F448392

General Info

Members Datasets Scaffolds Average Seq Length
459 173 918 191

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0532385|Ga0395900_0532385_325_1023
Length 222
Sequence MQISPQRVEAPRRDRNEQIRLVKRIVAALARLYLPWSMLNDRSSILSLLQTRRSAKPRELVGPGPTRDELERILTMAVRVPDHGKLHPWRLVTVAEDQRDALGAIFRQALADEDECAPFAKHEKADEFAHYAGQLIVLISAPIQGHKIPVWEQELSCGAVGMNLLLAATAVGYYSERVRRAFCSPGERIAGFIFIGQPSRELEERPRAALAEVWTEWQPPKP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.49
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0532385 3300037418 Bacteria 1121
2 MBSR1b_contig_8406955 2162886012 Bacteria 870
3 JGI24737J22298_10000375 3300001990 Bacteria 15198
4 JGI24737J22298_10043662 3300001990 Bacteria 1372
5 JGI24735J21928_10001012 3300002067 Bacteria 10051
6 JGI24735J21928_10035902 3300002067 Bacteria 1455
7 JGI24738J21930_10000224 3300002075 Bacteria 15326
8 rootH1_10071154 3300003323 Bacteria 1203
9 Ga0070658_10000260 3300005327 Bacteria 46341
10 Ga0070658_10085478 3300005327 Bacteria 2594
11 Ga0070658_10575902 3300005327 Unclassified 975
12 Ga0070658_10779429 3300005327 Bacteria 830
13 Ga0070676_10050722 3300005328 Bacteria 2434
14 Ga0070683_100001828 3300005329 Bacteria 16590
15 Ga0070683_100022444 3300005329 Bacteria 5641
16 Ga0070683_100955949 3300005329 Unclassified 822
17 Ga0070670_100015597 3300005331 Bacteria 6526
18 Ga0070670_100645950 3300005331 Bacteria 949
19 Ga0070666_10004011 3300005335 Bacteria 8937
20 Ga0070666_10006224 3300005335 Bacteria 7341
21 Ga0070666_10301435 3300005335 Bacteria 1141
22 Ga0070680_100008734 3300005336 Bacteria 7769
23 Ga0070680_100038411 3300005336 Bacteria 3872
24 Ga0070680_100044886 3300005336 Bacteria 3592
25 Ga0068868_100012499 3300005338 Bacteria 6207
26 Ga0068868_100012713 3300005338 Bacteria 6157
27 Ga0070660_100003134 3300005339 Bacteria 11362
28 Ga0070660_100004919 3300005339 Bacteria 9241
29 Ga0070660_100007487 3300005339 Bacteria 7611
30 Ga0070660_100013902 3300005339 Bacteria 5790
31 Ga0070660_100025557 3300005339 Bacteria 4390
32 Ga0070660_100063481 3300005339 Bacteria 2872
33 Ga0070660_100481507 3300005339 Bacteria 1031
34 Ga0070689_100061990 3300005340 Bacteria 2909
35 Ga0070691_10146710 3300005341 Bacteria 1206
36 Ga0070661_100000439 3300005344 Bacteria 31883
37 Ga0070661_100034097 3300005344 Bacteria 3691
38 Ga0070661_100133248 3300005344 Bacteria 1868
39 Ga0070661_100220857 3300005344 Bacteria 1453
40 Ga0070661_100275641 3300005344 Bacteria 1304
41 Ga0070661_100335449 3300005344 Bacteria 1183
42 Ga0070669_100325299 3300005353 Bacteria 1242
43 Ga0070675_100339557 3300005354 Bacteria 1330
44 Ga0070671_100011132 3300005355 Bacteria 7225
45 Ga0070671_100027431 3300005355 Bacteria 4689
46 Ga0070671_100073746 3300005355 Bacteria 2851
47 Ga0070671_100309938 3300005355 Bacteria 1344
48 Ga0070671_100458809 3300005355 Bacteria 1094
49 Ga0070671_101193097 3300005355 Unclassified 670
50 Ga0070674_100008921 3300005356 Bacteria 5989
51 Ga0070674_100074545 3300005356 Bacteria 2408
52 Ga0070674_100102064 3300005356 Bacteria 2091
53 Ga0070674_100286955 3300005356 Bacteria 1307
54 Ga0070674_100646998 3300005356 Bacteria 898
55 Ga0070674_101116546 3300005356 Bacteria 697
56 Ga0070673_100039610 3300005364 Bacteria 3608
57 Ga0070673_100125636 3300005364 Bacteria 2146
58 Ga0070688_100100888 3300005365 Bacteria 1903
59 Ga0070659_100000065 3300005366 Bacteria 82919
60 Ga0070659_100018472 3300005366 Bacteria 5262
61 Ga0070659_100031488 3300005366 Bacteria 4108
62 Ga0070659_100168810 3300005366 Bacteria 1791
63 Ga0070659_100184788 3300005366 Bacteria 1711
64 Ga0070667_100026784 3300005367 Bacteria 4797
65 Ga0070667_100347216 3300005367 Bacteria 1343
66 Ga0070714_100027275 3300005435 Bacteria 4728
67 Ga0070714_100467364 3300005435 Bacteria 1200
68 Ga0070713_100194429 3300005436 Bacteria 1829
69 Ga0070694_100053494 3300005444 Bacteria 2732
70 Ga0070663_100006864 3300005455 Bacteria 6890
71 Ga0070663_100019598 3300005455 Bacteria 4463
72 Ga0070663_100026675 3300005455 Bacteria 3915
73 Ga0070663_100126594 3300005455 Bacteria 1936
74 Ga0070678_100006946 3300005456 Bacteria 6679
75 Ga0070678_100068601 3300005456 Bacteria 2644
76 Ga0070662_100000010 3300005457 Bacteria 142717
77 Ga0070662_100008627 3300005457 Bacteria 6650
78 Ga0070662_100016183 3300005457 Bacteria 5004
79 Ga0070662_100132172 3300005457 Bacteria 1925
