F448394

General Info

Members Datasets Scaffolds Average Seq Length
459 300 916 260

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1415768|Ga0436364_1415768_245_1063
Length 272
Sequence MRNIRLRSVEVAAMRIKANGITVNYQIDGAEGAPCLVLSNSLATNLSMWDEQAAALKNAFRVLRYDQRGHGGTDAPAERYSFDLLIADAISLLDALSIKRAHFGGLSMGGATALGLALRHPDRIDRAIICDSGCASTPASSQQWEERITAARKGGMEAMVDSTMARWFPPEIITANPPYLDKVRAMIRSTPVDGFIGCATALANHDFRSAVGTVTRPLLFVVGEKDGPQPAAMRDMHQKVPGSRFVELPGAGHISNMDQPALFTKAIKEFLS

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 0
Rhizoplane 8.93
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1415768 3300037853 Bacteria 15859
2 JGI24743J22301_10000383 3300001991 Bacteria 4955
3 JGI24750J21931_1000983 3300002070 Bacteria 3761
4 JGI24749J21850_1002458 3300002076 Unclassified 2606
5 JGI24744J21845_10002260 3300002077 Bacteria 3918
6 JGI24742J22300_10005037 3300002244 Unclassified 2171
7 JGI25153J46596_10006547 3300003215 Bacteria 5872
8 JGI25405J52794_10008361 3300003911 Unclassified 1931
9 Ga0070690_100016671 3300005330 Bacteria 4406
10 Ga0070690_100314330 3300005330 Bacteria 1127
11 Ga0070670_100706381 3300005331 Bacteria 907
12 Ga0070677_10046154 3300005333 Bacteria 1741
13 Ga0068869_100069303 3300005334 Unclassified 2607
14 Ga0070682_100048255 3300005337 Unclassified 2650
15 Ga0068868_100139893 3300005338 Unclassified 1986
16 Ga0070689_100014657 3300005340 Bacteria 5701
17 Ga0070687_100009313 3300005343 Bacteria 4203
18 Ga0070687_100010078 3300005343 Bacteria 4070
19 Ga0070668_100256760 3300005347 Unclassified 1452
20 Ga0070669_100045756 3300005353 Bacteria 3190
21 Ga0070669_100148898 3300005353 Bacteria 1811
22 Ga0070669_100196237 3300005353 Unclassified 1586
23 Ga0070675_100017761 3300005354 Bacteria 5658
24 Ga0070671_100017741 3300005355 Bacteria 5771
25 Ga0070674_100028422 3300005356 Bacteria 3673
26 Ga0070674_100045095 3300005356 Bacteria 3011
27 Ga0070673_100021261 3300005364 Bacteria 4699
28 Ga0070659_100036244 3300005366 Bacteria 3844
29 Ga0070667_100118985 3300005367 Bacteria 2296
30 Ga0070709_10013702 3300005434 Bacteria 4565
31 Ga0070709_10161485 3300005434 Bacteria 1559
32 Ga0070714_100462358 3300005435 Bacteria 1206
33 Ga0070713_100023855 3300005436 Bacteria 4755
34 Ga0070710_10034343 3300005437 Unclassified 2759
35 Ga0070710_10080714 3300005437 Unclassified 1898
36 Ga0070710_10266932 3300005437 Unclassified 1105
37 Ga0070701_10017914 3300005438 Bacteria 3320
38 Ga0070711_100128787 3300005439 Bacteria 1882
39 Ga0070711_100183712 3300005439 Unclassified 1602
40 Ga0070705_100063029 3300005440 Unclassified 2210
41 Ga0070700_100020524 3300005441 Bacteria 3828
42 Ga0070700_100060922 3300005441 Bacteria 2379
43 Ga0070708_100163612 3300005445 Bacteria 2074
44 Ga0070678_100031587 3300005456 Bacteria 3656
45 Ga0070678_100094797 3300005456 Unclassified 2298
46 Ga0070678_100470804 3300005456 Bacteria 1104
47 Ga0070662_100060085 3300005457 Unclassified 2770
48 Ga0068867_100005896 3300005459 Bacteria 8692
49 Ga0070707_100732818 3300005468 Bacteria 952
50 Ga0070699_100005729 3300005518 Bacteria 10870
51 Ga0068853_100213790 3300005539 Unclassified 1758
52 Ga0070672_100023043 3300005543 Bacteria 4584
53 Ga0070672_100207013 3300005543 Bacteria 1642
54 Ga0070686_100009136 3300005544 Bacteria 5559
55 Ga0070686_100223559 3300005544 Bacteria 1362
56 Ga0070693_100027228 3300005547 Bacteria 3095
57 Ga0070665_100120325 3300005548 Unclassified 2627
58 Ga0070704_100404108 3300005549 Bacteria 1166
59 Ga0068855_100394482 3300005563 Unclassified 1518
60 Ga0070664_100105064 3300005564 Unclassified 2459
61 Ga0068854_100059674 3300005578 Unclassified 2757
62 Ga0068856_100108594 3300005614 Unclassified 2771
63 Ga0070702_100005142 3300005615 Bacteria 6057
64 Ga0068852_100011940 3300005616 Bacteria 6569
65 Ga0068864_100022653 3300005618 Bacteria 5268
66 Ga0068864_100023617 3300005618 Bacteria 5165
67 Ga0068866_10035084 3300005718 Unclassified 2447
68 Ga0068851_10023564 3300005834 Bacteria 3010
69 Ga0068863_100015406 3300005841 Bacteria 7350
70 Ga0068863_100160792 3300005841 Bacteria 2152
71 Ga0068863_100199110 3300005841 Bacteria 1926
72 Ga0068858_100086582 3300005842 Unclassified 2914
73 Ga0068862_100235491 3300005844 Unclassified 1662
74 Ga0081455_10073287 3300005937 Bacteria 2832
75 Ga0081538_10008920 3300005981 Bacteria 8429
76 Ga0081538_10028176 3300005981 Bacteria 3871
