 | 3300037853 | Ga0436364_0305164 | Ga0436364_0305164_1228_1839 | 201 |
| 351 | 3300037853 | Ga0436364_0867121 | Ga0436364_0867121_236_847 | 201 |
| 352 | 3300037853 | Ga0436364_1091719 | Ga0436364_1091719_1222_1836 | 201 |
| 353 | 3300042005 | Ga0439448_0138727 | Ga0439448_0138727_156_779 | 201 |
| 354 | 3300044673 | Ga0453683_0004648 | Ga0453683_0004648_1252_1905 | 201 |
| 355 | 3300045051 | Ga0451576_0536984 | Ga0451576_0536984_439_1050 | 201 |
| 356 | 3300045836 | Ga0466958_0056126 | Ga0466958_0056126_62_727 | 201 |
| 357 | 3300045976 | Ga0466967_1046237 | Ga0466967_1046237_148_762 | 201 |
| 358 | 3300046679 | Ga0495623_0020653 | Ga0495623_0020653_3615_4241 | 201 |
| 359 | 3300049568 | Ga0501031_0081232 | Ga0501031_0081232_451_1059 | 201 |
| 360 | 3300049572 | Ga0501036_0052168 | Ga0501036_0052168_143_751 | 201 |
| 361 | 3300049574 | Ga0501038_0045992 | Ga0501038_0045992_3077_3685 | 201 |
| 362 | 3300049576 | Ga0501040_0135776 | Ga0501040_0135776_771_1379 | 201 |
| 363 | 3300049577 | Ga0501041_0548737 | Ga0501041_0548737_56_667 | 201 |
| 364 | 3300049578 | Ga0501042_0204941 | Ga0501042_0204941_451_1059 | 201 |
| 365 | 3300049579 | Ga0501043_0242222 | Ga0501043_0242222_422_1030 | 201 |
| 366 | 3300049582 | Ga0501048_0079885 | Ga0501048_0079885_777_1385 | 201 |
| 367 | 3300049591 | Ga0501075_0057731 | Ga0501075_0057731_2274_2882 | 201 |
| 368 | 3300049742 | Ga0501080_0047885 | Ga0501080_0047885_2080_2688 | 201 |
| 369 | 3300049743 | Ga0501081_0036713 | Ga0501081_0036713_1260_1868 | 201 |
| 370 | 3300059490 | Ga0587066_062786 | Ga0587066_062786_104_715 | 201 |
| 371 | 3300059491 | Ga0587070_089158 | Ga0587070_089158_55_666 | 201 |
| 372 | 3300059492 | Ga0587073_0033314 | Ga0587073_0033314_96_710 | 201 |
| 373 | 3300059492 | Ga0587073_0065283 | Ga0587073_0065283_226_840 | 201 |
| 374 | 3300059492 | Ga0587073_0097839 | Ga0587073_0097839_98_709 | 201 |
| 375 | 3300059504 | Ga0587082_069661 | Ga0587082_069661_50_661 | 201 |
| 376 | 3300059505 | Ga0587083_0091806 | Ga0587083_0091806_48_659 | 201 |
| 377 | 3300059506 | Ga0587085_058415 | Ga0587085_058415_65_676 | 201 |
| 378 | 3300059508 | Ga0587088_049681 | Ga0587088_049681_18_632 | 201 |
| 379 | 3300059508 | Ga0587088_075278 | Ga0587088_075278_47_658 | 201 |
| 380 | 3300059510 | Ga0587090_038616 | Ga0587090_038616_188_802 | 201 |
| 381 | 3300059511 | Ga0587091_060842 | Ga0587091_060842_86_700 | 201 |
| 382 | 3300059513 | Ga0587094_038943 | Ga0587094_038943_105_716 | 201 |
| 383 | 3300059645 | Ga0587076_074511 | Ga0587076_074511_50_661 | 201 |
| 384 | 3300059647 | Ga0587079_091388 | Ga0587079_091388_51_662 | 201 |
| 385 | 3300059652 | Ga0587107_029224 | Ga0587107_029224_68_679 | 201 |
| 386 | 3300060353 | Ga0501082_0230136 | Ga0501082_0230136_876_1484 | 201 |
| 387 | 3300061734 | Ga0530510_0081982 | Ga0530510_0081982_63_671 | 201 |
| 388 | 3300003161 | Ga0006765J45826_114789 | Ga0006765J45826_1147891 | 202 |
| 389 | 3300003162 | Ga0006778J45830_1067745 | Ga0006778J45830_10677451 | 202 |
| 390 | 3300003574 | Ga0007410J51695_1066582 | Ga0007410J51695_10665821 | 202 |
| 391 | 3300003579 | Ga0007429J51699_1034974 | Ga0007429J51699_10349741 | 202 |
| 392 | 3300004798 | Ga0058859_11304566 | Ga0058859_113045661 | 202 |
| 393 | 3300004803 | Ga0058862_12888305 | Ga0058862_128883051 | 202 |
