F448377

General Info

Members Datasets Scaffolds Average Seq Length
459 290 458 201

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10397095|Ga0265338_103970952
Length 248
Sequence MAPQRDFPDFQTLLTKPRHKGYNYGATLEIEEGIMTQTSGQGAAPGAFTVPPLPYSFDALEPYIDAKTMEIHHDKHHAAYVTNLNKALEGHADLQKLSVEEIISHLDRVPENVRTAVRNNGGGHANHSLFWKIMKKGGGGEPKGELADAIKSTFGSFADFKTKFNQAATTRFGSGWAWLQIAGGKLAIESSANQDSPLMNNAKPVFGLDVWEHAYYLKYQNRRPEYIEAFWNVLNWDELTNNFEHAKK

Samples

Sample ID Description Type Environment
1 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
197 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.8
Metatranscriptomes 11.98
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 3.49
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006765J45826_114789 3300003161 Bacteria 687
2 Ga0006778J45830_1067745 3300003162 Bacteria 831
3 JGI26145J50221_1008472 3300003371 Bacteria 883
4 Ga0007410J51695_1066582 3300003574 Bacteria 696
5 Ga0007429J51699_1034974 3300003579 Bacteria 861
6 Ga0058859_11304566 3300004798 Bacteria 740
7 Ga0058863_11588021 3300004799 Bacteria 997
8 Ga0058862_12888305 3300004803 Bacteria 730
9 Ga0065704_10015880 3300005289 Bacteria 1661
10 Ga0065704_10019943 3300005289 Bacteria 1232
11 Ga0065712_10084370 3300005290 Bacteria 2754
12 Ga0065715_10003953 3300005293 Bacteria 5892
13 Ga0065707_10009026 3300005295 Bacteria 3072
14 Ga0070683_100122332 3300005329 Bacteria 2459
15 Ga0070670_100030212 3300005331 Bacteria 4666
16 Ga0070666_10426470 3300005335 Bacteria 956
17 Ga0070666_10682042 3300005335 Bacteria 753
18 Ga0070680_100370315 3300005336 Bacteria 1219
19 Ga0070689_100234754 3300005340 Bacteria 1509
20 Ga0070689_100265412 3300005340 Bacteria 1420
21 Ga0070689_100426433 3300005340 Bacteria 1125
22 Ga0070689_100507348 3300005340 Bacteria 1034
23 Ga0070687_100480125 3300005343 Bacteria 833
24 Ga0070669_100032387 3300005353 Bacteria 3775
25 Ga0070669_100236440 3300005353 Bacteria 1450
26 Ga0070675_100015752 3300005354 Bacteria 5984
27 Ga0070675_100704688 3300005354 Bacteria 920
28 Ga0070675_100785736 3300005354 Bacteria 870
29 Ga0070671_100018016 3300005355 Bacteria 5731
30 Ga0070674_100111358 3300005356 Bacteria 2010
31 Ga0070674_100538314 3300005356 Bacteria 978
32 Ga0070688_100052634 3300005365 Bacteria 2544
33 Ga0070688_100512477 3300005365 Bacteria 906
34 Ga0070688_100715258 3300005365 Bacteria 777
35 Ga0070659_100568545 3300005366 Bacteria 972
36 Ga0070667_100701295 3300005367 Bacteria 937
37 Ga0070709_10094221 3300005434 Bacteria 1981
38 Ga0070714_100014046 3300005435 Bacteria 6425
39 Ga0070714_101066680 3300005435 Bacteria 787
40 Ga0070713_100027943 3300005436 Bacteria 4448
41 Ga0070713_100070211 3300005436 Bacteria 2956
42 Ga0070713_100556871 3300005436 Bacteria 1086
43 Ga0070713_100896586 3300005436 Bacteria 853
44 Ga0070700_100256044 3300005441 Bacteria 1258
45 Ga0070694_100179016 3300005444 Bacteria 1567
46 Ga0070694_100371855 3300005444 Bacteria 1112
47 Ga0070662_100301055 3300005457 Bacteria 1303
48 Ga0070681_10082225 3300005458 Bacteria 3176
49 Ga0068867_100104177 3300005459 Bacteria 2171
50 Ga0070706_100084925 3300005467 Bacteria 2933
51 Ga0070698_100286746 3300005471 Bacteria 1578
52 Ga0070698_100830447 3300005471 Bacteria 869
53 Ga0070699_100032009 3300005518 Bacteria 4541
54 Ga0070699_100200396 3300005518 Bacteria 1775
55 Ga0070679_100819179 3300005530 Bacteria 874
56 Ga0070684_100139073 3300005535 Bacteria 2195
57 Ga0070697_100240728 3300005536 Bacteria 1545
58 Ga0068853_100235859 3300005539 Bacteria 1675
59 Ga0070672_100925695 3300005543 Bacteria 771
60 Ga0070695_100105534 3300005545 Bacteria 1904
61 Ga0070665_100017378 3300005548 Bacteria 7220
62 Ga0070665_100046108 3300005548 Bacteria 4378
63 Ga0070665_100660283 3300005548 Bacteria 1059
64 Ga0068855_100082379 3300005563 Bacteria 3729
65 Ga0068855_100130468 3300005563 Bacteria 2871
66 Ga0068855_100202065 3300005563 Bacteria 2237
67 Ga0068855_100854516 3300005563 Bacteria 964
68 Ga0070664_100054805 3300005564 Bacteria 3384
69 Ga0070664_100112402 3300005564 Bacteria 2379
70 Ga0068857_100651978 3300005577 Bacteria 998
71 Ga0068856_100024412 3300005614 Bacteria 5885
72 Ga0068856_100109945 3300005614 Bacteria 2753
73 Ga0070702_100076103 3300005615 Bacteria 1997
74 Ga0068852_100077425 3300005616 Bacteria 2940
75 Ga0068852_100515236 3300005616 Bacteria 1193
76 Ga0068859_100076630 3300005617 Bacteria 3385
77 Ga0068859_100137442 3300005617 Bacteria 2517
78 Ga0068864_100078595 3300005618 Bacteria 2888
79 Ga0068864_100541153 3300005618 Bacteria 1124
80 Ga0068866_10051230 3300005718 Bacteria 2100
81 Ga0068861_100130823 3300005719 Bacteria 2037
82 Ga0068861_100380356 3300005719 Bacteria 1247
83 Ga0068870_10032638 3300005840 Bacteria 2650
84 Ga0068863_100099960 3300005841 Bacteria 2757
85 Ga0068863_100123010 3300005841 Bacteria 2475
86 Ga0068863_100152778 3300005841 Bacteria 2209
87 Ga0068858_100145271 3300005842 Bacteria 2227
88 Ga0068860_100099235 3300005843 Bacteria 2778
89 Ga0068860_100107777 3300005843 Bacteria 2662
90 Ga0068860_100773627 3300005843 Bacteria 973
91 Ga0068862_100001533 3300005844 Bacteria 21121
92 Ga0081455_10018423 3300005937 Bacteria 6653
93 Ga0070717_10024248 3300006028 Bacteria 4815
94 Ga0070717_10322330 3300006028 Bacteria 1377
95 Ga0075364_10138192 3300006051 Bacteria 1638
96 Ga0097621_100074951 3300006237 Bacteria 2803
97 Ga0097621_100122781 3300006237 Bacteria 2204
98 Ga0068871_100010041 3300006358 Bacteria 6884
99 Ga0068871_100472498 3300006358 Bacteria 1127
100 Ga0075428_100000086 3300006844 Bacteria 77110
101 Ga0075428_100377064 3300006844 Bacteria 1521
102 Ga0075430_100000028 3300006846 Bacteria 74712
103 Ga0075430_100149440 3300006846 Bacteria 1945
104 Ga0075430_100293409 3300006846 Bacteria 1345
105 Ga0075431_100002556 3300006847 Bacteria 17557
106 Ga0075431_100168759 3300006847 Bacteria 2249
107 Ga0075431_100231690 3300006847 Bacteria 1881
108 Ga0075431_100792646 3300006847 Bacteria 921
109 Ga0075433_10184613 3300006852 Bacteria 1855
110 Ga0075429_100043206 3300006880 Bacteria 3922
111 Ga0075429_100304350 3300006880 Bacteria 1396
112 Ga0068865_100004448 3300006881 Bacteria 8453
113 Ga0068865_100071133 3300006881 Bacteria 2466
114 Ga0075436_100104708 3300006914 Bacteria 1972
115 Ga0097620_100076628 3300006931 Bacteria 3385
116 Ga0097620_100137444 3300006931 Bacteria 2517
117 Ga0075435_100058538 3300007076 Bacteria 3121
118 Ga0105251_10167034 3300009011 Bacteria 991
119 Ga0105240_10006710 3300009093 Bacteria 16864
120 Ga0105240_10059721 3300009093 Bacteria 4758