77 Ga0081538_10031978 3300005981 Bacteria 3537
78 Ga0075365_10025551 3300006038 Plasmid 3740
79 Ga0075365_10144259 3300006038 Unclassified 1654
80 Ga0075365_10244517 3300006038 Bacteria 1260
81 Ga0075368_10096839 3300006042 Bacteria 1210
82 Ga0075363_100184276 3300006048 Bacteria 1189
83 Ga0070715_10013163 3300006163 Bacteria 3031
84 Ga0070715_10221771 3300006163 Bacteria 972
85 Ga0070712_100024999 3300006175 Unclassified 3964
86 Ga0070712_100133613 3300006175 Unclassified 1884
87 Ga0070712_100212558 3300006175 Unclassified 1526
88 Ga0075366_10030195 3300006195 Bacteria 3185
89 Ga0075366_10067277 3300006195 Bacteria 2132
90 Ga0075370_10092995 3300006353 Bacteria 1741
91 Ga0068871_100005067 3300006358 Bacteria 9201
92 Ga0075428_100099647 3300006844 Bacteria 3168
93 Ga0075428_100140697 3300006844 Bacteria 2624
94 Ga0075430_100033805 3300006846 Bacteria 4339
95 Ga0075430_100188319 3300006846 Unclassified 1715
96 Ga0075431_100045648 3300006847 Bacteria 4517
97 Ga0075433_10101925 3300006852 Bacteria 2542
98 Ga0075433_10262967 3300006852 Bacteria 1529
99 Ga0075434_100005665 3300006871 Bacteria 11396
100 Ga0075434_100202930 3300006871 Bacteria 2003
101 Ga0075434_100323961 3300006871 Unclassified 1561
102 Ga0075429_100024012 3300006880 Bacteria 5289
103 Ga0068865_100008891 3300006881 Bacteria 6214
104 Ga0075435_100285986 3300007076 Unclassified 1408
105 Ga0075435_100332749 3300007076 Unclassified 1301
106 Ga0099794_10026684 3300007265 Bacteria 2673
107 Ga0105240_10838788 3300009093 Bacteria 993
108 Ga0111539_10037980 3300009094 Bacteria 5809
109 Ga0111539_10383176 3300009094 Bacteria 1637
110 Ga0111539_10808263 3300009094 Bacteria 1091
111 Ga0105245_10164813 3300009098 Bacteria 2106
112 Ga0105247_10011445 3300009101 Bacteria 5348
113 Ga0114129_10033816 3300009147 Bacteria 7222
114 Ga0114129_10039209 3300009147 Bacteria 6679
115 Ga0114129_10129261 3300009147 Bacteria 3471
116 Ga0114129_10668339 3300009147 Bacteria 1339
117 Ga0105241_10231245 3300009174 Unclassified 1559
118 Ga0105242_10385727 3300009176 Unclassified 1304
119 Ga0105248_10233430 3300009177 Unclassified 2071
120 Ga0105237_10029010 3300009545 Bacteria 5628
121 Ga0105249_10025573 3300009553 Bacteria 5316
122 Ga0105239_10109210 3300010375 Unclassified 3065
123 Ga0105246_10026635 3300011119 Bacteria 3781
124 Ga0157371_10244502 3300013102 Unclassified 1291
125 Ga0157378_10066008 3300013297 Bacteria 3240
126 Ga0163162_10469493 3300013306 Bacteria 1390
127 Ga0163162_10493683 3300013306 Bacteria 1355
128 Ga0163163_10017917 3300014325 Bacteria 6615
129 Ga0163163_10233433 3300014325 Unclassified 1889
130 Ga0157377_10056228 3300014745 Unclassified 2234
131 Ga0157379_10341245 3300014968 Bacteria 1370
132 Ga0157376_10196757 3300014969 Unclassified 1852
133 Ga0213876_10019809 3300021384 Bacteria 3553
134 Ga0213875_10000033 3300021388 Bacteria 170944
135 Ga0209758_1000257 3300025297 Bacteria 106321
136 Ga0207697_10081454 3300025315 Bacteria 1364
137 Ga0207656_10004525 3300025321 Bacteria 4863
138 Ga0207692_10020847 3300025898 Plasmid 2989
139 Ga0207642_10018378 3300025899 Unclassified 2682
140 Ga0207710_10014200 3300025900 Bacteria 3356
141 Ga0207688_10007108 3300025901 Bacteria 6089
142 Ga0207688_10086388 3300025901 Bacteria 1797
143 Ga0207680_10168951 3300025903 Unclassified 1472
144 Ga0207647_10013262 3300025904 Bacteria 5720
145 Ga0207685_10089846 3300025905 Bacteria 1291
146 Ga0207699_10013906 3300025906 Bacteria 4133
147 Ga0207699_10233146 3300025906 Bacteria 1261
148 Ga0207643_10002075 3300025908 Bacteria 11036
149 Ga0207705_10161598 3300025909 Bacteria 1683
150 Ga0207684_10072914 3300025910 Bacteria 2916
151 Ga0207684_10436181 3300025910 Bacteria 1125
152 Ga0207654_10168041 3300025911 Unclassified 1422
153 Ga0207707_10069054 3300025912 Bacteria 3080
154 Ga0207693_10031720 3300025915 Bacteria 4176
155 Ga0207693_10032217 3300025915 Unclassified 4137
156 Ga0207663_10127645 3300025916 Unclassified 1752
157 Ga0207663_10331563 3300025916 Unclassified 1146
158 Ga0207660_10277029 3300025917 Bacteria 1330
159 Ga0207662_10007537 3300025918 Bacteria 5925
160 Ga0207662_10015182 3300025918 Bacteria 4330
161 Ga0207652_10017356 3300025921 Bacteria 5890
162 Ga0207659_10054696 3300025926 Unclassified 2851
163 Ga0207687_10009295 3300025927 Bacteria 6430
164 Ga0207700_10027187 3300025928 Bacteria 4002
165 Ga0207700_10101170 3300025928 Bacteria 2299