| 394 | 3300005435 | Ga0070714_100014046 | Ga0070714_1000140464 | 202 |
| 395 | 3300005435 | Ga0070714_101066680 | Ga0070714_1010666802 | 202 |
| 396 | 3300005436 | Ga0070713_100027943 | Ga0070713_1000279433 | 202 |
| 397 | 3300005436 | Ga0070713_100556871 | Ga0070713_1005568711 | 202 |
| 398 | 3300005436 | Ga0070713_100896586 | Ga0070713_1008965861 | 202 |
| 399 | 3300005467 | Ga0070706_100084925 | Ga0070706_1000849253 | 202 |
| 400 | 3300005535 | Ga0070684_100139073 | Ga0070684_1001390731 | 202 |
| 401 | 3300005563 | Ga0068855_100082379 | Ga0068855_1000823792 | 202 |
| 402 | 3300005563 | Ga0068855_100854516 | Ga0068855_1008545161 | 202 |
| 403 | 3300005614 | Ga0068856_100024412 | Ga0068856_1000244122 | 202 |
| 404 | 3300005614 | Ga0068856_100109945 | Ga0068856_1001099453 | 202 |
| 405 | 3300006028 | Ga0070717_10024248 | Ga0070717_100242482 | 202 |
| 406 | 3300006028 | Ga0070717_10322330 | Ga0070717_103223301 | 202 |
| 407 | 3300013105 | Ga0157369_10036186 | Ga0157369_100361863 | 202 |
| 408 | 3300013105 | Ga0157369_10402488 | Ga0157369_104024882 | 202 |
| 409 | 3300013307 | Ga0157372_10028293 | Ga0157372_100282932 | 202 |
| 410 | 3300020069 | Ga0197907_10009712 | Ga0197907_100097121 | 202 |
| 411 | 3300020069 | Ga0197907_10944230 | Ga0197907_109442301 | 202 |
| 412 | 3300020069 | Ga0197907_11361374 | Ga0197907_113613741 | 202 |
| 413 | 3300020070 | Ga0206356_10076381 | Ga0206356_100763811 | 202 |
| 414 | 3300020070 | Ga0206356_11357793 | Ga0206356_113577931 | 202 |
| 415 | 3300020075 | Ga0206349_1119537 | Ga0206349_11195371 | 202 |
| 416 | 3300020075 | Ga0206349_1292317 | Ga0206349_12923171 | 202 |
| 417 | 3300020076 | Ga0206355_1165588 | Ga0206355_11655881 | 202 |
| 418 | 3300020077 | Ga0206351_10334331 | Ga0206351_103343311 | 202 |
| 419 | 3300020078 | Ga0206352_10116104 | Ga0206352_101161041 | 202 |
| 420 | 3300020078 | Ga0206352_10726661 | Ga0206352_107266611 | 202 |
| 421 | 3300020080 | Ga0206350_10097771 | Ga0206350_100977711 | 202 |
| 422 | 3300020080 | Ga0206350_10472793 | Ga0206350_104727931 | 202 |
| 423 | 3300020080 | Ga0206350_10940339 | Ga0206350_109403391 | 202 |
| 424 | 3300020081 | Ga0206354_10543553 | Ga0206354_105435531 | 202 |
| 425 | 3300020081 | Ga0206354_10666411 | Ga0206354_106664111 | 202 |
| 426 | 3300020082 | Ga0206353_11460749 | Ga0206353_114607491 | 202 |
| 427 | 3300022467 | Ga0224712_10193622 | Ga0224712_101936221 | 202 |
| 428 | 3300022467 | Ga0224712_10327154 | Ga0224712_103271541 | 202 |
| 429 | 3300025911 | Ga0207654_10192446 | Ga0207654_101924462 | 202 |
| 430 | 3300025913 | Ga0207695_10145229 | Ga0207695_101452292 | 202 |
| 431 | 3300025928 | Ga0207700_10016389 | Ga0207700_100163894 | 202 |
| 432 | 3300025928 | Ga0207700_10817365 | Ga0207700_108173651 | 202 |
| 433 | 3300025929 | Ga0207664_10010224 | Ga0207664_100102244 | 202 |
| 434 | 3300025949 | Ga0207667_10062008 | Ga0207667_100620084 | 202 |
| 435 | 3300026078 | Ga0207702_10260618 | Ga0207702_102606181 | 202 |
| 436 | 3300028023 | Ga0265357_1011164 | Ga0265357_10111641 | 202 |
| 437 | 3300030760 | Ga0265762_1006265 | Ga0265762_10062652 | 202 |
| 438 | 3300032002 | Ga0307416_100292714 | Ga0307416_1002927143 | 202 |
| 439 | 3300035695 | Ga0373927_0000552 | Ga0373927_0000552_14938_15552 | 202 |