121 Ga0105240_10253255 3300009093 Bacteria 2035
122 Ga0111539_10000166 3300009094 Bacteria 76156
123 Ga0111539_10162086 3300009094 Bacteria 2615
124 Ga0111539_10559243 3300009094 Bacteria 1332
125 Ga0111539_10631454 3300009094 Bacteria 1247
126 Ga0105245_10032444 3300009098 Bacteria 4624
127 Ga0105247_10006247 3300009101 Bacteria 7388
128 Ga0105247_10432517 3300009101 Bacteria 945
129 Ga0114129_10000148 3300009147 Bacteria 74039
130 Ga0114129_10015571 3300009147 Bacteria 10810
131 Ga0114129_10045979 3300009147 Bacteria 6135
132 Ga0114129_10430927 3300009147 Bacteria 1733
133 Ga0105242_10077293 3300009176 Bacteria 2777
134 Ga0105242_10158553 3300009176 Bacteria 1979
135 Ga0105242_10449384 3300009176 Bacteria 1214
136 Ga0105242_10766594 3300009176 Bacteria 951
137 Ga0105248_10005840 3300009177 Bacteria 13528
138 Ga0105248_10007216 3300009177 Bacteria 12192
139 Ga0105248_10008141 3300009177 Bacteria 11510
140 Ga0105248_10311456 3300009177 Bacteria 1773
141 Ga0105248_10797059 3300009177 Bacteria 1066
142 Ga0105237_10014985 3300009545 Bacteria 8079
143 Ga0105237_10098887 3300009545 Bacteria 2909
144 Ga0105238_10102032 3300009551 Bacteria 2851
145 Ga0105249_10119508 3300009553 Bacteria 2503
146 Ga0105239_10356510 3300010375 Bacteria 1651
147 Ga0157370_10193003 3300013104 Bacteria 1890
148 Ga0157370_10213244 3300013104 Bacteria 1789
149 Ga0157369_10036186 3300013105 Bacteria 5410
150 Ga0157369_10063056 3300013105 Bacteria 3994
151 Ga0157369_10369414 3300013105 Bacteria 1489
152 Ga0157369_10402488 3300013105 Bacteria 1420
153 Ga0157374_10975487 3300013296 Bacteria 866
154 Ga0163162_10094250 3300013306 Bacteria 3080
155 Ga0157372_10028293 3300013307 Bacteria 6117
156 Ga0157372_10258599 3300013307 Bacteria 2021
157 Ga0157372_10604408 3300013307 Bacteria 1278
158 Ga0157375_11518941 3300013308 Bacteria 791
159 Ga0163163_10061782 3300014325 Bacteria 3712
160 Ga0163163_10084459 3300014325 Bacteria 3181
161 Ga0157377_10165291 3300014745 Bacteria 1379
162 Ga0157379_10009196 3300014968 Bacteria 8606
163 Ga0157379_10038998 3300014968 Bacteria 4238
164 Ga0157379_10152597 3300014968 Bacteria 2084
165 Ga0157376_10027798 3300014969 Bacteria 4489
166 Ga0163161_10106662 3300017792 Bacteria 2091
167 Ga0197907_10009712 3300020069 Bacteria 838
168 Ga0197907_10859286 3300020069 Bacteria 2159
169 Ga0197907_10944230 3300020069 Bacteria 783
170 Ga0197907_11361374 3300020069 Bacteria 932
171 Ga0206356_10064439 3300020070 Bacteria 947
172 Ga0206356_10076381 3300020070 Bacteria 912
173 Ga0206356_11357793 3300020070 Bacteria 712
174 Ga0206349_1119537 3300020075 Bacteria 713
175 Ga0206349_1292317 3300020075 Bacteria 895
176 Ga0206355_1165588 3300020076 Bacteria 731
177 Ga0206355_1589848 3300020076 Bacteria 1204
178 Ga0206351_10100007 3300020077 Bacteria 661
179 Ga0206351_10334331 3300020077 Bacteria 710
180 Ga0206352_10116104 3300020078 Bacteria 680
181 Ga0206352_10726661 3300020078 Bacteria 668
182 Ga0206350_10097771 3300020080 Bacteria 941
183 Ga0206350_10472793 3300020080 Bacteria 710
184 Ga0206350_10703862 3300020080 Bacteria 827
185 Ga0206350_10940339 3300020080 Bacteria 862
186 Ga0206354_10543553 3300020081 Bacteria 951
187 Ga0206354_10666411 3300020081 Bacteria 711
188 Ga0206353_11460749 3300020082 Bacteria 693
189 Ga0154015_1063369 3300020610 Bacteria 726
190 Ga0154015_1585089 3300020610 Bacteria 714
191 Ga0213876_10014747 3300021384 Bacteria 4141
192 Ga0213875_10012340 3300021388 Bacteria 4226
193 Ga0213875_10052109 3300021388 Bacteria 1916
194 Ga0224712_10018737 3300022467 Bacteria 2320
195 Ga0224712_10193622 3300022467 Bacteria 921
196 Ga0224712_10327154 3300022467 Bacteria 721
197 Ga0207642_10145603 3300025899 Bacteria 1255
198 Ga0207710_10050671 3300025900 Bacteria 1863
199 Ga0207688_10607535 3300025901 Bacteria 689
200 Ga0207680_10218528 3300025903 Bacteria 1305
201 Ga0207680_10256499 3300025903 Bacteria 1209
202 Ga0207699_10284860 3300025906 Bacteria 1149
203 Ga0207643_10094057 3300025908 Bacteria 1750
204 Ga0207684_10153320 3300025910 Bacteria 1983
205 Ga0207654_10192446 3300025911 Bacteria 1338
206 Ga0207707_10425414 3300025912 Bacteria 1138
207 Ga0207695_10067420 3300025913 Bacteria 3671
208 Ga0207695_10145229 3300025913 Bacteria 2317
209 Ga0207695_10198123 3300025913 Bacteria 1923
210 Ga0207695_10356335 3300025913 Bacteria 1350
211 Ga0207671_10000014 3300025914 Bacteria 461481
212 Ga0207671_10179268 3300025914 Bacteria 1648
213 Ga0207660_10398751 3300025917 Bacteria 1108
214 Ga0207662_10132990 3300025918 Bacteria 1570
215 Ga0207657_10226458 3300025919 Bacteria 1496
216 Ga0207657_10334913 3300025919 Bacteria 1195
217 Ga0207657_10377986 3300025919 Bacteria 1116
218 Ga0207649_10546683 3300025920 Bacteria 885
219 Ga0207652_10725472 3300025921 Bacteria 886
220 Ga0207694_10083433 3300025924 Bacteria 2513
221 Ga0207650_10505929 3300025925 Bacteria 1010
222 Ga0207650_10959862 3300025925 Bacteria 727
223 Ga0207687_10265585 3300025927 Bacteria 1370
224 Ga0207700_10016389 3300025928 Bacteria 4922
225 Ga0207700_10817365 3300025928 Bacteria 834
226 Ga0207664_10010224 3300025929 Bacteria 6626
227 Ga0207644_10248952 3300025931 Bacteria 1417
228 Ga0207644_10275163 3300025931 Bacteria 1350
229 Ga0207706_10237533 3300025933 Bacteria 1593
230 Ga0207686_10095364 3300025934 Bacteria 1974
231 Ga0207686_10104974 3300025934 Bacteria 1894
232 Ga0207709_10335413 3300025935 Bacteria 1136
233 Ga0207670_10069798 3300025936 Bacteria 2425
234 Ga0207670_10689674 3300025936 Bacteria 845
235 Ga0207669_10454483 3300025937 Bacteria 1016
236 Ga0207669_10828558 3300025937 Bacteria 769
237 Ga0207704_10120793 3300025938 Bacteria 1793
238 Ga0207711_10003755 3300025941 Bacteria 13081
239 Ga0207711_10031597 3300025941 Bacteria 4471
240 Ga0207711_10092798 3300025941 Bacteria 2658
241 Ga0207711_10206618 3300025941 Bacteria 1793
242 Ga0207689_10150630 3300025942 Bacteria 1917
243 Ga0207689_10449377 3300025942 Bacteria 1077
244 Ga0207679_10231536 3300025945 Bacteria 1560
245 Ga0207679_10653856 3300025945 Bacteria 951
246 Ga0207667_10062008 3300025949 Bacteria 3911
247 Ga0207667_10328881 3300025949 Bacteria 1560
248 Ga0207651_10534127 3300025960 Bacteria 1018
249 Ga0207712_10076503 3300025961 Bacteria 2423
250 Ga0207668_10879278 3300025972 Bacteria 797
251 Ga0207677_10439421 3300026023 Bacteria 1115
252 Ga0207703_10063242 3300026035 Bacteria 3034
253 Ga0207703_10069505 3300026035 Bacteria 2904
254 Ga0207703_10895054 3300026035 Bacteria 850
255 Ga0207708_10464680 3300026075 Bacteria 1056
256 Ga0207702_10260618 3300026078 Bacteria 1632