166 Ga0207664_10021128 3300025929 Bacteria 4835
167 Ga0207664_10169389 3300025929 Unclassified 1868
168 Ga0207644_10231177 3300025931 Unclassified 1469
169 Ga0207690_10168737 3300025932 Unclassified 1638
170 Ga0207706_10015417 3300025933 Bacteria 6905
171 Ga0207706_10237232 3300025933 Bacteria 1594
172 Ga0207709_10022129 3300025935 Bacteria 3604
173 Ga0207709_10176326 3300025935 Bacteria 1505
174 Ga0207670_10000455 3300025936 Bacteria 22951
175 Ga0207670_10081280 3300025936 Bacteria 2267
176 Ga0207669_10021736 3300025937 Bacteria 3393
177 Ga0207704_10000912 3300025938 Bacteria 13084
178 Ga0207704_10124986 3300025938 Bacteria 1769
179 Ga0207665_10005340 3300025939 Bacteria 8586
180 Ga0207665_10022065 3300025939 Bacteria 4187
181 Ga0207691_10004025 3300025940 Bacteria 14247
182 Ga0207691_10277546 3300025940 Bacteria 1442
183 Ga0207711_10077936 3300025941 Unclassified 2890
184 Ga0207689_10149400 3300025942 Bacteria 1926
185 Ga0207661_10066060 3300025944 Bacteria 2938
186 Ga0207651_10060161 3300025960 Unclassified 2635
187 Ga0207712_10052625 3300025961 Unclassified 2853
188 Ga0207668_10226141 3300025972 Bacteria 1506
189 Ga0207668_10390372 3300025972 Bacteria 1174
190 Ga0207640_10015083 3300025981 Bacteria 4466
191 Ga0207658_10021187 3300025986 Bacteria 4508
192 Ga0207658_10557463 3300025986 Bacteria 1026
193 Ga0207703_10008357 3300026035 Bacteria 8183
194 Ga0207639_10045505 3300026041 Bacteria 3306
195 Ga0207678_10051301 3300026067 Bacteria 3561
196 Ga0207678_10534515 3300026067 Bacteria 1024
197 Ga0207708_10041917 3300026075 Bacteria 3489
198 Ga0207702_10028550 3300026078 Bacteria 4638
199 Ga0207641_10030123 3300026088 Bacteria 4493
200 Ga0207641_10166699 3300026088 Bacteria 2007
201 Ga0207648_10003697 3300026089 Bacteria 16019
202 Ga0207648_10260485 3300026089 Bacteria 1547
203 Ga0207648_10349372 3300026089 Unclassified 1333
204 Ga0207676_10017472 3300026095 Bacteria 5199
205 Ga0207676_10123380 3300026095 Unclassified 2188
206 Ga0207676_10320331 3300026095 Unclassified 1423
207 Ga0207674_10044165 3300026116 Bacteria 4591
208 Ga0207675_100001123 3300026118 Bacteria 26537
209 Ga0207675_100058971 3300026118 Bacteria 3582
210 Ga0207683_10025579 3300026121 Bacteria 5093
211 Ga0207683_10059362 3300026121 Bacteria 3360
212 Ga0207683_10092099 3300026121 Bacteria 2701
213 Ga0207698_10044145 3300026142 Bacteria 3346
214 Ga0209588_1108429 3300027671 Bacteria 892
215 Ga0209813_10099768 3300027866 Bacteria 986
216 Ga0268266_10078869 3300028379 Unclassified 2866
217 Ga0268264_10137962 3300028381 Bacteria 2171
218 Ga0265340_10022433 3300031247 Bacteria 3227
219 Ga0265339_10055506 3300031249 Unclassified 2148
220 Ga0265316_10072050 3300031344 Bacteria 2662
221 Ga0265316_10257632 3300031344 Bacteria 1280
222 Ga0265314_10231738 3300031711 Bacteria 1071
223 Ga0373926_0027394 3300035083 Bacteria 1997
224 Ga0373928_0012748 3300035084 Bacteria 1681
225 Ga0373944_0007188 3300035089 Unclassified 2977
226 Ga0373949_0047399 3300035090 Bacteria 1074
227 Ga0373951_0009297 3300035091 Bacteria 2215
228 Ga0373952_0036911 3300035092 Bacteria 1112
229 Ga0373923_0000675 3300035111 Bacteria 8677
230 Ga0373936_0004148 3300035113 Bacteria 5461
231 Ga0373936_0009045 3300035113 Bacteria 3758
232 Ga0373936_0009282 3300035113 Bacteria 3706
233 Ga0373936_0156283 3300035113 Bacteria 991
234 Ga0373945_0006369 3300035116 Bacteria 3807
235 Ga0373954_0032387 3300035118 Bacteria 2416
236 Ga0373956_0012639 3300035119 Bacteria 3503
237 Ga0373957_0035050 3300035120 Bacteria 1862
238 Ga0373960_0019382 3300035121 Bacteria 1787
239 Ga0373943_0016765 3300035170 Bacteria 3346
240 Ga0373943_0031643 3300035170 Bacteria 2511
241 Ga0373946_0003372 3300035171 Bacteria 5668
242 Ga0373946_0029546 3300035171 Bacteria 2182
243 Ga0373955_0002175 3300035172 Bacteria 8488
244 Ga0373924_0000349 3300035410 Bacteria 14213
245 Ga0373931_0002818 3300035691 Bacteria 7746
246 Ga0373931_0216336 3300035691 Unclassified 1152
247 Ga0373935_0000980 3300035692 Bacteria 15499
248 Ga0373935_0052077 3300035692 Unclassified 2601
249 Ga0373927_0012798 3300035695 Bacteria 5580
250 Ga0373927_0059733 3300035695 Bacteria 2466
251 Ga0373927_0075786 3300035695 Bacteria 2178
252 Ga0373933_0000518 3300035724 Bacteria 24100
253 Ga0373947_0000379 3300035725 Bacteria 25163
254 Ga0373947_0009132 3300035725 Bacteria 5698