80 Ga0070681_10049284 3300005458 Bacteria 4207
81 Ga0070681_10082880 3300005458 Bacteria 3161
82 Ga0070681_10136481 3300005458 Bacteria 2384
83 Ga0068867_100042069 3300005459 Bacteria 3340
84 Ga0070679_100038907 3300005530 Bacteria 4729
85 Ga0070679_100039777 3300005530 Bacteria 4675
86 Ga0070679_100103627 3300005530 Bacteria 2831
87 Ga0070679_100293986 3300005530 Bacteria 1576
88 Ga0070684_100017032 3300005535 Bacteria 5956
89 Ga0070684_100057186 3300005535 Bacteria 3405
90 Ga0068853_100000396 3300005539 Bacteria 29782
91 Ga0068853_100079743 3300005539 Bacteria 2863
92 Ga0068853_100115443 3300005539 Bacteria 2389
93 Ga0068853_100284752 3300005539 Bacteria 1524
94 Ga0068853_100419502 3300005539 Bacteria 1255
95 Ga0068853_100523886 3300005539 Bacteria 1121
96 Ga0070672_100260762 3300005543 Bacteria 1462
97 Ga0070672_100322220 3300005543 Bacteria 1314
98 Ga0070672_100325767 3300005543 Bacteria 1306
99 Ga0070686_100180181 3300005544 Bacteria 1501
100 Ga0070665_100004913 3300005548 Bacteria 13867
101 Ga0070665_100181615 3300005548 Bacteria 2105
102 Ga0070665_100196172 3300005548 Bacteria 2020
103 Ga0070665_100330485 3300005548 Bacteria 1529
104 Ga0068855_100002953 3300005563 Bacteria 20778
105 Ga0068855_100004196 3300005563 Bacteria 17582
106 Ga0068855_100278914 3300005563 Bacteria 1856
107 Ga0068855_100280487 3300005563 Bacteria 1850
108 Ga0070664_100000992 3300005564 Bacteria 22212
109 Ga0070664_100126808 3300005564 Bacteria 2240
110 Ga0068857_100276689 3300005577 Bacteria 1543
111 Ga0068857_100279128 3300005577 Bacteria 1536
112 Ga0068857_101044585 3300005577 Bacteria 787
113 Ga0068857_101066487 3300005577 Bacteria 779
114 Ga0068854_100038840 3300005578 Bacteria 3350
115 Ga0068854_100123462 3300005578 Bacteria 1969
116 Ga0068854_100162655 3300005578 Bacteria 1730
117 Ga0068854_100203182 3300005578 Bacteria 1559
118 Ga0068854_100242241 3300005578 Bacteria 1436
119 Ga0068854_100250918 3300005578 Bacteria 1413
120 Ga0068856_100000101 3300005614 Bacteria 82391
121 Ga0068856_100006671 3300005614 Bacteria 11313
122 Ga0068856_100059824 3300005614 Bacteria 3763
123 Ga0068856_100072385 3300005614 Bacteria 3412
124 Ga0068856_100353060 3300005614 Bacteria 1489
125 Ga0068856_100718141 3300005614 Bacteria 1019
126 Ga0068856_100898644 3300005614 Unclassified 905
127 Ga0068852_100001142 3300005616 Bacteria 17566
128 Ga0068852_100009616 3300005616 Bacteria 7182
129 Ga0068852_100027136 3300005616 Bacteria 4663
130 Ga0068852_100146770 3300005616 Bacteria 2189
131 Ga0068852_100268617 3300005616 Bacteria 1640
132 Ga0068852_100277850 3300005616 Bacteria 1613
133 Ga0068852_100289289 3300005616 Bacteria 1582
134 Ga0068859_100030425 3300005617 Bacteria 5417
135 Ga0068859_100193110 3300005617 Bacteria 2120
136 Ga0068859_101284590 3300005617 Bacteria 806
137 Ga0068864_100001039 3300005618 Bacteria 23285
138 Ga0068864_100028520 3300005618 Bacteria 4719
139 Ga0068864_100040385 3300005618 Bacteria 3992
140 Ga0068864_100323132 3300005618 Bacteria 1450
141 Ga0068866_10084411 3300005718 Bacteria 1714
142 Ga0068851_10011222 3300005834 Bacteria 4197
143 Ga0068851_10066106 3300005834 Bacteria 1862
144 Ga0068851_10133417 3300005834 Bacteria 1345
145 Ga0068863_100022058 3300005841 Bacteria 6081
146 Ga0068858_100031902 3300005842 Bacteria 4895
147 Ga0068858_100329043 3300005842 Bacteria 1461
148 Ga0068860_100010737 3300005843 Bacteria 9043
149 Ga0068860_100182041 3300005843 Bacteria 2031
150 Ga0068862_100553746 3300005844 Bacteria 1098
151 Ga0068862_100555806 3300005844 Bacteria 1096
152 Ga0081539_10033538 3300005985 Bacteria 3123
153 Ga0097621_100017299 3300006237 Bacteria 5472
154 Ga0075431_100375759 3300006847 Bacteria 1426
155 Ga0097620_100030430 3300006931 Bacteria 5417
156 Ga0097620_100193101 3300006931 Bacteria 2120
157 Ga0097620_101284629 3300006931 Bacteria 806
158 Ga0097620_101284630 3300006931 Bacteria 806
159 Ga0105240_10036481 3300009093 Bacteria 6323
160 Ga0105247_10091559 3300009101 Bacteria 1931
161 Ga0105243_10181325 3300009148 Bacteria 1831
162 Ga0105243_10279096 3300009148 Bacteria 1504
163 Ga0105241_10010676 3300009174 Bacteria 6737
164 Ga0105242_10139702 3300009176 Bacteria 2101
165 Ga0105248_10001870 3300009177 Bacteria 23331
166 Ga0105248_10022148 3300009177 Bacteria 7043
167 Ga0105248_10654357 3300009177 Bacteria 1185
168 Ga0105248_11173763 3300009177 Bacteria 868
169 Ga0105237_10053768 3300009545 Bacteria 4038