257 Ga0207641_10000431 3300026088 Bacteria 48383
258 Ga0207641_10049875 3300026088 Bacteria 3539
259 Ga0207641_10308127 3300026088 Bacteria 1498
260 Ga0207648_10046080 3300026089 Bacteria 3823
261 Ga0207648_10504841 3300026089 Bacteria 1107
262 Ga0207648_10690100 3300026089 Bacteria 946
263 Ga0207676_10608329 3300026095 Bacteria 1050
264 Ga0207674_10594913 3300026116 Bacteria 1068
265 Ga0207675_100148412 3300026118 Bacteria 2231
266 Ga0207675_100239807 3300026118 Bacteria 1752
267 Ga0207683_10309178 3300026121 Bacteria 1447
268 Ga0207698_10462767 3300026142 Bacteria 1227
269 Ga0209999_1004313 3300027543 Bacteria 2561
270 Ga0209998_10013211 3300027717 Bacteria 1718
271 Ga0209974_10002498 3300027876 Bacteria 6656
272 Ga0207428_10000251 3300027907 Bacteria 73186
273 Ga0207428_10049608 3300027907 Bacteria 3362
274 Ga0207428_10350299 3300027907 Bacteria 1086
275 Ga0265357_1011164 3300028023 Bacteria 912
276 Ga0268266_10023052 3300028379 Bacteria 5299
277 Ga0268266_10045377 3300028379 Bacteria 3760
278 Ga0268265_10005741 3300028380 Bacteria 8472
279 Ga0268265_10227742 3300028380 Bacteria 1636
280 Ga0268264_10110664 3300028381 Bacteria 2405
281 Ga0265338_10397095 3300028800 Bacteria 984
282 Ga0265762_1006265 3300030760 Bacteria 2131
283 Ga0307408_100009815 3300031548 Bacteria 6309
284 Ga0307408_100037371 3300031548 Bacteria 3420
285 Ga0307408_100083440 3300031548 Bacteria 2394
286 Ga0307405_10030512 3300031731 Bacteria 3162
287 Ga0307405_10483022 3300031731 Bacteria 989
288 Ga0307413_10166015 3300031824 Bacteria 1557
289 Ga0307410_10097771 3300031852 Bacteria 2098
290 Ga0307410_10332722 3300031852 Bacteria 1208
291 Ga0307406_10671897 3300031901 Bacteria 862
292 Ga0307407_10155701 3300031903 Bacteria 1490
293 Ga0307407_10594098 3300031903 Bacteria 823
294 Ga0307412_10187186 3300031911 Bacteria 1562
295 Ga0307409_100291065 3300031995 Bacteria 1515
296 Ga0307416_100006748 3300032002 Bacteria 7218
297 Ga0307416_100028702 3300032002 Bacteria 4143
298 Ga0307416_100101529 3300032002 Bacteria 2505
299 Ga0307416_100292714 3300032002 Bacteria 1613
300 Ga0307416_100538280 3300032002 Bacteria 1239
301 Ga0307411_10113017 3300032005 Bacteria 1948
302 Ga0307411_10494836 3300032005 Bacteria 1032
303 Ga0307415_100318874 3300032126 Bacteria 1295
304 Ga0307415_100580089 3300032126 Bacteria 994
305 Ga0316593_10234493 3300032168 Bacteria 684
306 Ga0373958_0039432 3300034819 Bacteria 960
307 Ga0373944_0092944 3300035089 Bacteria 1010
308 Ga0373952_0099779 3300035092 Bacteria 765
309 Ga0373936_0222060 3300035113 Bacteria 838
310 Ga0373945_0095938 3300035116 Bacteria 1155
311 Ga0373954_0301977 3300035118 Bacteria 790
312 Ga0373943_0409143 3300035170 Bacteria 784
313 Ga0373946_0054459 3300035171 Bacteria 1684
314 Ga0373946_0065859 3300035171 Bacteria 1552
315 Ga0373962_0019411 3300035242 Bacteria 1778
316 Ga0373931_0377941 3300035691 Bacteria 892
317 Ga0373927_0000552 3300035695 Bacteria 28516
318 Ga0373947_0267151 3300035725 Bacteria 1135
319 Ga0373947_0300220 3300035725 Bacteria 1071
320 Ga0373937_0955559 3300036401 Bacteria 806
321 Ga0265778_020135 3300036457 Bacteria 819
322 Ga0373925_0225766 3300037068 Bacteria 1496
323 Ga0373925_0403599 3300037068 Bacteria 1115
324 Ga0373925_0778839 3300037068 Bacteria 789
325 Ga0395905_0010290 3300037471 Bacteria 9106
326 Ga0436364_0305164 3300037853 Bacteria 13203
327 Ga0436364_0867121 3300037853 Bacteria 1243
328 Ga0436364_1091719 3300037853 Bacteria 4646
329 Ga0436365_0767090 3300039437 Bacteria 11651
330 Ga0451802_0086641 3300041460 Bacteria 1107
331 Ga0439441_004453 3300042001 Bacteria 2125
332 Ga0439448_0138727 3300042005 Bacteria 841
333 Ga0439435_0041457 3300042436 Bacteria 1290
334 Ga0439464_0000301 3300042439 Bacteria 9392
335 Ga0451577_0001463 3300042876 Bacteria 31346
336 Ga0453683_0004648 3300044673 Bacteria 9687
337 Ga0466964_0200826 3300044706 Bacteria 957
338 Ga0453684_0000324 3300044712 Bacteria 201431
339 Ga0466957_0109780 3300044842 Bacteria 1748
340 Ga0466957_0298777 3300044842 Bacteria 1081
341 Ga0466959_0020720 3300045049 Bacteria 4845
342 Ga0466959_0055775 3300045049 Bacteria 2884
343 Ga0451576_0019003 3300045051 Bacteria 7508
344 Ga0451576_0536984 3300045051 Bacteria 1229
345 Ga0466958_0056126 3300045836 Bacteria 2392
346 Ga0466958_0113299 3300045836 Bacteria 1694
347 Ga0466967_1046237 3300045976 Bacteria 813
348 Ga0495662_0232856 3300046476 Bacteria 908
349 Ga0495664_0093746 3300046477 Bacteria 1807
350 Ga0495628_0018272 3300046516 Bacteria 5812
351 Ga0495643_0000016 3300046522 Bacteria 313579
352 Ga0495645_0010425 3300046543 Bacteria 6513
353 Ga0495635_0191922 3300046663 Bacteria 1387
354 Ga0495635_0256009 3300046663 Bacteria 1179
355 Ga0495623_0020653 3300046679 Bacteria 4257
356 Ga0495646_0347484 3300046680 Bacteria 778
357 Ga0495647_0013207 3300046681 Bacteria 2858
358 Ga0495658_0265000 3300046683 Bacteria 1082
359 Ga0495604_0555440 3300047317 Bacteria 740
360 Ga0495674_0288415 3300047319 Bacteria 1343
361 Ga0495676_0157657 3300047321 Bacteria 1609
362 Ga0495684_0239068 3300047471 Bacteria 1325
363 Ga0496101_0082063 3300048904 Bacteria 2386
364 Ga0496104_0052271 3300048907 Bacteria 3859
365 Ga0496105_0232078 3300048908 Bacteria 1499
366 Ga0496106_0334681 3300048909 Bacteria 1215
367 Ga0496108_0004433 3300048911 Bacteria 11301
368 Ga0496108_0182514 3300048911 Bacteria 1817
369 Ga0496108_0585910 3300048911 Bacteria 972
370 Ga0496109_0290791 3300048912 Bacteria 1540
371 Ga0496110_0422496 3300048913 Bacteria 1215
372 Ga0496111_0916585 3300048914 Bacteria 631
373 Ga0496112_0005771 3300048915 Bacteria 10767
374 Ga0496112_0008688 3300048915 Bacteria 9108
375 Ga0496113_0119253 3300048916 Bacteria 2061
376 Ga0496114_0051441 3300048917 Bacteria 3430
377 Ga0496114_0266579 3300048917 Bacteria 1509
378 Ga0501299_005645 3300049522 Bacteria 1932
379 Ga0501031_0081232 3300049568 Bacteria 2113
380 Ga0501031_0408831 3300049568 Bacteria 878
381 Ga0501032_0096265 3300049569 Bacteria 1962
382 Ga0501033_0022820 3300049570 Bacteria 4718
383 Ga0501034_0054629 3300049571 Bacteria 4020
384 Ga0501034_0657950 3300049571 Bacteria 949
385 Ga0501036_0052168 3300049572 Bacteria 3464
386 Ga0501036_0166564 3300049572 Bacteria 1857
387 Ga0501037_0004407 3300049573 Bacteria 10227
388 Ga0501037_0030519 3300049573 Bacteria 3983
389 Ga0501038_0045992 3300049574 Bacteria 3786
390 Ga0501039_0261078 3300049575 Bacteria 1361
391 Ga0501040_0135776 3300049576 Bacteria 1732
392 Ga0501041_0548737 3300049577 Bacteria 736
393 Ga0501042_0204941 3300049578 Bacteria 1422