255 Ga0373947_0142577 3300035725 Bacteria 1538
256 Ga0373937_0003427 3300036401 Bacteria 13305
257 Ga0373937_0093045 3300036401 Bacteria 2795
258 Ga0373925_0000018 3300037068 Bacteria 174213
259 Ga0373925_0083931 3300037068 Bacteria 2427
260 Ga0373925_0109980 3300037068 Bacteria 2127
261 Ga0373925_0136452 3300037068 Bacteria 1917
262 Ga0373925_0237083 3300037068 Bacteria 1460
263 Ga0373925_0563685 3300037068 Bacteria 937
264 Ga0436364_0640586 3300037853 Bacteria 24713
265 Ga0242420_017975 3300038996 Bacteria 1242
266 Ga0436365_1602128 3300039437 Bacteria 969
267 Ga0436365_1728479 3300039437 Bacteria 1044
268 Ga0436365_1806888 3300039437 Bacteria 1652
269 Ga0436360_1137067 3300039438 Bacteria 1303
270 Ga0436361_0333298 3300039447 Unclassified 4463
271 Ga0436363_0672779 3300039450 Bacteria 2581
272 Ga0436362_0611484 3300039453 Bacteria 738
273 Ga0439453_0002437 3300041408 Bacteria 2569
274 Ga0439465_0076272 3300041413 Bacteria 1130
275 Ga0495627_025823 3300046453 Unclassified 1901
276 Ga0495627_056818 3300046453 Bacteria 1166
277 Ga0495592_0000001 3300046454 Bacteria 305819
278 Ga0495603_0050483 3300046455 Bacteria 2473
279 Ga0495603_0139763 3300046455 Bacteria 1409
280 Ga0495638_0064892 3300046460 Unclassified 2249
281 Ga0495641_0010696 3300046461 Bacteria 5289
282 Ga0495653_0000092 3300046463 Bacteria 74868
283 Ga0495580_0034610 3300046472 Bacteria 3636
284 Ga0495580_0262011 3300046472 Bacteria 1182
285 Ga0495639_0002053 3300046475 Bacteria 8906
286 Ga0495662_0002406 3300046476 Bacteria 9406
287 Ga0495662_0104125 3300046476 Bacteria 1388
288 Ga0495664_0000001 3300046477 Bacteria 757730
289 Ga0495584_0053672 3300046491 Unclassified 2028
290 Ga0495584_0097771 3300046491 Bacteria 1483
291 Ga0495585_0034359 3300046492 Bacteria 2866
292 Ga0495594_0018976 3300046499 Bacteria 3650
293 Ga0495608_0000050 3300046511 Bacteria 96603
294 Ga0495618_0000064 3300046514 Bacteria 77194
295 Ga0495628_0000003 3300046516 Bacteria 470339
296 Ga0495630_0041506 3300046517 Bacteria 3436
297 Ga0495630_0111254 3300046517 Bacteria 2074
298 Ga0495631_0033846 3300046518 Bacteria 2293
299 Ga0495637_0072656 3300046520 Unclassified 1385
300 Ga0495644_0045006 3300046523 Unclassified 1660
301 Ga0495666_0021329 3300046526 Bacteria 3206
302 Ga0495652_0000001 3300046529 Bacteria 1045081
303 Ga0495652_0052786 3300046529 Bacteria 3466
304 Ga0495665_0053942 3300046531 Bacteria 2124
305 Ga0495665_0177609 3300046531 Bacteria 1107
306 Ga0495640_0000006 3300046533 Bacteria 285419
307 Ga0495640_0191633 3300046533 Bacteria 1299
308 Ga0495640_0346456 3300046533 Bacteria 917
309 Ga0495586_0071258 3300046535 Bacteria 1899
310 Ga0495587_0000028 3300046536 Bacteria 138663
311 Ga0495598_0001032 3300046537 Bacteria 5343
312 Ga0495609_0096042 3300046538 Unclassified 1286
313 Ga0495645_0000004 3300046543 Bacteria 532661
314 Ga0495633_0072242 3300046558 Unclassified 1609
315 Ga0495667_0000001 3300046559 Bacteria 834831
316 Ga0495656_0010486 3300046615 Bacteria 3372
317 Ga0495634_0000075 3300046642 Bacteria 77824
318 Ga0495635_0000015 3300046663 Bacteria 215468
319 Ga0495635_0127532 3300046663 Bacteria 1735
320 Ga0495659_0029569 3300046664 Unclassified 1903
321 Ga0495661_0291808 3300046665 Bacteria 819
322 Ga0495657_0000155 3300046675 Bacteria 62116
323 Ga0495599_0000029 3300046678 Bacteria 113803
324 Ga0495599_0029483 3300046678 Bacteria 3441
325 Ga0495646_0000006 3300046680 Bacteria 258496
326 Ga0495646_0157839 3300046680 Bacteria 1258
327 Ga0495647_0061741 3300046681 Bacteria 1480
328 Ga0495658_0003319 3300046683 Bacteria 7981
329 Ga0495658_0279131 3300046683 Bacteria 1054
330 Ga0495613_0024732 3300046689 Bacteria 4474
331 Ga0495613_0051659 3300046689 Bacteria 3029
332 Ga0495613_0100908 3300046689 Unclassified 2084
333 Ga0495613_0177608 3300046689 Bacteria 1509
334 Ga0495624_0007758 3300046690 Bacteria 7530
335 Ga0495624_0054259 3300046690 Bacteria 2527
336 Ga0495589_0119033 3300046794 Bacteria 1272
337 Ga0495600_0000286 3300046809 Bacteria 27213
338 Ga0495581_0069301 3300047315 Bacteria 2039
339 Ga0495581_0069309 3300047315 Bacteria 2039
340 Ga0495604_0000091 3300047317 Bacteria 77216
341 Ga0495674_0000001 3300047319 Bacteria 778665
342 Ga0495674_0050867 3300047319 Bacteria 3655
343 Ga0495676_0049102 3300047321 Bacteria 3396
344 Ga0495676_0191861 3300047321 Bacteria 1425
345 Ga0495680_0000489 3300047322 Bacteria 44631