170 Ga0105238_10006901 3300009551 Bacteria 11340
171 Ga0105238_10015895 3300009551 Bacteria 7615
172 Ga0105238_10035010 3300009551 Bacteria 5107
173 Ga0105249_10490850 3300009553 Bacteria 1272
174 Ga0105239_10130123 3300010375 Bacteria 2799
175 Ga0105246_10060154 3300011119 Bacteria 2638
176 Ga0105246_10110581 3300011119 Bacteria 2018
177 Ga0157373_10037784 3300013100 Bacteria 3460
178 Ga0157373_10706877 3300013100 Bacteria 739
179 Ga0157371_10001218 3300013102 Bacteria 27387
180 Ga0157371_10032159 3300013102 Bacteria 3776
181 Ga0157371_10145018 3300013102 Bacteria 1691
182 Ga0157370_10027882 3300013104 Bacteria 5564
183 Ga0157370_10029043 3300013104 Bacteria 5433
184 Ga0157370_10094415 3300013104 Bacteria 2806
185 Ga0157370_10123523 3300013104 Bacteria 2417
186 Ga0157369_10005567 3300013105 Bacteria 14622
187 Ga0157369_10010979 3300013105 Bacteria 10309
188 Ga0157369_10187606 3300013105 Bacteria 2174
189 Ga0157369_10374625 3300013105 Bacteria 1478
190 Ga0157369_10588919 3300013105 Bacteria 1148
191 Ga0157374_10728240 3300013296 Bacteria 1006
192 Ga0157374_11333688 3300013296 Unclassified 740
193 Ga0157378_10869236 3300013297 Unclassified 931
194 Ga0157372_10003113 3300013307 Bacteria 17884
195 Ga0157372_10093843 3300013307 Bacteria 3416
196 Ga0157372_10508393 3300013307 Bacteria 1405
197 Ga0157375_10153917 3300013308 Bacteria 2437
198 Ga0157375_10312496 3300013308 Bacteria 1736
199 Ga0163163_10000580 3300014325 Bacteria 32211
200 Ga0163163_10066705 3300014325 Bacteria 3575
201 Ga0163163_10473403 3300014325 Bacteria 1313
202 Ga0163163_10654124 3300014325 Bacteria 1114
203 Ga0157377_10518713 3300014745 Bacteria 836
204 Ga0157379_10140038 3300014968 Bacteria 2181
205 Ga0157376_10059707 3300014969 Bacteria 3198
206 Ga0213875_10028218 3300021388 Bacteria 2667
207 Ga0207697_10101259 3300025315 Bacteria 1228
208 Ga0207656_10006676 3300025321 Bacteria 4166
209 Ga0207642_10052178 3300025899 Bacteria 1854
210 Ga0207642_10076829 3300025899 Bacteria 1609
211 Ga0207688_10050221 3300025901 Bacteria 2334
212 Ga0207680_10001072 3300025903 Bacteria 12900
213 Ga0207680_10003153 3300025903 Bacteria 7741
214 Ga0207680_10102725 3300025903 Bacteria 1840
215 Ga0207680_10279842 3300025903 Bacteria 1159
216 Ga0207647_10002885 3300025904 Bacteria 12953
217 Ga0207647_10003379 3300025904 Bacteria 11970
218 Ga0207647_10014514 3300025904 Bacteria 5429
219 Ga0207647_10043790 3300025904 Bacteria 2799
220 Ga0207647_10144318 3300025904 Bacteria 1394
221 Ga0207647_10248870 3300025904 Bacteria 1020
222 Ga0207647_10467224 3300025904 Unclassified 706
223 Ga0207645_10061856 3300025907 Bacteria 2392
224 Ga0207705_10000113 3300025909 Bacteria 90567
225 Ga0207705_10000448 3300025909 Bacteria 35488
226 Ga0207705_10014604 3300025909 Bacteria 5651
227 Ga0207705_10084364 3300025909 Bacteria 2319
228 Ga0207705_10116247 3300025909 Bacteria 1980
229 Ga0207705_10123321 3300025909 Bacteria 1924
230 Ga0207705_10166339 3300025909 Bacteria 1659
231 Ga0207705_10195755 3300025909 Unclassified 1530
232 Ga0207705_10207902 3300025909 Bacteria 1484
233 Ga0207654_10004653 3300025911 Bacteria 6936
234 Ga0207654_10394649 3300025911 Bacteria 961
235 Ga0207707_10062699 3300025912 Bacteria 3235
236 Ga0207707_10110419 3300025912 Bacteria 2403
237 Ga0207695_10106072 3300025913 Bacteria 2796
238 Ga0207671_10120038 3300025914 Bacteria 2009
239 Ga0207660_10028808 3300025917 Bacteria 3802
240 Ga0207660_10104052 3300025917 Bacteria 2125
241 Ga0207657_10000026 3300025919 Bacteria 143118
242 Ga0207657_10000278 3300025919 Bacteria 54678
243 Ga0207657_10004865 3300025919 Bacteria 14135
244 Ga0207657_10014993 3300025919 Bacteria 7528
245 Ga0207657_10035525 3300025919 Bacteria 4468
246 Ga0207657_10041946 3300025919 Bacteria 4041
247 Ga0207657_10045167 3300025919 Bacteria 3869
248 Ga0207657_10066552 3300025919 Bacteria 3067
249 Ga0207657_10143023 3300025919 Bacteria 1953
250 Ga0207657_10356139 3300025919 Bacteria 1154
251 Ga0207649_10001918 3300025920 Bacteria 11872
252 Ga0207649_10029991 3300025920 Bacteria 3216
253 Ga0207649_10156100 3300025920 Bacteria 1577
254 Ga0207649_10179433 3300025920 Bacteria 1481
255 Ga0207649_10205147 3300025920 Bacteria 1395
256 Ga0207649_10240530 3300025920 Bacteria 1299
257 Ga0207649_10624870 3300025920 Bacteria 830
258 Ga0207652_10000465 3300025921 Bacteria 41540