394 Ga0501042_0400690 3300049578 Bacteria 994
395 Ga0501043_0242222 3300049579 Bacteria 1391
396 Ga0501046_0081713 3300049580 Bacteria 2495
397 Ga0501047_0122491 3300049581 Bacteria 2481
398 Ga0501048_0079885 3300049582 Bacteria 2308
399 Ga0501071_1286949 3300049587 Bacteria 565
400 Ga0501072_0128314 3300049588 Bacteria 2021
401 Ga0501073_0083930 3300049589 Bacteria 2216
402 Ga0501073_0189448 3300049589 Bacteria 1423
403 Ga0501075_0045075 3300049591 Bacteria 3310
404 Ga0501075_0057731 3300049591 Bacteria 2922
405 Ga0501075_0899566 3300049591 Bacteria 673
406 Ga0501076_0408389 3300049592 Bacteria 1117
407 Ga0501235_011300 3300049669 Bacteria 1957
408 Ga0501242_027528 3300049674 Bacteria 756
409 Ga0501249_124559 3300049679 Bacteria 631
410 Ga0501080_0047885 3300049742 Bacteria 3980
411 Ga0501081_0036713 3300049743 Bacteria 3342
412 Ga0501044_0534032 3300049823 Bacteria 1071
413 nmdc:mga05p37_100800_c1 3300050507 Bacteria 3557
414 nmdc:mga05p37_221_c1 3300050507 Bacteria 57542
415 nmdc:mga05p37_2609_c1 3300050507 Bacteria 20981
416 nmdc:mga05p37_357126_c1 3300050507 Bacteria 1719
417 nmdc:mga05p37_55812_c1 3300050507 Bacteria 4863
418 nmdc:mga09592_254084_c1 3300050508 Bacteria 1523
419 nmdc:mga09592_39781_c1 3300050508 Bacteria 3950
420 nmdc:mga0qj67_10030_c1 3300050509 Bacteria 7066
421 nmdc:mga0qj67_438056_c1 3300050509 Bacteria 1053
422 nmdc:mga06r32_23101_c1 3300050510 Bacteria 5754
423 nmdc:mga06r32_423739_c1 3300050510 Bacteria 1312
424 nmdc:mga08y16_13158_c1 3300050511 Bacteria 8705
425 nmdc:mga08y16_690310_c1 3300050511 Bacteria 1022
426 nmdc:mga08y16_743486_c1 3300050511 Bacteria 977
427 nmdc:mga08y16_85677_c1 3300050511 Bacteria 3284
428 nmdc:mga0rr50_380486_c1 3300050513 Bacteria 1190
429 nmdc:mga08x19_283782_c1 3300050514 Bacteria 1148
430 nmdc:mga08x19_80356_c1 3300050514 Bacteria 2139
431 nmdc:mga0a205_103917_c1 3300050515 Bacteria 2740
432 Ga0495612_0069383 3300053078 Bacteria 1468
433 Ga0495619_0203943 3300053085 Bacteria 1369
434 Ga0500646_0017397 3300053090 Bacteria 1885
435 Ga0500641_0039509 3300053096 Bacteria 1901
436 Ga0500658_0131929 3300053134 Bacteria 1115
437 Ga0501084_0783230 3300054114 Bacteria 803
438 Ga0587066_062786 3300059490 Bacteria 763
439 Ga0587070_089158 3300059491 Bacteria 691
440 Ga0587073_0033314 3300059492 Bacteria 1079
441 Ga0587073_0065283 3300059492 Bacteria 865
442 Ga0587073_0097839 3300059492 Bacteria 758
443 Ga0587082_069661 3300059504 Bacteria 712
444 Ga0587083_0091806 3300059505 Bacteria 742
445 Ga0587085_058415 3300059506 Bacteria 723
446 Ga0587088_049681 3300059508 Bacteria 817
447 Ga0587088_075278 3300059508 Bacteria 712
448 Ga0587090_037498 3300059510 Bacteria 839
449 Ga0587090_038616 3300059510 Bacteria 831
450 Ga0587091_060842 3300059511 Bacteria 802
451 Ga0587091_099496 3300059511 Bacteria 680
452 Ga0587094_038943 3300059513 Bacteria 767
453 Ga0587076_074511 3300059645 Bacteria 712
454 Ga0587079_091388 3300059647 Bacteria 713
455 Ga0587107_029224 3300059652 Bacteria 828
456 Ga0501082_0230136 3300060353 Bacteria 1613
457 Ga0501082_0624221 3300060353 Bacteria 943
458 Ga0530510_0081982 3300061734 Bacteria 2349

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_1286949 Ga0501071_1286949_40_537 164
2 3300036401 Ga0373937_0955559 Ga0373937_0955559_194_742 180
3 3300013104 Ga0157370_10213244 Ga0157370_102132441 182
4 3300005289 Ga0065704_10019943 Ga0065704_100199431 197
5 3300005295 Ga0065707_10009026 Ga0065707_100090263 197
6 3300005354 Ga0070675_100704688 Ga0070675_1007046882 197
7 3300005436 Ga0070713_100070211 Ga0070713_1000702112 197
8 3300005543 Ga0070672_100925695 Ga0070672_1009256952 197
9 3300006051 Ga0075364_10138192 Ga0075364_101381922 197
10 3300013308 Ga0157375_11518941 Ga0157375_115189411 197
11 3300014745 Ga0157377_10165291 Ga0157377_101652912 197
12 3300039437 Ga0436365_0767090 Ga0436365_0767090_9434_10033 197
13 3300005289 Ga0065704_10015880 Ga0065704_100158802 198
14 3300005335 Ga0070666_10426470 Ga0070666_104264701 198
15 3300005335 Ga0070666_10682042 Ga0070666_106820422 198
16 3300005340 Ga0070689_100234754 Ga0070689_1002347542 198
17 3300005340 Ga0070689_100265412 Ga0070689_1002654123 198
18 3300005340 Ga0070689_100426433 Ga0070689_1004264332 198
19 3300005340 Ga0070689_100507348 Ga0070689_1005073482 198
20 3300005343 Ga0070687_100480125 Ga0070687_1004801251 198
21 3300005353 Ga0070669_100032387 Ga0070669_1000323872 198
22 3300005355 Ga0070671_100018016 Ga0070671_1000180164 198
23 3300005365 Ga0070688_100512477 Ga0070688_1005124772 198
24 3300005366 Ga0070659_100568545 Ga0070659_1005685451 198
25 3300005367 Ga0070667_100701295 Ga0070667_1007012952 198
26 3300005458 Ga0070681_10082225 Ga0070681_100822255 198
27 3300005459 Ga0068867_100104177 Ga0068867_1001041772 198
28 3300005471 Ga0070698_100286746 Ga0070698_1002867462 198
29 3300005471 Ga0070698_100830447 Ga0070698_1008304471 198
30 3300005518 Ga0070699_100200396 Ga0070699_1002003961 198
31 3300005539 Ga0068853_100235859 Ga0068853_1002358592 198
32 3300005548 Ga0070665_100046108 Ga0070665_1000461083 198
33 3300005548 Ga0070665_100660283 Ga0070665_1006602832 198
34 3300005563 Ga0068855_100202065 Ga0068855_1002020652 198
35 3300005564 Ga0070664_100054805 Ga0070664_1000548053 198
36 3300005564 Ga0070664_100112402 Ga0070664_1001124021 198
37 3300005577 Ga0068857_100651978 Ga0068857_1006519782 198
38 3300005615 Ga0070702_100076103 Ga0070702_1000761032 198
39 3300005616 Ga0068852_100515236 Ga0068852_1005152362 198
40 3300005617 Ga0068859_100137442 Ga0068859_1001374422 198
41 3300005618 Ga0068864_100541153 Ga0068864_1005411532 198
42 3300005718 Ga0068866_10051230 Ga0068866_100512302 198
43 3300005841 Ga0068863_100123010 Ga0068863_1001230102 198
44 3300005841 Ga0068863_100152778 Ga0068863_1001527783 198
45 3300005842 Ga0068858_100145271 Ga0068858_1001452711 198
46 3300005843 Ga0068860_100107777 Ga0068860_1001077772 198
47 3300005843 Ga0068860_100773627 Ga0068860_1007736272 198
48 3300005844 Ga0068862_100001533 Ga0068862_1000015336 198
49 3300005937 Ga0081455_10018423 Ga0081455_100184236 198
50 3300006237 Ga0097621_100074951 Ga0097621_1000749513 198
51 3300006237 Ga0097621_100122781 Ga0097621_1001227811 198
52 3300006358 Ga0068871_100010041 Ga0068871_1000100416 198
53 3300006844 Ga0075428_100000086 Ga0075428_10000008666 198
54 3300006844 Ga0075428_100377064 Ga0075428_1003770642 198
55 3300006846 Ga0075430_100000028 Ga0075430_10000002869 198
56 3300006846 Ga0075430_100149440 Ga0075430_1001494401 198
57 3300006846 Ga0075430_100293409 Ga0075430_1002934091 198