346 Ga0495680_0117844 3300047322 Bacteria 1963
347 Ga0495683_0072869 3300047323 Unclassified 1685
348 Ga0495675_0000839 3300047444 Bacteria 18796
349 Ga0495684_0000055 3300047471 Bacteria 79796
350 Ga0495593_0004038 3300047673 Bacteria 8743
351 Ga0495602_0000002 3300048088 Bacteria 422216
352 Ga0495614_0036818 3300048089 Bacteria 2100
353 Ga0496100_0007444 3300048903 Bacteria 6041
354 Ga0496100_0109236 3300048903 Unclassified 1919
355 Ga0496100_0189472 3300048903 Unclassified 1492
356 Ga0496101_0007214 3300048904 Bacteria 7192
357 Ga0496101_0084706 3300048904 Bacteria 2348
358 Ga0496102_0095207 3300048905 Unclassified 2759
359 Ga0496102_0330467 3300048905 Bacteria 1436
360 Ga0496103_0002271 3300048906 Bacteria 12150
361 Ga0496103_0010326 3300048906 Bacteria 5525
362 Ga0496104_0007174 3300048907 Bacteria 9824
363 Ga0496104_0023607 3300048907 Bacteria 5655
364 Ga0496104_0025694 3300048907 Bacteria 5431
365 Ga0496104_0295801 3300048907 Bacteria 1531
366 Ga0496105_0005627 3300048908 Bacteria 9532
367 Ga0496105_0010836 3300048908 Bacteria 7177
368 Ga0496105_0015839 3300048908 Bacteria 6014
369 Ga0496105_0019432 3300048908 Bacteria 5479
370 Ga0496106_0067435 3300048909 Unclassified 2727
371 Ga0496106_0190335 3300048909 Bacteria 1631
372 Ga0496107_0006554 3300048910 Bacteria 8010
373 Ga0496107_0125422 3300048910 Unclassified 1893
374 Ga0496108_0000543 3300048911 Bacteria 29524
375 Ga0496108_0033548 3300048911 Bacteria 4264
376 Ga0496108_0054925 3300048911 Bacteria 3343
377 Ga0496109_0003802 3300048912 Bacteria 12597
378 Ga0496109_0571800 3300048912 Unclassified 1065
379 Ga0496110_0084701 3300048913 Unclassified 2829
380 Ga0496110_0391055 3300048913 Unclassified 1267
381 Ga0496111_0002301 3300048914 Bacteria 11483
382 Ga0496111_0219135 3300048914 Bacteria 1414
383 Ga0496112_0007413 3300048915 Bacteria 9738
384 Ga0496112_0012790 3300048915 Bacteria 7725
385 Ga0496112_0217799 3300048915 Bacteria 1866
386 Ga0496112_0438600 3300048915 Bacteria 1244
387 Ga0496113_0000246 3300048916 Bacteria 25589
388 Ga0496113_0001863 3300048916 Bacteria 12008
389 Ga0496113_0059644 3300048916 Bacteria 2875
390 Ga0496114_0015768 3300048917 Bacteria 6080
391 Ga0496114_0301153 3300048917 Bacteria 1415
392 Ga0496115_0004442 3300048918 Bacteria 10166
393 Ga0496115_0046352 3300048918 Bacteria 3473
394 Ga0501031_0023233 3300049568 Bacteria 4042
395 Ga0501032_0167431 3300049569 Bacteria 1442
396 Ga0501036_0024805 3300049572 Bacteria 5056
397 Ga0501036_0357767 3300049572 Bacteria 1219
398 Ga0501037_0003014 3300049573 Bacteria 12233
399 Ga0501038_0006400 3300049574 Bacteria 10906
400 Ga0501039_0029225 3300049575 Bacteria 4245
401 Ga0501042_0346746 3300049578 Bacteria 1074
402 Ga0501043_0026415 3300049579 Bacteria 4555
403 Ga0501046_0006409 3300049580 Bacteria 10433
404 Ga0501047_0037561 3300049581 Bacteria 4683
405 Ga0501047_0489148 3300049581 Bacteria 1058
406 Ga0501047_0561762 3300049581 Bacteria 965
407 Ga0501048_0009463 3300049582 Bacteria 7313
408 Ga0501067_0008646 3300049583 Bacteria 5645
409 Ga0501069_0004081 3300049585 Bacteria 7532
410 Ga0501071_0306495 3300049587 Bacteria 1204
411 Ga0501072_0043470 3300049588 Bacteria 3530
412 Ga0501072_0116729 3300049588 Bacteria 2126
413 Ga0501072_0202229 3300049588 Bacteria 1584
414 Ga0501073_0012248 3300049589 Bacteria 6259
415 Ga0501074_0019331 3300049590 Bacteria 4948
416 Ga0501074_0676496 3300049590 Unclassified 729
417 Ga0501076_0131713 3300049592 Bacteria 2028
418 Ga0501076_0154538 3300049592 Bacteria 1867
419 Ga0501076_0567398 3300049592 Bacteria 936
420 Ga0501077_0146646 3300049593 Bacteria 1497
421 Ga0501083_0048815 3300049744 Bacteria 2856
422 Ga0501083_0167662 3300049744 Bacteria 1436
423 Ga0501083_0242649 3300049744 Bacteria 1173
424 Ga0501035_0006803 3300049822 Bacteria 10681
425 Ga0501044_0508194 3300049823 Bacteria 1105
426 Ga0501045_0034707 3300049824 Bacteria 3663
427 Ga0501045_0389789 3300049824 Bacteria 1037
428 nmdc:mga03683_193586_c1 3300050489 Bacteria 931
429 nmdc:mga0yw44_148284_c1 3300050492 Unclassified 1529
430 nmdc:mga06z11_150138_c1 3300050494 Bacteria 1324
431 nmdc:mga06z11_256362_c1 3300050494 Bacteria 1031
432 nmdc:mga06z11_65651_c1 3300050494 Bacteria 1905
433 nmdc:mga05p37_123510_c1 3300050507 Bacteria 3180
434 nmdc:mga05p37_163787_c1 3300050507 Bacteria 2714
435 nmdc:mga05p37_36771_c1 3300050507 Bacteria 6005