259 Ga0207652_10073377 3300025921 Bacteria 2977
260 Ga0207652_10098868 3300025921 Bacteria 2574
261 Ga0207652_10136662 3300025921 Bacteria 2189
262 Ga0207652_10165254 3300025921 Bacteria 1984
263 Ga0207681_10250930 3300025923 Bacteria 1381
264 Ga0207694_10004638 3300025924 Bacteria 10697
265 Ga0207694_10025286 3300025924 Bacteria 4512
266 Ga0207650_10156298 3300025925 Bacteria 1803
267 Ga0207650_10168490 3300025925 Bacteria 1739
268 Ga0207659_10293386 3300025926 Bacteria 1333
269 Ga0207659_10329862 3300025926 Bacteria 1261
270 Ga0207700_10277387 3300025928 Bacteria 1441
271 Ga0207664_10035017 3300025929 Bacteria 3871
272 Ga0207664_10483469 3300025929 Bacteria 1108
273 Ga0207644_10000141 3300025931 Bacteria 51791
274 Ga0207644_10003740 3300025931 Bacteria 9861
275 Ga0207644_10010361 3300025931 Bacteria 6145
276 Ga0207644_10015650 3300025931 Bacteria 5095
277 Ga0207644_10153729 3300025931 Bacteria 1782
278 Ga0207690_10000036 3300025932 Bacteria 143853
279 Ga0207690_10031500 3300025932 Bacteria 3394
280 Ga0207690_10094847 3300025932 Bacteria 2118
281 Ga0207690_10107923 3300025932 Bacteria 2000
282 Ga0207690_10546134 3300025932 Bacteria 941
283 Ga0207706_10000031 3300025933 Bacteria 143109
284 Ga0207706_10002634 3300025933 Bacteria 17481
285 Ga0207706_10011975 3300025933 Bacteria 7899
286 Ga0207706_10102430 3300025933 Bacteria 2519
287 Ga0207686_10220908 3300025934 Bacteria 1368
288 Ga0207709_10381157 3300025935 Bacteria 1073
289 Ga0207709_10472394 3300025935 Bacteria 973
290 Ga0207669_10073461 3300025937 Bacteria 2158
291 Ga0207669_10095849 3300025937 Bacteria 1946
292 Ga0207669_10818872 3300025937 Bacteria 773
293 Ga0207691_10017617 3300025940 Bacteria 6768
294 Ga0207691_10052652 3300025940 Bacteria 3718
295 Ga0207691_10278180 3300025940 Bacteria 1440
296 Ga0207711_10000446 3300025941 Bacteria 43126
297 Ga0207711_10001681 3300025941 Bacteria 20384
298 Ga0207711_10036153 3300025941 Bacteria 4190
299 Ga0207711_10167183 3300025941 Bacteria 1994
300 Ga0207689_10048946 3300025942 Bacteria 3487
301 Ga0207689_10384176 3300025942 Bacteria 1169
302 Ga0207661_10006059 3300025944 Bacteria 8540
303 Ga0207661_10129633 3300025944 Bacteria 2158
304 Ga0207679_10000093 3300025945 Bacteria 78331
305 Ga0207679_10078640 3300025945 Bacteria 2513
306 Ga0207667_10019103 3300025949 Bacteria 7662
307 Ga0207667_10029924 3300025949 Bacteria 5898
308 Ga0207667_10035974 3300025949 Bacteria 5310
309 Ga0207667_10077408 3300025949 Bacteria 3450
310 Ga0207667_10105343 3300025949 Bacteria 2909
311 Ga0207651_10584603 3300025960 Bacteria 974
312 Ga0207640_10005614 3300025981 Bacteria 6840
313 Ga0207640_10007355 3300025981 Bacteria 6080
314 Ga0207640_10033692 3300025981 Bacteria 3190
315 Ga0207640_10052479 3300025981 Bacteria 2656
316 Ga0207640_10131247 3300025981 Bacteria 1811
317 Ga0207640_10144154 3300025981 Bacteria 1740
318 Ga0207640_10197340 3300025981 Bacteria 1522
319 Ga0207677_10006971 3300026023 Bacteria 6215
320 Ga0207677_10011783 3300026023 Bacteria 4999
321 Ga0207677_10036236 3300026023 Bacteria 3213
322 Ga0207703_10003718 3300026035 Bacteria 12695
323 Ga0207703_10092208 3300026035 Bacteria 2549
324 Ga0207639_10001599 3300026041 Bacteria 15228
325 Ga0207639_10021314 3300026041 Bacteria 4653
326 Ga0207639_10030754 3300026041 Bacteria 3940
327 Ga0207639_10473977 3300026041 Bacteria 1140
328 Ga0207678_10000265 3300026067 Bacteria 47379
329 Ga0207678_10019169 3300026067 Bacteria 6006
330 Ga0207678_10044732 3300026067 Bacteria 3829
331 Ga0207678_10046433 3300026067 Bacteria 3755
332 Ga0207678_10061994 3300026067 Bacteria 3216
333 Ga0207702_10000353 3300026078 Bacteria 52560
334 Ga0207702_10032782 3300026078 Bacteria 4335
335 Ga0207702_10105742 3300026078 Bacteria 2493
336 Ga0207702_10563602 3300026078 Bacteria 1115
337 Ga0207702_11234698 3300026078 Unclassified 741
338 Ga0207641_10030826 3300026088 Bacteria 4444
339 Ga0207641_10205960 3300026088 Bacteria 1816
340 Ga0207641_10212315 3300026088 Bacteria 1790
341 Ga0207648_10027331 3300026089 Bacteria 5066
342 Ga0207648_10029038 3300026089 Bacteria 4904
343 Ga0207648_10178973 3300026089 Bacteria 1876
344 Ga0207676_10008600 3300026095 Bacteria 7253
345 Ga0207676_10016645 3300026095 Bacteria 5326
346 Ga0207676_10163729 3300026095 Bacteria 1930
347 Ga0207674_10016204 3300026116 Bacteria 8163
348 Ga0207674_10052413 3300026116 Bacteria 4161