58 3300006847 Ga0075431_100002556 Ga0075431_1000025564 198
59 3300006847 Ga0075431_100168759 Ga0075431_1001687592 198
60 3300006847 Ga0075431_100231690 Ga0075431_1002316902 198
61 3300006847 Ga0075431_100792646 Ga0075431_1007926461 198
62 3300006852 Ga0075433_10184613 Ga0075433_101846132 198
63 3300006880 Ga0075429_100043206 Ga0075429_1000432062 198
64 3300006881 Ga0068865_100004448 Ga0068865_1000044487 198
65 3300006931 Ga0097620_100137444 Ga0097620_1001374442 198
66 3300009011 Ga0105251_10167034 Ga0105251_101670342 198
67 3300009093 Ga0105240_10006710 Ga0105240_1000671019 198
68 3300009093 Ga0105240_10059721 Ga0105240_100597211 198
69 3300009093 Ga0105240_10253255 Ga0105240_102532552 198
70 3300009094 Ga0111539_10000166 Ga0111539_100001669 198
71 3300009094 Ga0111539_10162086 Ga0111539_101620862 198
72 3300009094 Ga0111539_10559243 Ga0111539_105592432 198
73 3300009094 Ga0111539_10631454 Ga0111539_106314541 198
74 3300009101 Ga0105247_10006247 Ga0105247_100062473 198
75 3300009101 Ga0105247_10432517 Ga0105247_104325171 198
76 3300009147 Ga0114129_10000148 Ga0114129_100001489 198
77 3300009147 Ga0114129_10015571 Ga0114129_100155712 198
78 3300009147 Ga0114129_10045979 Ga0114129_100459792 198
79 3300009147 Ga0114129_10430927 Ga0114129_104309271 198
80 3300009176 Ga0105242_10158553 Ga0105242_101585532 198
81 3300009176 Ga0105242_10766594 Ga0105242_107665942 198
82 3300009177 Ga0105248_10005840 Ga0105248_100058406 198
83 3300009177 Ga0105248_10007216 Ga0105248_100072162 198
84 3300009545 Ga0105237_10014985 Ga0105237_1001498512 198
85 3300009551 Ga0105238_10102032 Ga0105238_101020324 198
86 3300013105 Ga0157369_10063056 Ga0157369_100630563 198
87 3300013307 Ga0157372_10258599 Ga0157372_102585992 198
88 3300013307 Ga0157372_10604408 Ga0157372_106044082 198
89 3300014325 Ga0163163_10084459 Ga0163163_100844591 198
90 3300014968 Ga0157379_10009196 Ga0157379_100091966 198
91 3300014968 Ga0157379_10038998 Ga0157379_100389985 198
92 3300014968 Ga0157379_10152597 Ga0157379_101525972 198
93 3300014969 Ga0157376_10027798 Ga0157376_100277983 198
94 3300025900 Ga0207710_10050671 Ga0207710_100506712 198
95 3300025901 Ga0207688_10607535 Ga0207688_106075351 198
96 3300025903 Ga0207680_10218528 Ga0207680_102185281 198
97 3300025912 Ga0207707_10425414 Ga0207707_104254142 198
98 3300025913 Ga0207695_10067420 Ga0207695_100674206 198
99 3300025913 Ga0207695_10198123 Ga0207695_101981232 198
100 3300025913 Ga0207695_10356335 Ga0207695_103563352 198
101 3300025914 Ga0207671_10000014 Ga0207671_10000014290 198
102 3300025918 Ga0207662_10132990 Ga0207662_101329901 198
103 3300025919 Ga0207657_10226458 Ga0207657_102264581 198
104 3300025919 Ga0207657_10377986 Ga0207657_103779862 198
105 3300025920 Ga0207649_10546683 Ga0207649_105466831 198
106 3300025924 Ga0207694_10083433 Ga0207694_100834332 198
107 3300025925 Ga0207650_10959862 Ga0207650_109598622 198
108 3300025931 Ga0207644_10275163 Ga0207644_102751632 198
109 3300025934 Ga0207686_10095364 Ga0207686_100953642 198
110 3300025935 Ga0207709_10335413 Ga0207709_103354132 198
111 3300025936 Ga0207670_10069798 Ga0207670_100697982 198
112 3300025941 Ga0207711_10003755 Ga0207711_100037555 198
113 3300025941 Ga0207711_10031597 Ga0207711_100315974 198
114 3300025941 Ga0207711_10206618 Ga0207711_102066182 198
115 3300025942 Ga0207689_10150630 Ga0207689_101506302 198
116 3300025945 Ga0207679_10231536 Ga0207679_102315361 198
117 3300025945 Ga0207679_10653856 Ga0207679_106538561 198
118 3300025949 Ga0207667_10328881 Ga0207667_103288812 198
119 3300025972 Ga0207668_10879278 Ga0207668_108792781 198
120 3300026035 Ga0207703_10063242 Ga0207703_100632421 198
121 3300026035 Ga0207703_10069505 Ga0207703_100695052 198
122 3300026088 Ga0207641_10000431 Ga0207641_1000043140 198
123 3300026088 Ga0207641_10308127 Ga0207641_103081272 198
124 3300026089 Ga0207648_10504841 Ga0207648_105048411 198
125 3300026089 Ga0207648_10690100 Ga0207648_106901002 198
126 3300026095 Ga0207676_10608329 Ga0207676_106083292 198
127 3300026116 Ga0207674_10594913 Ga0207674_105949132 198
128 3300026121 Ga0207683_10309178 Ga0207683_103091781 198
129 3300027907 Ga0207428_10000251 Ga0207428_100002519 198
130 3300027907 Ga0207428_10049608 Ga0207428_100496083 198
131 3300028379 Ga0268266_10045377 Ga0268266_100453773 198
132 3300028380 Ga0268265_10005741 Ga0268265_100057416 198
133 3300028381 Ga0268264_10110664 Ga0268264_101106642 198
134 3300031548 Ga0307408_100009815 Ga0307408_1000098152 198
135 3300031548 Ga0307408_100037371 Ga0307408_1000373712 198
136 3300031548 Ga0307408_100083440 Ga0307408_1000834403 198
137 3300031731 Ga0307405_10030512 Ga0307405_100305123 198
138 3300031731 Ga0307405_10483022 Ga0307405_104830221 198
139 3300031824 Ga0307413_10166015 Ga0307413_101660152 198
140 3300031852 Ga0307410_10097771 Ga0307410_100977714 198
141 3300031901 Ga0307406_10671897 Ga0307406_106718972 198
142 3300031903 Ga0307407_10594098 Ga0307407_105940981 198
143 3300031911 Ga0307412_10187186 Ga0307412_101871863 198
144 3300031995 Ga0307409_100291065 Ga0307409_1002910652 198
145 3300032002 Ga0307416_100006748 Ga0307416_1000067484 198
146 3300032002 Ga0307416_100028702 Ga0307416_1000287022 198
147 3300032002 Ga0307416_100101529 Ga0307416_1001015292 198
148 3300032005 Ga0307411_10494836 Ga0307411_104948362 198
149 3300032126 Ga0307415_100318874 Ga0307415_1003188742 198
150 3300032126 Ga0307415_100580089 Ga0307415_1005800892 198
151 3300034819 Ga0373958_0039432 Ga0373958_0039432_283_882 198
152 3300035089 Ga0373944_0092944 Ga0373944_0092944_274_873 198
153 3300035092 Ga0373952_0099779 Ga0373952_0099779_119_718 198
154 3300035113 Ga0373936_0222060 Ga0373936_0222060_208_807 198
155 3300035116 Ga0373945_0095938 Ga0373945_0095938_64_663 198
156 3300035118 Ga0373954_0301977 Ga0373954_0301977_142_741 198
157 3300035170 Ga0373943_0409143 Ga0373943_0409143_31_630 198
158 3300035171 Ga0373946_0054459 Ga0373946_0054459_255_854 198
159 3300035171 Ga0373946_0065859 Ga0373946_0065859_355_954 198
160 3300035242 Ga0373962_0019411 Ga0373962_0019411_421_1020 198
161 3300035691 Ga0373931_0377941 Ga0373931_0377941_89_688 198
162 3300035725 Ga0373947_0267151 Ga0373947_0267151_175_774 198
163 3300035725 Ga0373947_0300220 Ga0373947_0300220_227_907 198
164 3300037068 Ga0373925_0225766 Ga0373925_0225766_326_925 198
165 3300037068 Ga0373925_0403599 Ga0373925_0403599_494_1093 198
166 3300042001 Ga0439441_004453 Ga0439441_004453_209_808 198
167 3300042439 Ga0439464_0000301 Ga0439464_0000301_6014_6613 198
168 3300046476 Ga0495662_0232856 Ga0495662_0232856_260_859 198