436 nmdc:mga05p37_533926_c1 3300050507 Bacteria 1339
437 nmdc:mga05p37_54601_c1 3300050507 Bacteria 4914
438 nmdc:mga0qj67_128116_c1 3300050509 Bacteria 2054
439 nmdc:mga0qj67_38772_c1 3300050509 Bacteria 3739
440 nmdc:mga06r32_91005_c1 3300050510 Bacteria 2981
441 nmdc:mga0n895_179408_c1 3300050512 Bacteria 2149
442 nmdc:mga0n895_8568_c1 3300050512 Bacteria 8865
443 nmdc:mga08x19_14321_c1 3300050514 Bacteria 4810
444 nmdc:mga08x19_382088_c1 3300050514 Bacteria 986
445 nmdc:mga0a205_231155_c1 3300050515 Bacteria 1732
446 Ga0495601_0000006 3300053077 Bacteria 373770
447 Ga0495601_0067064 3300053077 Bacteria 2285
448 Ga0495601_0183110 3300053077 Unclassified 1369
449 Ga0495612_0000004 3300053078 Bacteria 286946
450 Ga0495612_0009427 3300053078 Plasmid 3960
451 Ga0495655_0001809 3300053083 Unclassified 3331
452 Ga0495595_0000051 3300053084 Bacteria 60041
453 Ga0495619_0000027 3300053085 Bacteria 165001
454 Ga0495619_0011849 3300053085 Bacteria 5492
455 Ga0495619_0020714 3300053085 Bacteria 4193
456 Ga0495619_0074147 3300053085 Bacteria 2281
457 Ga0495619_0153810 3300053085 Unclassified 1587
458 Ga0530510_0402470 3300061734 Bacteria 1032
459 Ga0436364_1415768
460 JGI24743J22301_10000383
461 JGI24750J21931_1000983
462 JGI24749J21850_1002458
463 JGI24744J21845_10002260
464 JGI24742J22300_10005037
465 JGI25153J46596_10006547
466 JGI25405J52794_10008361
467 Ga0070690_100016671
468 Ga0070690_100314330
469 Ga0070670_100706381
470 Ga0070677_10046154
471 Ga0068869_100069303
472 Ga0070682_100048255
473 Ga0068868_100139893
474 Ga0070689_100014657
475 Ga0070687_100009313
476 Ga0070687_100010078
477 Ga0070668_100256760
478 Ga0070669_100045756
479 Ga0070669_100148898
480 Ga0070669_100196237
481 Ga0070675_100017761
482 Ga0070671_100017741
483 Ga0070674_100028422
484 Ga0070674_100045095
485 Ga0070673_100021261
486 Ga0070659_100036244
487 Ga0070667_100118985
488 Ga0070709_10013702
489 Ga0070709_10161485
490 Ga0070714_100462358
491 Ga0070713_100023855
492 Ga0070710_10034343
493 Ga0070710_10080714
494 Ga0070710_10266932
495 Ga0070701_10017914
496 Ga0070711_100128787
497 Ga0070711_100183712
498 Ga0070705_100063029
499 Ga0070700_100020524
500 Ga0070700_100060922
501 Ga0070708_100163612
502 Ga0070678_100031587
503 Ga0070678_100094797
504 Ga0070678_100470804
505 Ga0070662_100060085
506 Ga0068867_100005896
507 Ga0070707_100732818
508 Ga0070699_100005729
509 Ga0068853_100213790
510 Ga0070672_100023043
511 Ga0070672_100207013
512 Ga0070686_100009136
513 Ga0070686_100223559
514 Ga0070693_100027228
515 Ga0070665_100120325
516 Ga0070704_100404108
517 Ga0068855_100394482
518 Ga0070664_100105064
519 Ga0068854_100059674
520 Ga0068856_100108594
521 Ga0070702_100005142
522 Ga0068852_100011940
523 Ga0068864_100022653
524 Ga0068864_100023617
525 Ga0068866_10035084
526 Ga0068851_10023564
527 Ga0068863_100015406
528 Ga0068863_100160792
529 Ga0068863_100199110
530 Ga0068858_100086582
531 Ga0068862_100235491
532 Ga0081455_10073287
533 Ga0081538_10008920
534 Ga0081538_10028176
535 Ga0081538_10031978
536 Ga0075365_10025551
537 Ga0075365_10144259
538 Ga0075365_10244517
539 Ga0075368_10096839
540 Ga0075363_100184276
541 Ga0070715_10013163
542 Ga0070715_10221771
543 Ga0070712_100024999
544 Ga0070712_100133613
545 Ga0070712_100212558
546 Ga0075366_10030195
547 Ga0075366_10067277
548 Ga0075370_10092995
549 Ga0068871_100005067
550 Ga0075428_100099647
551 Ga0075428_100140697
552 Ga0075430_100033805
553 Ga0075430_100188319
554 Ga0075431_100045648
555 Ga0075433_10101925
556 Ga0075433_10262967
557 Ga0075434_100005665
558 Ga0075434_100202930
559 Ga0075434_100323961
560 Ga0075429_100024012
561 Ga0068865_100008891
562 Ga0075435_100285986
563 Ga0075435_100332749
564 Ga0099794_10026684
565 Ga0105240_10838788
566 Ga0111539_10037980
567 Ga0111539_10383176
568 Ga0111539_10808263
569 Ga0105245_10164813
570 Ga0105247_10011445
571 Ga0114129_10033816
572 Ga0114129_10039209
573 Ga0114129_10129261
574 Ga0114129_10668339
575 Ga0105241_10231245
576 Ga0105242_10385727
577 Ga0105248_10233430
578 Ga0105237_10029010
579 Ga0105249_10025573
580 Ga0105239_10109210
581 Ga0105246_10026635
582 Ga0157371_10244502
583 Ga0157378_10066008
584 Ga0163162_10469493
585 Ga0163162_10493683
586 Ga0163163_10017917
587 Ga0163163_10233433
588 Ga0157377_10056228
589 Ga0157379_10341245
590 Ga0157376_10196757
591 Ga0213876_10019809
592 Ga0213875_10000033