349 Ga0207674_10658527 3300026116 Bacteria 1011
350 Ga0207683_10005837 3300026121 Bacteria 10555
351 Ga0207683_10089439 3300026121 Bacteria 2741
352 Ga0207698_10003104 3300026142 Bacteria 9965
353 Ga0207698_10007352 3300026142 Bacteria 6904
354 Ga0207698_10035439 3300026142 Bacteria 3650
355 Ga0207698_10062838 3300026142 Bacteria 2902
356 Ga0207698_10128258 3300026142 Bacteria 2162
357 Ga0268266_10027043 3300028379 Bacteria 4881
358 Ga0268266_10190142 3300028379 Bacteria 1874
359 Ga0268266_10193335 3300028379 Bacteria 1859
360 Ga0268265_10293942 3300028380 Bacteria 1459
361 Ga0268264_10001234 3300028381 Bacteria 24544
362 Ga0268264_10356690 3300028381 Bacteria 1393
363 Ga0268264_11267971 3300028381 Unclassified 747
364 Ga0316182_1389001 3300030745 Bacteria 1584
365 Ga0307405_10805552 3300031731 Bacteria 787
366 Ga0307413_10527114 3300031824 Bacteria 954
367 Ga0307410_10025269 3300031852 Bacteria 3724
368 Ga0307410_10412719 3300031852 Bacteria 1093
369 Ga0307406_10240881 3300031901 Bacteria 1357
370 Ga0307406_10470364 3300031901 Bacteria 1013
371 Ga0307409_100090321 3300031995 Bacteria 2507
372 Ga0307416_100142397 3300032002 Bacteria 2182
373 Ga0307414_10248599 3300032004 Bacteria 1477
374 Ga0373949_0049032 3300035090 Bacteria 1059
375 Ga0373960_0015845 3300035121 Bacteria 1930
376 Ga0373931_0013473 3300035691 Bacteria 3982
377 Ga0395899_0003429 3300037312 Bacteria 12571
378 Ga0395899_0029034 3300037312 Bacteria 4161
379 Ga0395899_0044258 3300037312 Bacteria 3318
380 Ga0395899_0053199 3300037312 Bacteria 2999
381 Ga0395899_0192668 3300037312 Bacteria 1426
382 Ga0395900_0005818 3300037418 Bacteria 12880
383 Ga0395900_0007745 3300037418 Bacteria 11080
384 Ga0395900_0017045 3300037418 Bacteria 7416
385 Ga0395900_0025891 3300037418 Bacteria 6005
386 Ga0395900_0062621 3300037418 Bacteria 3824
387 Ga0395900_0098976 3300037418 Bacteria 2996
388 Ga0395900_0135921 3300037418 Bacteria 2518
389 Ga0395900_0292412 3300037418 Bacteria 1617
390 Ga0395900_0424443 3300037418 Bacteria 1290
391 Ga0395898_0016676 3300037466 Bacteria 7508
392 Ga0395898_0022279 3300037466 Bacteria 6416
393 Ga0395898_0352118 3300037466 Unclassified 1404
394 Ga0395898_0528216 3300037466 Bacteria 1121
395 Ga0395898_1318009 3300037466 Bacteria 651
396 Ga0395905_0002782 3300037471 Bacteria 19152
397 Ga0395905_0004759 3300037471 Bacteria 14028
398 Ga0395905_0011289 3300037471 Bacteria 8635
399 Ga0395905_0028490 3300037471 Bacteria 5265
400 Ga0395905_0030537 3300037471 Bacteria 5076
401 Ga0395905_0035057 3300037471 Bacteria 4711
402 Ga0395905_0038639 3300037471 Bacteria 4478
403 Ga0395905_0082452 3300037471 Bacteria 3013
404 Ga0395905_0118998 3300037471 Bacteria 2483
405 Ga0395905_0210187 3300037471 Bacteria 1823
406 Ga0395905_0239519 3300037471 Bacteria 1695
407 Ga0395905_0363705 3300037471 Bacteria 1339
408 Ga0395905_0705880 3300037471 Bacteria 911
409 Ga0395905_0736094 3300037471 Bacteria 888
410 Ga0436364_0131873 3300037853 Bacteria 5530
411 Ga0395901_0000872 3300038443 Bacteria 33280
412 Ga0395901_0012625 3300038443 Bacteria 8571
413 Ga0395901_0045214 3300038443 Bacteria 4568
414 Ga0395901_0049545 3300038443 Bacteria 4365
415 Ga0395901_0098609 3300038443 Bacteria 3064
416 Ga0395901_0193264 3300038443 Bacteria 2134
417 Ga0395901_0202507 3300038443 Bacteria 2080
418 Ga0395901_0351289 3300038443 Bacteria 1521
419 Ga0395901_0373559 3300038443 Bacteria 1468
420 Ga0395901_0395372 3300038443 Bacteria 1421
421 Ga0395901_0409927 3300038443 Bacteria 1391
422 Ga0395901_0608224 3300038443 Bacteria 1101
423 Ga0466969_0158592 3300044656 Bacteria 1040
424 Ga0466966_0150365 3300044684 Bacteria 1420
425 Ga0466963_0034233 3300044694 Bacteria 3305
426 Ga0466963_0070444 3300044694 Bacteria 2352
427 Ga0466963_0304839 3300044694 Bacteria 1120
428 Ga0466964_0252646 3300044706 Bacteria 870
429 Ga0466971_0243516 3300044719 Bacteria 856
430 Ga0466957_0268716 3300044842 Bacteria 1138
431 Ga0466957_0289501 3300044842 Bacteria 1098
432 Ga0466960_0450508 3300044901 Unclassified 748
433 Ga0466959_0081692 3300045049 Bacteria 2329
434 Ga0466967_0275017 3300045976 Bacteria 1615
435 Ga0466967_0404797 3300045976 Bacteria 1328
436 Ga0466967_0470735 3300045976 Bacteria 1230
437 Ga0466967_0525314 3300045976 Bacteria 1163
438 Ga0495643_0201314 3300046522 Unclassified 956
439 Ga0495670_0216045 3300046691 Bacteria 1018
440 Ga0495687_073335 3300047443 Bacteria 1365