169 3300046477 Ga0495664_0093746 Ga0495664_0093746_1192_1791 198
170 3300046543 Ga0495645_0010425 Ga0495645_0010425_5187_5786 198
171 3300046663 Ga0495635_0191922 Ga0495635_0191922_659_1339 198
172 3300046663 Ga0495635_0256009 Ga0495635_0256009_62_661 198
173 3300046681 Ga0495647_0013207 Ga0495647_0013207_1202_1801 198
174 3300046683 Ga0495658_0265000 Ga0495658_0265000_313_993 198
175 3300047319 Ga0495674_0288415 Ga0495674_0288415_92_691 198
176 3300047321 Ga0495676_0157657 Ga0495676_0157657_707_1306 198
177 3300047471 Ga0495684_0239068 Ga0495684_0239068_676_1275 198
178 3300048911 Ga0496108_0004433 Ga0496108_0004433_10468_11067 198
179 3300048911 Ga0496108_0585910 Ga0496108_0585910_255_854 198
180 3300048913 Ga0496110_0422496 Ga0496110_0422496_422_1021 198
181 3300048914 Ga0496111_0916585 Ga0496111_0916585_14_613 198
182 3300048915 Ga0496112_0005771 Ga0496112_0005771_7800_8399 198
183 3300048917 Ga0496114_0051441 Ga0496114_0051441_2398_2997 198
184 3300048917 Ga0496114_0266579 Ga0496114_0266579_86_685 198
185 3300049522 Ga0501299_005645 Ga0501299_005645_334_933 198
186 3300049669 Ga0501235_011300 Ga0501235_011300_571_1170 198
187 3300049674 Ga0501242_027528 Ga0501242_027528_117_716 198
188 3300049679 Ga0501249_124559 Ga0501249_124559_11_610 198
189 3300050507 nmdc:mga05p37_100800_c1 nmdc:mga05p37_100800_c1_1725_2324 198
190 3300050507 nmdc:mga05p37_221_c1 nmdc:mga05p37_221_c1_8435_9034 198
191 3300050507 nmdc:mga05p37_2609_c1 nmdc:mga05p37_2609_c1_2800_3399 198
192 3300050507 nmdc:mga05p37_357126_c1 nmdc:mga05p37_357126_c1_208_807 198
193 3300050507 nmdc:mga05p37_55812_c1 nmdc:mga05p37_55812_c1_917_1516 198
194 3300050508 nmdc:mga09592_254084_c1 nmdc:mga09592_254084_c1_18_617 198
195 3300050508 nmdc:mga09592_39781_c1 nmdc:mga09592_39781_c1_2268_2867 198
196 3300050509 nmdc:mga0qj67_10030_c1 nmdc:mga0qj67_10030_c1_3305_3904 198
197 3300050509 nmdc:mga0qj67_438056_c1 nmdc:mga0qj67_438056_c1_116_715 198
198 3300050510 nmdc:mga06r32_23101_c1 nmdc:mga06r32_23101_c1_652_1251 198
199 3300050510 nmdc:mga06r32_423739_c1 nmdc:mga06r32_423739_c1_156_755 198
200 3300050511 nmdc:mga08y16_13158_c1 nmdc:mga08y16_13158_c1_3829_4428 198
201 3300050511 nmdc:mga08y16_690310_c1 nmdc:mga08y16_690310_c1_277_876 198
202 3300050515 nmdc:mga0a205_103917_c1 nmdc:mga0a205_103917_c1_1167_1766 198
203 3300053085 Ga0495619_0203943 Ga0495619_0203943_347_1027 198
204 3300053134 Ga0500658_0131929 Ga0500658_0131929_91_690 198
205 iso_pu_bacteria 8057632132 8057634774 198
206 3300005290 Ga0065712_10084370 Ga0065712_100843703 199
207 3300005293 Ga0065715_10003953 Ga0065715_100039535 199
208 3300005331 Ga0070670_100030212 Ga0070670_1000302123 199
209 3300005353 Ga0070669_100236440 Ga0070669_1002364402 199
210 3300005354 Ga0070675_100015752 Ga0070675_1000157522 199
211 3300005354 Ga0070675_100785736 Ga0070675_1007857361 199
212 3300005356 Ga0070674_100111358 Ga0070674_1001113582 199
213 3300005356 Ga0070674_100538314 Ga0070674_1005383141 199
214 3300005365 Ga0070688_100052634 Ga0070688_1000526342 199
215 3300005365 Ga0070688_100715258 Ga0070688_1007152581 199
216 3300005441 Ga0070700_100256044 Ga0070700_1002560441 199
217 3300005457 Ga0070662_100301055 Ga0070662_1003010553 199
218 3300005548 Ga0070665_100017378 Ga0070665_1000173786 199
219 3300005616 Ga0068852_100077425 Ga0068852_1000774252 199
220 3300005617 Ga0068859_100076630 Ga0068859_1000766302 199
221 3300005618 Ga0068864_100078595 Ga0068864_1000785954 199
222 3300005719 Ga0068861_100130823 Ga0068861_1001308232 199
223 3300005719 Ga0068861_100380356 Ga0068861_1003803561 199
224 3300005840 Ga0068870_10032638 Ga0068870_100326381 199
225 3300005841 Ga0068863_100099960 Ga0068863_1000999602 199
226 3300005843 Ga0068860_100099235 Ga0068860_1000992352 199
227 3300006358 Ga0068871_100472498 Ga0068871_1004724981 199
228 3300006881 Ga0068865_100071133 Ga0068865_1000711334 199
229 3300006931 Ga0097620_100076628 Ga0097620_1000766284 199
230 3300009098 Ga0105245_10032444 Ga0105245_100324443 199
231 3300009176 Ga0105242_10077293 Ga0105242_100772934 199
232 3300009176 Ga0105242_10449384 Ga0105242_104493842 199
233 3300009177 Ga0105248_10008141 Ga0105248_100081417 199
234 3300009177 Ga0105248_10311456 Ga0105248_103114562 199
235 3300009553 Ga0105249_10119508 Ga0105249_101195082 199
236 3300010375 Ga0105239_10356510 Ga0105239_103565102 199
237 3300013104 Ga0157370_10193003 Ga0157370_101930032 199
238 3300013306 Ga0163162_10094250 Ga0163162_100942503 199
239 3300014325 Ga0163163_10061782 Ga0163163_100617822 199
240 3300017792 Ga0163161_10106662 Ga0163161_101066622 199
241 3300025899 Ga0207642_10145603 Ga0207642_101456031 199
242 3300025903 Ga0207680_10256499 Ga0207680_102564992 199
243 3300025908 Ga0207643_10094057 Ga0207643_100940571 199
244 3300025919 Ga0207657_10334913 Ga0207657_103349133 199
245 3300025925 Ga0207650_10505929 Ga0207650_105059292 199
246 3300025927 Ga0207687_10265585 Ga0207687_102655851 199
247 3300025931 Ga0207644_10248952 Ga0207644_102489521 199
248 3300025933 Ga0207706_10237533 Ga0207706_102375334 199
249 3300025934 Ga0207686_10104974 Ga0207686_101049742 199
250 3300025936 Ga0207670_10689674 Ga0207670_106896741 199
251 3300025937 Ga0207669_10454483 Ga0207669_104544832 199
252 3300025937 Ga0207669_10828558 Ga0207669_108285582 199
253 3300025938 Ga0207704_10120793 Ga0207704_101207932 199
254 3300025941 Ga0207711_10092798 Ga0207711_100927982 199
255 3300025942 Ga0207689_10449377 Ga0207689_104493771 199
256 3300025960 Ga0207651_10534127 Ga0207651_105341272 199
257 3300025961 Ga0207712_10076503 Ga0207712_100765032 199
258 3300026035 Ga0207703_10895054 Ga0207703_108950541 199
259 3300026075 Ga0207708_10464680 Ga0207708_104646802 199
260 3300026088 Ga0207641_10049875 Ga0207641_100498754 199
261 3300026089 Ga0207648_10046080 Ga0207648_100460803 199
262 3300026118 Ga0207675_100148412 Ga0207675_1001484123 199
263 3300026118 Ga0207675_100239807 Ga0207675_1002398072 199
264 3300026142 Ga0207698_10462767 Ga0207698_104627672 199
265 3300027907 Ga0207428_10350299 Ga0207428_103502992 199
266 3300028379 Ga0268266_10023052 Ga0268266_100230526 199
267 3300028380 Ga0268265_10227742 Ga0268265_102277422 199
268 3300031852 Ga0307410_10332722 Ga0307410_103327222 199
269 3300031903 Ga0307407_10155701 Ga0307407_101557012 199
270 3300032002 Ga0307416_100538280 Ga0307416_1005382802 199
271 3300032005 Ga0307411_10113017 Ga0307411_101130172 199
272 3300041460 Ga0451802_0086641 Ga0451802_0086641_290_892 199
273 3300042436 Ga0439435_0041457 Ga0439435_0041457_26_628 199