593 Ga0209758_1000257
594 Ga0207697_10081454
595 Ga0207656_10004525
596 Ga0207692_10020847
597 Ga0207642_10018378
598 Ga0207710_10014200
599 Ga0207688_10007108
600 Ga0207688_10086388
601 Ga0207680_10168951
602 Ga0207647_10013262
603 Ga0207685_10089846
604 Ga0207699_10013906
605 Ga0207699_10233146
606 Ga0207643_10002075
607 Ga0207705_10161598
608 Ga0207684_10072914
609 Ga0207684_10436181
610 Ga0207654_10168041
611 Ga0207707_10069054
612 Ga0207693_10031720
613 Ga0207693_10032217
614 Ga0207663_10127645
615 Ga0207663_10331563
616 Ga0207660_10277029
617 Ga0207662_10007537
618 Ga0207662_10015182
619 Ga0207652_10017356
620 Ga0207659_10054696
621 Ga0207687_10009295
622 Ga0207700_10027187
623 Ga0207700_10101170
624 Ga0207664_10021128
625 Ga0207664_10169389
626 Ga0207644_10231177
627 Ga0207690_10168737
628 Ga0207706_10015417
629 Ga0207706_10237232
630 Ga0207709_10022129
631 Ga0207709_10176326
632 Ga0207670_10000455
633 Ga0207670_10081280
634 Ga0207669_10021736
635 Ga0207704_10000912
636 Ga0207704_10124986
637 Ga0207665_10005340
638 Ga0207665_10022065
639 Ga0207691_10004025
640 Ga0207691_10277546
641 Ga0207711_10077936
642 Ga0207689_10149400
643 Ga0207661_10066060
644 Ga0207651_10060161
645 Ga0207712_10052625
646 Ga0207668_10226141
647 Ga0207668_10390372
648 Ga0207640_10015083
649 Ga0207658_10021187
650 Ga0207658_10557463
651 Ga0207703_10008357
652 Ga0207639_10045505
653 Ga0207678_10051301
654 Ga0207678_10534515
655 Ga0207708_10041917
656 Ga0207702_10028550
657 Ga0207641_10030123
658 Ga0207641_10166699
659 Ga0207648_10003697
660 Ga0207648_10260485
661 Ga0207648_10349372
662 Ga0207676_10017472
663 Ga0207676_10123380
664 Ga0207676_10320331
665 Ga0207674_10044165
666 Ga0207675_100001123
667 Ga0207675_100058971
668 Ga0207683_10025579
669 Ga0207683_10059362
670 Ga0207683_10092099
671 Ga0207698_10044145
672 Ga0209588_1108429
673 Ga0209813_10099768
674 Ga0268266_10078869
675 Ga0268264_10137962
676 Ga0265340_10022433
677 Ga0265339_10055506
678 Ga0265316_10072050
679 Ga0265316_10257632
680 Ga0265314_10231738
681 Ga0373926_0027394
682 Ga0373928_0012748
683 Ga0373944_0007188
684 Ga0373949_0047399
685 Ga0373951_0009297
686 Ga0373952_0036911
687 Ga0373923_0000675
688 Ga0373936_0004148
689 Ga0373936_0009045
690 Ga0373936_0009282
691 Ga0373936_0156283
692 Ga0373945_0006369
693 Ga0373954_0032387
694 Ga0373956_0012639
695 Ga0373957_0035050
696 Ga0373960_0019382
697 Ga0373943_0016765
698 Ga0373943_0031643
699 Ga0373946_0003372
700 Ga0373946_0029546
701 Ga0373955_0002175
702 Ga0373924_0000349
703 Ga0373931_0002818
704 Ga0373931_0216336
705 Ga0373935_0000980
706 Ga0373935_0052077
707 Ga0373927_0012798
708 Ga0373927_0059733
709 Ga0373927_0075786
710 Ga0373933_0000518
711 Ga0373947_0000379
712 Ga0373947_0009132
713 Ga0373947_0142577
714 Ga0373937_0003427
715 Ga0373937_0093045
716 Ga0373925_0000018
717 Ga0373925_0083931
718 Ga0373925_0109980
719 Ga0373925_0136452
720 Ga0373925_0237083
721 Ga0373925_0563685
722 Ga0436364_0640586
723 Ga0242420_017975
724 Ga0436365_1602128
725 Ga0436365_1728479
726 Ga0436365_1806888
727 Ga0436360_1137067
728 Ga0436361_0333298
729 Ga0436363_0672779
730 Ga0436362_0611484
731 Ga0439453_0002437
732 Ga0439465_0076272
733 Ga0495627_025823
734 Ga0495627_056818
735 Ga0495592_0000001
736 Ga0495603_0050483
737 Ga0495603_0139763
738 Ga0495638_0064892
739 Ga0495641_0010696
740 Ga0495653_0000092
741 Ga0495580_0034610
742 Ga0495580_0262011
743 Ga0495639_0002053
744 Ga0495662_0002406
745 Ga0495662_0104125
746 Ga0495664_0000001
747 Ga0495584_0053672
748 Ga0495584_0097771
749 Ga0495585_0034359
750 Ga0495594_0018976
751 Ga0495608_0000050
752 Ga0495618_0000064
753 Ga0495628_0000003
754 Ga0495630_0041506
755 Ga0495630_0111254
756 Ga0495631_0033846
757 Ga0495637_0072656
758 Ga0495644_0045006
759 Ga0495666_0021329
760 Ga0495652_0000001
761 Ga0495652_0052786
762 Ga0495665_0053942
763 Ga0495665_0177609
764 Ga0495640_0000006
765 Ga0495640_0191633
766 Ga0495640_0346456
767 Ga0495586_0071258
768 Ga0495587_0000028
769 Ga0495598_0001032
770 Ga0495609_0096042
771 Ga0495645_0000004
772 Ga0495633_0072242
773 Ga0495667_0000001
774 Ga0495656_0010486
775 Ga0495634_0000075
776 Ga0495635_0000015
777 Ga0495635_0127532
778 Ga0495659_0029569
779 Ga0495661_0291808
780 Ga0495657_0000155
781 Ga0495599_0000029
782 Ga0495599_0029483
783 Ga0495646_0000006
784 Ga0495646_0157839
785 Ga0495647_0061741