441 Ga0496100_0734702 3300048903 Unclassified 771
442 Ga0496101_0047882 3300048904 Bacteria 3070
443 Ga0496101_0131747 3300048904 Bacteria 1899
444 Ga0496105_0324302 3300048908 Bacteria 1234
445 Ga0496106_0078613 3300048909 Bacteria 2532
446 Ga0496107_0201351 3300048910 Bacteria 1480
447 Ga0496108_0046713 3300048911 Bacteria 3618
448 Ga0496108_0136044 3300048911 Bacteria 2114
449 Ga0496109_0040514 3300048912 Bacteria 4219
450 Ga0496109_0078365 3300048912 Bacteria 3042
451 Ga0496109_0211340 3300048912 Bacteria 1824
452 Ga0496110_0063420 3300048913 Bacteria 3265
453 Ga0496111_0431350 3300048914 Bacteria 973
454 Ga0496112_0003520 3300048915 Bacteria 12985
455 Ga0496112_0110238 3300048915 Bacteria 2722
456 Ga0496113_0010917 3300048916 Bacteria 6029
457 Ga0501235_016351 3300049669 Bacteria 1639
458 Ga0501249_058344 3300049679 Bacteria 892
459 Ga0501221_027962 3300049704 Bacteria 1157
460 Ga0395900_0532385
461 MBSR1b_contig_8406955
462 JGI24737J22298_10000375
463 JGI24737J22298_10043662
464 JGI24735J21928_10001012
465 JGI24735J21928_10035902
466 JGI24738J21930_10000224
467 rootH1_10071154
468 Ga0070658_10000260
469 Ga0070658_10085478
470 Ga0070658_10575902
471 Ga0070658_10779429
472 Ga0070676_10050722
473 Ga0070683_100001828
474 Ga0070683_100022444
475 Ga0070683_100955949
476 Ga0070670_100015597
477 Ga0070670_100645950
478 Ga0070666_10004011
479 Ga0070666_10006224
480 Ga0070666_10301435
481 Ga0070680_100008734
482 Ga0070680_100038411
483 Ga0070680_100044886
484 Ga0068868_100012499
485 Ga0068868_100012713
486 Ga0070660_100003134
487 Ga0070660_100004919
488 Ga0070660_100007487
489 Ga0070660_100013902
490 Ga0070660_100025557
491 Ga0070660_100063481
492 Ga0070660_100481507
493 Ga0070689_100061990
494 Ga0070691_10146710
495 Ga0070661_100000439
496 Ga0070661_100034097
497 Ga0070661_100133248
498 Ga0070661_100220857
499 Ga0070661_100275641
500 Ga0070661_100335449
501 Ga0070669_100325299
502 Ga0070675_100339557
503 Ga0070671_100011132
504 Ga0070671_100027431
505 Ga0070671_100073746
506 Ga0070671_100309938
507 Ga0070671_100458809
508 Ga0070671_101193097
509 Ga0070674_100008921
510 Ga0070674_100074545
511 Ga0070674_100102064
512 Ga0070674_100286955
513 Ga0070674_100646998
514 Ga0070674_101116546
515 Ga0070673_100039610
516 Ga0070673_100125636
517 Ga0070688_100100888
518 Ga0070659_100000065
519 Ga0070659_100018472
520 Ga0070659_100031488
521 Ga0070659_100168810
522 Ga0070659_100184788
523 Ga0070667_100026784
524 Ga0070667_100347216
525 Ga0070714_100027275
526 Ga0070714_100467364
527 Ga0070713_100194429
528 Ga0070694_100053494
529 Ga0070663_100006864
530 Ga0070663_100019598
531 Ga0070663_100026675
532 Ga0070663_100126594
533 Ga0070678_100006946
534 Ga0070678_100068601
535 Ga0070662_100000010
536 Ga0070662_100008627
537 Ga0070662_100016183
538 Ga0070662_100132172
539 Ga0070681_10049284
540 Ga0070681_10082880
541 Ga0070681_10136481
542 Ga0068867_100042069
543 Ga0070679_100038907
544 Ga0070679_100039777
545 Ga0070679_100103627
546 Ga0070679_100293986
547 Ga0070684_100017032
548 Ga0070684_100057186
549 Ga0068853_100000396
550 Ga0068853_100079743
551 Ga0068853_100115443
552 Ga0068853_100284752
553 Ga0068853_100419502
554 Ga0068853_100523886
555 Ga0070672_100260762
556 Ga0070672_100322220
557 Ga0070672_100325767
558 Ga0070686_100180181
559 Ga0070665_100004913
560 Ga0070665_100181615
561 Ga0070665_100196172
562 Ga0070665_100330485
563 Ga0068855_100002953
564 Ga0068855_100004196
565 Ga0068855_100278914
566 Ga0068855_100280487
567 Ga0070664_100000992
568 Ga0070664_100126808
569 Ga0068857_100276689
570 Ga0068857_100279128
571 Ga0068857_101044585
572 Ga0068857_101066487
573 Ga0068854_100038840
574 Ga0068854_100123462
575 Ga0068854_100162655
576 Ga0068854_100203182
577 Ga0068854_100242241
578 Ga0068854_100250918
579 Ga0068856_100000101
580 Ga0068856_100006671
581 Ga0068856_100059824
582 Ga0068856_100072385
583 Ga0068856_100353060
584 Ga0068856_100718141
585 Ga0068856_100898644
586 Ga0068852_100001142
587 Ga0068852_100009616
588 Ga0068852_100027136
589 Ga0068852_100146770
590 Ga0068852_100268617
591 Ga0068852_100277850
592 Ga0068852_100289289
593 Ga0068859_100030425
594 Ga0068859_100193110
595 Ga0068859_101284590
596 Ga0068864_100001039
597 Ga0068864_100028520
598 Ga0068864_100040385
599 Ga0068864_100323132
600 Ga0068866_10084411
601 Ga0068851_10011222
602 Ga0068851_10066106
603 Ga0068851_10133417
604 Ga0068863_100022058
605 Ga0068858_100031902
606 Ga0068858_100329043
607 Ga0068860_100010737
608 Ga0068860_100182041
609 Ga0068862_100553746
610 Ga0068862_100555806
611 Ga0081539_10033538
612 Ga0097621_100017299
613 Ga0075431_100375759
614 Ga0097620_100030430
615 Ga0097620_100193101
616 Ga0097620_101284629
617 Ga0097620_101284630
618 Ga0105240_10036481
619 Ga0105247_10091559
620 Ga0105243_10181325
621 Ga0105243_10279096
622 Ga0105241_10010676
623 Ga0105242_10139702
624 Ga0105248_10001870
625 Ga0105248_10022148
626 Ga0105248_10654357
627 Ga0105248_11173763
628 Ga0105237_10053768
629 Ga0105238_10006901
630 Ga0105238_10015895
631 Ga0105238_10035010
632 Ga0105249_10490850
633 Ga0105239_10130123
634 Ga0105246_10060154
635 Ga0105246_10110581
636 Ga0157373_10037784
637 Ga0157373_10706877
638 Ga0157371_10001218
639 Ga0157371_10032159
640 Ga0157371_10145018
641 Ga0157370_10027882
642 Ga0157370_10029043
643 Ga0157370_10094415
644 Ga0157370_10123523
645 Ga0157369_10005567
646 Ga0157369_10010979
647 Ga0157369_10187606
648 Ga0157369_10374625
649 Ga0157369_10588919
650 Ga0157374_10728240
651 Ga0157374_11333688
652 Ga0157378_10869236
653 Ga0157372_10003113
654 Ga0157372_10093843
655 Ga0157372_10508393
656 Ga0157375_10153917
657 Ga0157375_10312496
658 Ga0163163_10000580
659 Ga0163163_10066705
660 Ga0163163_10473403
661 Ga0163163_10654124
662 Ga0157377_10518713
663 Ga0157379_10140038
664 Ga0157376_10059707
665 Ga0213875_10028218
666 Ga0207697_10101259
667 Ga0207656_10006676
668 Ga0207642_10052178
669 Ga0207642_10076829
670 Ga0207688_10050221
671 Ga0207680_10001072
672 Ga0207680_10003153
673 Ga0207680_10102725
674 Ga0207680_10279842
675 Ga0207647_10002885
676 Ga0207647_10003379
677 Ga0207647_10014514
678 Ga0207647_10043790
679 Ga0207647_10144318
680 Ga0207647_10248870
681 Ga0207647_10467224
682 Ga0207645_10061856
683 Ga0207705_10000113
684 Ga0207705_10000448
685 Ga0207705_10014604
686 Ga0207705_10084364
687 Ga0207705_10116247
688 Ga0207705_10123321
689 Ga0207705_10166339
690 Ga0207705_10195755
691 Ga0207705_10207902
692 Ga0207654_10004653
693 Ga0207654_10394649
694 Ga0207707_10062699
695 Ga0207707_10110419
696 Ga0207695_10106072
697 Ga0207671_10120038
698 Ga0207660_10028808
699 Ga0207660_10104052
700 Ga0207657_10000026
701 Ga0207657_10000278
702 Ga0207657_10004865
703 Ga0207657_10014993
704 Ga0207657_10035525
705 Ga0207657_10041946
706 Ga0207657_10045167
707 Ga0207657_10066552
708 Ga0207657_10143023
709 Ga0207657_10356139
710 Ga0207649_10001918
711 Ga0207649_10029991
712 Ga0207649_10156100
713 Ga0207649_10179433
714 Ga0207649_10205147
715 Ga0207649_10240530
716 Ga0207649_10624870
717 Ga0207652_10000465
718 Ga0207652_10073377
719 Ga0207652_10098868
720 Ga0207652_10136662
721 Ga0207652_10165254
722 Ga0207681_10250930
723 Ga0207694_10004638
724 Ga0207694_10025286
725 Ga0207650_10156298
726 Ga0207650_10168490
727 Ga0207659_10293386
728 Ga0207659_10329862
729 Ga0207700_10277387
730 Ga0207664_10035017
731 Ga0207664_10483469
732 Ga0207644_10000141
733 Ga0207644_10003740
734 Ga0207644_10010361
735 Ga0207644_10015650
736 Ga0207644_10153729
737 Ga0207690_10000036
738 Ga0207690_10031500
739 Ga0207690_10094847
740 Ga0207690_10107923
741 Ga0207690_10546134
742 Ga0207706_10000031
743 Ga0207706_10002634
744 Ga0207706_10011975
745 Ga0207706_10102430
746 Ga0207686_10220908
747 Ga0207709_10381157
748 Ga0207709_10472394
749 Ga0207669_10073461
750 Ga0207669_10095849
751 Ga0207669_10818872
752 Ga0207691_10017617
753 Ga0207691_10052652
754 Ga0207691_10278180
755 Ga0207711_10000446
756 Ga0207711_10001681
757 Ga0207711_10036153
758 Ga0207711_10167183
759 Ga0207689_10048946
760 Ga0207689_10384176
761 Ga0207661_10006059
762 Ga0207661_10129633
763 Ga0207679_10000093
764 Ga0207679_10078640
765 Ga0207667_10019103
766 Ga0207667_10029924
767 Ga0207667_10035974
768 Ga0207667_10077408
769 Ga0207667_10105343
770 Ga0207651_10584603
771 Ga0207640_10005614
772 Ga0207640_10007355
773 Ga0207640_10033692
774 Ga0207640_10052479
775 Ga0207640_10131247
776 Ga0207640_10144154
777 Ga0207640_10197340
778 Ga0207677_10006971
779 Ga0207677_10011783
780 Ga0207677_10036236
781 Ga0207703_10003718
782 Ga0207703_10092208
783 Ga0207639_10001599
784 Ga0207639_10021314
785 Ga0207639_10030754
786 Ga0207639_10473977
787 Ga0207678_10000265
788 Ga0207678_10019169
789 Ga0207678_10044732
790 Ga0207678_10046433