274 3300048904 Ga0496101_0082063 Ga0496101_0082063_1223_1825 199
275 3300048907 Ga0496104_0052271 Ga0496104_0052271_924_1526 199
276 3300048908 Ga0496105_0232078 Ga0496105_0232078_576_1178 199
277 3300048909 Ga0496106_0334681 Ga0496106_0334681_255_857 199
278 3300048911 Ga0496108_0182514 Ga0496108_0182514_648_1250 199
279 3300048912 Ga0496109_0290791 Ga0496109_0290791_473_1075 199
280 3300048915 Ga0496112_0008688 Ga0496112_0008688_434_1036 199
281 3300048916 Ga0496113_0119253 Ga0496113_0119253_879_1481 199
282 3300049568 Ga0501031_0408831 Ga0501031_0408831_202_804 199
283 3300049569 Ga0501032_0096265 Ga0501032_0096265_645_1247 199
284 3300049570 Ga0501033_0022820 Ga0501033_0022820_2485_3087 199
285 3300049571 Ga0501034_0054629 Ga0501034_0054629_475_1077 199
286 3300049572 Ga0501036_0166564 Ga0501036_0166564_43_645 199
287 3300049573 Ga0501037_0030519 Ga0501037_0030519_2853_3455 199
288 3300049575 Ga0501039_0261078 Ga0501039_0261078_19_621 199
289 3300049578 Ga0501042_0400690 Ga0501042_0400690_307_909 199
290 3300049580 Ga0501046_0081713 Ga0501046_0081713_579_1181 199
291 3300049581 Ga0501047_0122491 Ga0501047_0122491_1154_1756 199
292 3300049589 Ga0501073_0083930 Ga0501073_0083930_411_1013 199
293 3300049589 Ga0501073_0189448 Ga0501073_0189448_741_1343 199
294 3300049591 Ga0501075_0045075 Ga0501075_0045075_68_679 199
295 3300049591 Ga0501075_0899566 Ga0501075_0899566_24_626 199
296 3300049592 Ga0501076_0408389 Ga0501076_0408389_133_744 199
297 3300049823 Ga0501044_0534032 Ga0501044_0534032_19_621 199
298 3300050511 nmdc:mga08y16_743486_c1 nmdc:mga08y16_743486_c1_230_832 199
299 3300050511 nmdc:mga08y16_85677_c1 nmdc:mga08y16_85677_c1_1753_2355 199
300 3300053090 Ga0500646_0017397 Ga0500646_0017397_965_1567 199
301 3300053096 Ga0500641_0039509 Ga0500641_0039509_927_1529 199
302 3300054114 Ga0501084_0783230 Ga0501084_0783230_166_777 199
303 3300060353 Ga0501082_0624221 Ga0501082_0624221_21_623 199
304 3300005444 Ga0070694_100179016 Ga0070694_1001790161 200
305 3300005444 Ga0070694_100371855 Ga0070694_1003718552 200
306 3300005518 Ga0070699_100032009 Ga0070699_1000320095 200
307 3300006914 Ga0075436_100104708 Ga0075436_1001047082 200
308 3300007076 Ga0075435_100058538 Ga0075435_1000585382 200
309 3300020070 Ga0206356_10064439 Ga0206356_100644391 200
310 3300020077 Ga0206351_10100007 Ga0206351_101000071 200
311 3300020610 Ga0154015_1063369 Ga0154015_10633691 200
312 3300020610 Ga0154015_1585089 Ga0154015_15850891 200
313 3300022467 Ga0224712_10018737 Ga0224712_100187371 200
314 3300037068 Ga0373925_0778839 Ga0373925_0778839_149_754 200
315 3300050513 nmdc:mga0rr50_380486_c1 nmdc:mga0rr50_380486_c1_124_729 200
316 3300050514 nmdc:mga08x19_283782_c1 nmdc:mga08x19_283782_c1_323_928 200
317 3300059511 Ga0587091_099496 Ga0587091_099496_21_629 200
318 3300003371 JGI26145J50221_1008472 JGI26145J50221_10084721 201
319 3300004799 Ga0058863_11588021 Ga0058863_115880211 201
320 3300005329 Ga0070683_100122332 Ga0070683_1001223322 201
321 3300005336 Ga0070680_100370315 Ga0070680_1003703152 201
322 3300005434 Ga0070709_10094221 Ga0070709_100942212 201
323 3300005530 Ga0070679_100819179 Ga0070679_1008191792 201
324 3300005536 Ga0070697_100240728 Ga0070697_1002407281 201
325 3300005545 Ga0070695_100105534 Ga0070695_1001055342 201
326 3300005563 Ga0068855_100130468 Ga0068855_1001304683 201
327 3300006880 Ga0075429_100304350 Ga0075429_1003043502 201
328 3300009177 Ga0105248_10797059 Ga0105248_107970591 201
329 3300009545 Ga0105237_10098887 Ga0105237_100988872 201
330 3300013105 Ga0157369_10369414 Ga0157369_103694142 201
331 3300013296 Ga0157374_10975487 Ga0157374_109754872 201
332 3300020069 Ga0197907_10859286 Ga0197907_108592861 201
333 3300020076 Ga0206355_1589848 Ga0206355_15898481 201
334 3300020080 Ga0206350_10703862 Ga0206350_107038621 201
335 3300021384 Ga0213876_10014747 Ga0213876_100147473 201
336 3300021388 Ga0213875_10012340 Ga0213875_100123402 201
337 3300021388 Ga0213875_10052109 Ga0213875_100521092 201
338 3300025906 Ga0207699_10284860 Ga0207699_102848601 201
339 3300025910 Ga0207684_10153320 Ga0207684_101533202 201
340 3300025914 Ga0207671_10179268 Ga0207671_101792682 201
341 3300025917 Ga0207660_10398751 Ga0207660_103987511 201
342 3300025921 Ga0207652_10725472 Ga0207652_107254721 201
343 3300026023 Ga0207677_10439421 Ga0207677_104394212 201
344 3300027543 Ga0209999_1004313 Ga0209999_10043135 201
345 3300027717 Ga0209998_10013211 Ga0209998_100132112 201
346 3300027876 Ga0209974_10002498 Ga0209974_100024981 201
347 3300028800 Ga0265338_10397095 Ga0265338_103970952 201
348 3300032168 Ga0316593_10234493 Ga0316593_102344931 201
349 3300037471 Ga0395905_0010290 Ga0395905_0010290_1661_2269 201
350 3300037853 Ga0436364_0305164 Ga0436364_0305164_1228_1839 201
351 3300037853 Ga0436364_0867121 Ga0436364_0867121_236_847 201
352 3300037853 Ga0436364_1091719 Ga0436364_1091719_1222_1836 201
353 3300042005 Ga0439448_0138727 Ga0439448_0138727_156_779 201
354 3300044673 Ga0453683_0004648 Ga0453683_0004648_1252_1905 201
355 3300045051 Ga0451576_0536984 Ga0451576_0536984_439_1050 201
356 3300045836 Ga0466958_0056126 Ga0466958_0056126_62_727 201
357 3300045976 Ga0466967_1046237 Ga0466967_1046237_148_762 201
358 3300046679 Ga0495623_0020653 Ga0495623_0020653_3615_4241 201
359 3300049568 Ga0501031_0081232 Ga0501031_0081232_451_1059 201
360 3300049572 Ga0501036_0052168 Ga0501036_0052168_143_751 201
361 3300049574 Ga0501038_0045992 Ga0501038_0045992_3077_3685 201
362 3300049576 Ga0501040_0135776 Ga0501040_0135776_771_1379 201
363 3300049577 Ga0501041_0548737 Ga0501041_0548737_56_667 201
364 3300049578 Ga0501042_0204941 Ga0501042_0204941_451_1059 201
365 3300049579 Ga0501043_0242222 Ga0501043_0242222_422_1030 201
366 3300049582 Ga0501048_0079885 Ga0501048_0079885_777_1385 201
367 3300049591 Ga0501075_0057731 Ga0501075_0057731_2274_2882 201
368 3300049742 Ga0501080_0047885 Ga0501080_0047885_2080_2688 201
369 3300049743 Ga0501081_0036713 Ga0501081_0036713_1260_1868 201
370 3300059490 Ga0587066_062786 Ga0587066_062786_104_715 201
371 3300059491 Ga0587070_089158 Ga0587070_089158_55_666 201
372 3300059492 Ga0587073_0033314 Ga0587073_0033314_96_710 201
373 3300059492 Ga0587073_0065283 Ga0587073_0065283_226_840 201
374 3300059492 Ga0587073_0097839 Ga0587073_0097839_98_709 201
375 3300059504 Ga0587082_069661 Ga0587082_069661_50_661 201
376 3300059505 Ga0587083_0091806 Ga0587083_0091806_48_659 201
377 3300059506 Ga0587085_058415 Ga0587085_058415_65_676 201
378 3300059508 Ga0587088_049681 Ga0587088_049681_18_632 201
379 3300059508 Ga0587088_075278 Ga0587088_075278_47_658 201
380 3300059510 Ga0587090_038616 Ga0587090_038616_188_802 201
381 3300059511 Ga0587091_060842 Ga0587091_060842_86_700 201
382 3300059513 Ga0587094_038943 Ga0587094_038943_105_716 201
383 3300059645 Ga0587076_074511 Ga0587076_074511_50_661 201
384 3300059647 Ga0587079_091388 Ga0587079_091388_51_662 201
385 3300059652 Ga0587107_029224 Ga0587107_029224_68_679 201
386 3300060353 Ga0501082_0230136 Ga0501082_0230136_876_1484 201
387 3300061734 Ga0530510_0081982 Ga0530510_0081982_63_671 201
388 3300003161 Ga0006765J45826_114789 Ga0006765J45826_1147891 202
389 3300003162 Ga0006778J45830_1067745 Ga0006778J45830_10677451 202
390 3300003574 Ga0007410J51695_1066582 Ga0007410J51695_10665821 202
391 3300003579 Ga0007429J51699_1034974 Ga0007429J51699_10349741 202
392 3300004798 Ga0058859_11304566 Ga0058859_113045661 202
393 3300004803 Ga0058862_12888305 Ga0058862_128883051 202
394 3300005435 Ga0070714_100014046 Ga0070714_1000140464 202
395 3300005435 Ga0070714_101066680 Ga0070714_1010666802 202
396 3300005436 Ga0070713_100027943 Ga0070713_1000279433 202
397 3300005436 Ga0070713_100556871 Ga0070713_1005568711 202
398 3300005436 Ga0070713_100896586 Ga0070713_1008965861 202
399 3300005467 Ga0070706_100084925 Ga0070706_1000849253 202
400 3300005535 Ga0070684_100139073 Ga0070684_1001390731 202
401 3300005563 Ga0068855_100082379 Ga0068855_1000823792 202
402 3300005563 Ga0068855_100854516 Ga0068855_1008545161 202
403 3300005614 Ga0068856_100024412 Ga0068856_1000244122 202
404 3300005614 Ga0068856_100109945 Ga0068856_1001099453 202
405 3300006028 Ga0070717_10024248 Ga0070717_100242482 202
406 3300006028 Ga0070717_10322330 Ga0070717_103223301 202
407 3300013105 Ga0157369_10036186 Ga0157369_100361863 202
408 3300013105 Ga0157369_10402488 Ga0157369_104024882 202
409 3300013307 Ga0157372_10028293 Ga0157372_100282932 202
410 3300020069 Ga0197907_10009712 Ga0197907_100097121 202
411 3300020069 Ga0197907_10944230 Ga0197907_109442301 202
412 3300020069 Ga0197907_11361374 Ga0197907_113613741 202
413 3300020070 Ga0206356_10076381 Ga0206356_100763811 202
414 3300020070 Ga0206356_11357793 Ga0206356_113577931 202
415 3300020075 Ga0206349_1119537 Ga0206349_11195371 202
416 3300020075 Ga0206349_1292317 Ga0206349_12923171 202
417 3300020076 Ga0206355_1165588 Ga0206355_11655881 202
418 3300020077 Ga0206351_10334331 Ga0206351_103343311 202
419 3300020078 Ga0206352_10116104 Ga0206352_101161041 202
420 3300020078 Ga0206352_10726661 Ga0206352_107266611 202
421 3300020080 Ga0206350_10097771 Ga0206350_100977711 202
422 3300020080 Ga0206350_10472793 Ga0206350_104727931 202
423 3300020080 Ga0206350_10940339 Ga0206350_109403391 202
424 3300020081 Ga0206354_10543553 Ga0206354_105435531 202
425 3300020081 Ga0206354_10666411 Ga0206354_106664111 202
426 3300020082 Ga0206353_11460749 Ga0206353_114607491 202
427 3300022467 Ga0224712_10193622 Ga0224712_101936221 202
428 3300022467 Ga0224712_10327154 Ga0224712_103271541 202
429 3300025911 Ga0207654_10192446 Ga0207654_101924462 202
430 3300025913 Ga0207695_10145229 Ga0207695_101452292 202
431 3300025928 Ga0207700_10016389 Ga0207700_100163894 202
432 3300025928 Ga0207700_10817365 Ga0207700_108173651 202
433 3300025929 Ga0207664_10010224 Ga0207664_100102244 202
434 3300025949 Ga0207667_10062008 Ga0207667_100620084 202
435 3300026078 Ga0207702_10260618 Ga0207702_102606181 202
436 3300028023 Ga0265357_1011164 Ga0265357_10111641 202
437 3300030760 Ga0265762_1006265 Ga0265762_10062652 202
438 3300032002 Ga0307416_100292714 Ga0307416_1002927143 202
439 3300035695 Ga0373927_0000552 Ga0373927_0000552_14938_15552 202
440 3300036457 Ga0265778_020135 Ga0265778_020135_115_765 202
441 3300042876 Ga0451577_0001463 Ga0451577_0001463_6844_7464 202
442 3300044706 Ga0466964_0200826 Ga0466964_0200826_33_653 202
443 3300044712 Ga0453684_0000324 Ga0453684_0000324_108222_108842 202
444 3300044842 Ga0466957_0109780 Ga0466957_0109780_314_928 202
445 3300044842 Ga0466957_0298777 Ga0466957_0298777_392_1012 202
446 3300045049 Ga0466959_0020720 Ga0466959_0020720_1379_1999 202
447 3300045049 Ga0466959_0055775 Ga0466959_0055775_569_1189 202
448 3300045051 Ga0451576_0019003 Ga0451576_0019003_5393_6013 202
449 3300045836 Ga0466958_0113299 Ga0466958_0113299_479_1099 202
450 3300046516 Ga0495628_0018272 Ga0495628_0018272_1733_2494 202
451 3300046522 Ga0495643_0000016 Ga0495643_0000016_153771_154394 202
452 3300046680 Ga0495646_0347484 Ga0495646_0347484_143_763 202
453 3300047317 Ga0495604_0555440 Ga0495604_0555440_95_715 202
454 3300049571 Ga0501034_0657950 Ga0501034_0657950_42_653 202
455 3300049573 Ga0501037_0004407 Ga0501037_0004407_9584_10198 202
456 3300049588 Ga0501072_0128314 Ga0501072_0128314_46_657 202
457 3300050514 nmdc:mga08x19_80356_c1 nmdc:mga08x19_80356_c1_614_1234 202
458 3300053078 Ga0495612_0069383 Ga0495612_0069383_622_1242 202
459 3300059510 Ga0587090_037498 Ga0587090_037498_10_654 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

47

135

0.96

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

142

242

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.991 3 200
2rcv-assembly2.cif.gz_H crystal structure of the bacillus subtilis superoxide dismutase 0.9862 3 200
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.986 3 200
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9842 3 200
6ex3-assembly1.cif.gz_A staphylococcus aureus superoxide dismutase soda 0.9831 3 200
ID Description Score Start End Superfamily
2ce4B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9953 20 88 1.10.287.990
6ex3A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9937 20 89 1.10.287.990
2rcvD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9926 20 89 1.10.287.990
2cdyC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9921 20 88 1.10.287.990
3kkyB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9916 20 88 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A085DR24-F1-model_v4 deleted 0.9937 101 201
AF-A0A7X9DGD8-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9925 95 201 GO:0004784
GO:0005737
GO:0046872
AF-A0A3C0K592-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9918 1 200 GO:0004784
GO:0005737
GO:0046872
AF-A0A1H6FXA6-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9911 1 201 GO:0004784
GO:0005737
GO:0046872
AF-A0A2N2PMT9-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9911 2 199 GO:0004784
GO:0005737
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map