786 Ga0495658_0003319
787 Ga0495658_0279131
788 Ga0495613_0024732
789 Ga0495613_0051659
790 Ga0495613_0100908
791 Ga0495613_0177608
792 Ga0495624_0007758
793 Ga0495624_0054259
794 Ga0495589_0119033
795 Ga0495600_0000286
796 Ga0495581_0069301
797 Ga0495581_0069309
798 Ga0495604_0000091
799 Ga0495674_0000001
800 Ga0495674_0050867
801 Ga0495676_0049102
802 Ga0495676_0191861
803 Ga0495680_0000489
804 Ga0495680_0117844
805 Ga0495683_0072869
806 Ga0495675_0000839
807 Ga0495684_0000055
808 Ga0495593_0004038
809 Ga0495602_0000002
810 Ga0495614_0036818
811 Ga0496100_0007444
812 Ga0496100_0109236
813 Ga0496100_0189472
814 Ga0496101_0007214
815 Ga0496101_0084706
816 Ga0496102_0095207
817 Ga0496102_0330467
818 Ga0496103_0002271
819 Ga0496103_0010326
820 Ga0496104_0007174
821 Ga0496104_0023607
822 Ga0496104_0025694
823 Ga0496104_0295801
824 Ga0496105_0005627
825 Ga0496105_0010836
826 Ga0496105_0015839
827 Ga0496105_0019432
828 Ga0496106_0067435
829 Ga0496106_0190335
830 Ga0496107_0006554
831 Ga0496107_0125422
832 Ga0496108_0000543
833 Ga0496108_0033548
834 Ga0496108_0054925
835 Ga0496109_0003802
836 Ga0496109_0571800
837 Ga0496110_0084701
838 Ga0496110_0391055
839 Ga0496111_0002301
840 Ga0496111_0219135
841 Ga0496112_0007413
842 Ga0496112_0012790
843 Ga0496112_0217799
844 Ga0496112_0438600
845 Ga0496113_0000246
846 Ga0496113_0001863
847 Ga0496113_0059644
848 Ga0496114_0015768
849 Ga0496114_0301153
850 Ga0496115_0004442
851 Ga0496115_0046352
852 Ga0501031_0023233
853 Ga0501032_0167431
854 Ga0501036_0024805
855 Ga0501036_0357767
856 Ga0501037_0003014
857 Ga0501038_0006400
858 Ga0501039_0029225
859 Ga0501042_0346746
860 Ga0501043_0026415
861 Ga0501046_0006409
862 Ga0501047_0037561
863 Ga0501047_0489148
864 Ga0501047_0561762
865 Ga0501048_0009463
866 Ga0501067_0008646
867 Ga0501069_0004081
868 Ga0501071_0306495
869 Ga0501072_0043470
870 Ga0501072_0116729
871 Ga0501072_0202229
872 Ga0501073_0012248
873 Ga0501074_0019331
874 Ga0501074_0676496
875 Ga0501076_0131713
876 Ga0501076_0154538
877 Ga0501076_0567398
878 Ga0501077_0146646
879 Ga0501083_0048815
880 Ga0501083_0167662
881 Ga0501083_0242649
882 Ga0501035_0006803
883 Ga0501044_0508194
884 Ga0501045_0034707
885 Ga0501045_0389789
886 nmdc:mga03683_193586_c1
887 nmdc:mga0yw44_148284_c1
888 nmdc:mga06z11_150138_c1
889 nmdc:mga06z11_256362_c1
890 nmdc:mga06z11_65651_c1
891 nmdc:mga05p37_123510_c1
892 nmdc:mga05p37_163787_c1
893 nmdc:mga05p37_36771_c1
894 nmdc:mga05p37_533926_c1
895 nmdc:mga05p37_54601_c1
896 nmdc:mga0qj67_128116_c1
897 nmdc:mga0qj67_38772_c1
898 nmdc:mga06r32_91005_c1
899 nmdc:mga0n895_179408_c1
900 nmdc:mga0n895_8568_c1
901 nmdc:mga08x19_14321_c1
902 nmdc:mga08x19_382088_c1
903 nmdc:mga0a205_231155_c1
904 Ga0495601_0000006
905 Ga0495601_0067064
906 Ga0495601_0183110
907 Ga0495612_0000004
908 Ga0495612_0009427
909 Ga0495655_0001809
910 Ga0495595_0000051
911 Ga0495619_0000027
912 Ga0495619_0011849
913 Ga0495619_0020714
914 Ga0495619_0074147
915 Ga0495619_0153810
916 Ga0530510_0402470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

34

171

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

34

259

0.74

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

36

266

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9621 1 260
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.9585 1 260
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9515 1 260
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9459 1 258
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.9445 1 260
ID Description Score Start End Superfamily
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9529 1 260 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9484 1 260 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.946 1 258 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9448 1 260 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9321 1 258 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2D7Z661-F1-model_v4 3-oxoadipate enol-lactonase 0.981 1 211 GO:0016020
GO:0042952
GO:0047570
AF-A0A7W1LDM9-F1-model_v4 Alpha/beta fold hydrolase 0.9806 1 112 GO:0016787
AF-A0A7S9CSA5-F1-model_v4 Alpha/beta fold hydrolase 0.9703 1 258 GO:0016020
GO:0016787
AF-A0A832DLV2-F1-model_v4 Alpha/beta fold hydrolase 0.97 10 259 GO:0016787
AF-A0A353ETC5-F1-model_v4 Alpha/beta hydrolase 0.9686 3 258 GO:0016020
GO:0016787

Map