791 Ga0207678_10061994
792 Ga0207702_10000353
793 Ga0207702_10032782
794 Ga0207702_10105742
795 Ga0207702_10563602
796 Ga0207702_11234698
797 Ga0207641_10030826
798 Ga0207641_10205960
799 Ga0207641_10212315
800 Ga0207648_10027331
801 Ga0207648_10029038
802 Ga0207648_10178973
803 Ga0207676_10008600
804 Ga0207676_10016645
805 Ga0207676_10163729
806 Ga0207674_10016204
807 Ga0207674_10052413
808 Ga0207674_10658527
809 Ga0207683_10005837
810 Ga0207683_10089439
811 Ga0207698_10003104
812 Ga0207698_10007352
813 Ga0207698_10035439
814 Ga0207698_10062838
815 Ga0207698_10128258
816 Ga0268266_10027043
817 Ga0268266_10190142
818 Ga0268266_10193335
819 Ga0268265_10293942
820 Ga0268264_10001234
821 Ga0268264_10356690
822 Ga0268264_11267971
823 Ga0316182_1389001
824 Ga0307405_10805552
825 Ga0307413_10527114
826 Ga0307410_10025269
827 Ga0307410_10412719
828 Ga0307406_10240881
829 Ga0307406_10470364
830 Ga0307409_100090321
831 Ga0307416_100142397
832 Ga0307414_10248599
833 Ga0373949_0049032
834 Ga0373960_0015845
835 Ga0373931_0013473
836 Ga0395899_0003429
837 Ga0395899_0029034
838 Ga0395899_0044258
839 Ga0395899_0053199
840 Ga0395899_0192668
841 Ga0395900_0005818
842 Ga0395900_0007745
843 Ga0395900_0017045
844 Ga0395900_0025891
845 Ga0395900_0062621
846 Ga0395900_0098976
847 Ga0395900_0135921
848 Ga0395900_0292412
849 Ga0395900_0424443
850 Ga0395898_0016676
851 Ga0395898_0022279
852 Ga0395898_0352118
853 Ga0395898_0528216
854 Ga0395898_1318009
855 Ga0395905_0002782
856 Ga0395905_0004759
857 Ga0395905_0011289
858 Ga0395905_0028490
859 Ga0395905_0030537
860 Ga0395905_0035057
861 Ga0395905_0038639
862 Ga0395905_0082452
863 Ga0395905_0118998
864 Ga0395905_0210187
865 Ga0395905_0239519
866 Ga0395905_0363705
867 Ga0395905_0705880
868 Ga0395905_0736094
869 Ga0436364_0131873
870 Ga0395901_0000872
871 Ga0395901_0012625
872 Ga0395901_0045214
873 Ga0395901_0049545
874 Ga0395901_0098609
875 Ga0395901_0193264
876 Ga0395901_0202507
877 Ga0395901_0351289
878 Ga0395901_0373559
879 Ga0395901_0395372
880 Ga0395901_0409927
881 Ga0395901_0608224
882 Ga0466969_0158592
883 Ga0466966_0150365
884 Ga0466963_0034233
885 Ga0466963_0070444
886 Ga0466963_0304839
887 Ga0466964_0252646
888 Ga0466971_0243516
889 Ga0466957_0268716
890 Ga0466957_0289501
891 Ga0466960_0450508
892 Ga0466959_0081692
893 Ga0466967_0275017
894 Ga0466967_0404797
895 Ga0466967_0470735
896 Ga0466967_0525314
897 Ga0495643_0201314
898 Ga0495670_0216045
899 Ga0495687_073335
900 Ga0496100_0734702
901 Ga0496101_0047882
902 Ga0496101_0131747
903 Ga0496105_0324302
904 Ga0496106_0078613
905 Ga0496107_0201351
906 Ga0496108_0046713
907 Ga0496108_0136044
908 Ga0496109_0040514
909 Ga0496109_0078365
910 Ga0496109_0211340
911 Ga0496110_0063420
912 Ga0496111_0431350
913 Ga0496112_0003520
914 Ga0496112_0110238
915 Ga0496113_0010917
916 Ga0501235_016351
917 Ga0501249_058344
918 Ga0501221_027962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

49

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dil-assembly2.cif.gz_C crystal structure of putative nitroreductase from salmonella enterica 0.8678 6 164
3k6h-assembly1.cif.gz_B crystal structure of a nitroreductase family protein from agrobacterium tumefaciens str. c58 0.852 4 186
8dil-assembly1.cif.gz_A crystal structure of putative nitroreductase from salmonella enterica 0.8414 6 183
7tmf-assembly1.cif.gz_A crystal structure of nad(p)h nitroreductase from klebsiella pneumoniae (short b-axis) 0.8413 5 165
8dil-assembly1.cif.gz_A crystal structure of putative nitroreductase from salmonella enterica 0.837 6 183
ID Description Score Start End Superfamily
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8895 7 165 3.40.109.10
3k6hB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8497 7 165 3.40.109.10
af_Q9H9J2_55_186_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.8002 60 91 1.10.1520.10
2i7hE00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7691 3 182 3.40.109.10
af_Q2G001_1_177_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7687 6 175 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A2H0HTM1-F1-model_v4 Nitroreductase 0.9321 23 163 GO:0016491
AF-A0A530Y0L6-F1-model_v4 Nitroreductase 0.9229 23 129 GO:0016491
AF-A0A530Y0L6-F1-model_v4 Nitroreductase 0.907 23 129 GO:0016491
AF-A0A0K6HKC2-F1-model_v4 deleted 0.9069 9 141
AF-A0A848QMQ9-F1-model_v4 deleted 0.9055 7 163

Map