| 440 | 3300036457 | Ga0265778_020135 | Ga0265778_020135_115_765 | 202 |
| 441 | 3300042876 | Ga0451577_0001463 | Ga0451577_0001463_6844_7464 | 202 |
| 442 | 3300044706 | Ga0466964_0200826 | Ga0466964_0200826_33_653 | 202 |
| 443 | 3300044712 | Ga0453684_0000324 | Ga0453684_0000324_108222_108842 | 202 |
| 444 | 3300044842 | Ga0466957_0109780 | Ga0466957_0109780_314_928 | 202 |
| 445 | 3300044842 | Ga0466957_0298777 | Ga0466957_0298777_392_1012 | 202 |
| 446 | 3300045049 | Ga0466959_0020720 | Ga0466959_0020720_1379_1999 | 202 |
| 447 | 3300045049 | Ga0466959_0055775 | Ga0466959_0055775_569_1189 | 202 |
| 448 | 3300045051 | Ga0451576_0019003 | Ga0451576_0019003_5393_6013 | 202 |
| 449 | 3300045836 | Ga0466958_0113299 | Ga0466958_0113299_479_1099 | 202 |
| 450 | 3300046516 | Ga0495628_0018272 | Ga0495628_0018272_1733_2494 | 202 |
| 451 | 3300046522 | Ga0495643_0000016 | Ga0495643_0000016_153771_154394 | 202 |
| 452 | 3300046680 | Ga0495646_0347484 | Ga0495646_0347484_143_763 | 202 |
| 453 | 3300047317 | Ga0495604_0555440 | Ga0495604_0555440_95_715 | 202 |
| 454 | 3300049571 | Ga0501034_0657950 | Ga0501034_0657950_42_653 | 202 |
| 455 | 3300049573 | Ga0501037_0004407 | Ga0501037_0004407_9584_10198 | 202 |
| 456 | 3300049588 | Ga0501072_0128314 | Ga0501072_0128314_46_657 | 202 |
| 457 | 3300050514 | nmdc:mga08x19_80356_c1 | nmdc:mga08x19_80356_c1_614_1234 | 202 |
| 458 | 3300053078 | Ga0495612_0069383 | Ga0495612_0069383_622_1242 | 202 |
| 459 | 3300059510 | Ga0587090_037498 | Ga0587090_037498_10_654 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rcv-assembly3.cif.gz_D | crystal structure of the bacillus subtilis superoxide dismutase | 0.991 | 3 | 200 |
| 2rcv-assembly2.cif.gz_H | crystal structure of the bacillus subtilis superoxide dismutase | 0.9862 | 3 | 200 |
| 2rcv-assembly4.cif.gz_F | crystal structure of the bacillus subtilis superoxide dismutase | 0.986 | 3 | 200 |
| 1xuq-assembly1.cif.gz_B | crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. | 0.9842 | 3 | 200 |
| 6ex3-assembly1.cif.gz_A | staphylococcus aureus superoxide dismutase soda | 0.9831 | 3 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ce4B01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9953 | 20 | 88 | 1.10.287.990 |
| 6ex3A01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9937 | 20 | 89 | 1.10.287.990 |
| 2rcvD01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9926 | 20 | 89 | 1.10.287.990 |
| 2cdyC01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9921 | 20 | 88 | 1.10.287.990 |
| 3kkyB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9916 | 20 | 88 | 1.10.287.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A085DR24-F1-model_v4 | deleted | 0.9937 | 101 | 201 |
|
| AF-A0A7X9DGD8-F1-model_v4 | superoxide dismutase (EC 1.15.1.1) | 0.9925 | 95 | 201 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A3C0K592-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9918 | 1 | 200 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A1H6FXA6-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9911 | 1 | 201 |
GO:0004784
GO:0005737 GO:0046872 |
| AF-A0A2N2PMT9-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9911 | 2 | 199 |
GO:0004784
GO:0005737 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar