F448400

General Info

Members Datasets Scaffolds Average Seq Length
459 246 451 423

Family's Representative Sequence

Representative Sequence 3300041494|Ga0451837_1323892|Ga0451837_1323892_1446_2864
Length 453
Sequence MTEQTSQTEPAVTAGPPVPLSQQPHTNQELFDRAKKVIPGGVNSPVRAFDAVGGTPYFVSMAAGAHVWDVEGRAYVDLVQSYGAIIAGHAHPRVVEAVRQAAGEGTSYGAPTHREVLLAEAITARVPSCEKVRLVSSGTEATMTAIRLARGATGRNRVVKFAGNYHGHSDVLLAASGSAVAHLDHSDGAAVPGSAGVPPGAVADTSVVPYNVVPTLDDSVACVIVEPVAANMGLVAPVPGFLRGLREECDRVGALLVFDEVITGFRLGVGGAQQVFGVKPDLTCFGKVIGGGLNIGAFGGSAAVMDELAPLGPVYQAGTLSGNPLATAAGLAALSLLDQAAYDQLDSIAMHLAVGLEDAFGHAGLTVRMPRFGSLVGIFAGPDLPHDYESARSTDEALYGRIFHGLLDRGVALAPGAYEVMFPGLAHTEAVVDHVVAAAADVAAEVAAVRTAG

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
5 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
6 2941471342 Luteibacter sp. 621 Isolate Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
246 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 0
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0.44
Rhizoplane 2.4
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000013 3300003373 Bacteria 18346
2 Ga0055536_1004973 3300003781 Bacteria 6607
3 Ga0070658_10171246 3300005327 Bacteria 1824
4 Ga0070683_100118941 3300005329 Bacteria 2495
5 Ga0070670_100006824 3300005331 Bacteria 9670
6 Ga0068869_100077037 3300005334 Bacteria 2479
7 Ga0070666_10000481 3300005335 Bacteria 24156
8 Ga0070666_10036691 3300005335 Bacteria 3255
9 Ga0068868_100157190 3300005338 Bacteria 1875
10 Ga0070661_100001549 3300005344 Bacteria 15981
11 Ga0070661_100143385 3300005344 Bacteria 1801
12 Ga0070668_100098389 3300005347 Bacteria 2315
13 Ga0070675_100039830 3300005354 Bacteria 3835
14 Ga0070671_100031730 3300005355 Bacteria 4367
15 Ga0070671_100136409 3300005355 Bacteria 2069
16 Ga0070667_100047272 3300005367 Bacteria 3620
17 Ga0070667_100134076 3300005367 Bacteria 2164
18 Ga0070663_100026993 3300005455 Bacteria 3894
19 Ga0070678_100059020 3300005456 Bacteria 2818
20 Ga0070678_100059075 3300005456 Bacteria 2817
21 Ga0070662_100156817 3300005457 Bacteria 1778
22 Ga0070681_10000799 3300005458 Bacteria 26246
23 Ga0070699_100000027 3300005518 Bacteria 157339
24 Ga0070684_100063291 3300005535 Bacteria 3242
25 Ga0068853_100048560 3300005539 Bacteria 3646
26 Ga0068853_100119571 3300005539 Bacteria 2348
27 Ga0070672_100005969 3300005543 Bacteria 8127
28 Ga0070693_100028394 3300005547 Bacteria 3042
29 Ga0070665_100001471 3300005548 Bacteria 27594
30 Ga0070665_100048846 3300005548 Bacteria 4247
31 Ga0068855_100029349 3300005563 Bacteria 6577
32 Ga0068855_100088873 3300005563 Bacteria 3568
33 Ga0068855_100265279 3300005563 Bacteria 1911
34 Ga0070664_100067001 3300005564 Bacteria 3067
35 Ga0068857_100157676 3300005577 Bacteria 2058
36 Ga0068854_100165855 3300005578 Bacteria 1715
37 Ga0068856_100024075 3300005614 Bacteria 5924
38 Ga0068852_100028657 3300005616 Bacteria 4562
39 Ga0068852_100122015 3300005616 Bacteria 2388
40 Ga0068859_100245506 3300005617 Bacteria 1880
41 Ga0068864_100013511 3300005618 Bacteria 6770
42 Ga0068866_10074670 3300005718 Bacteria 1803
43 Ga0068851_10000993 3300005834 Bacteria 12285
44 Ga0068863_100055943 3300005841 Bacteria 3735
45 Ga0068858_100008779 3300005842 Bacteria 9693
46 Ga0068858_100046290 3300005842 Bacteria 4033
47 Ga0068858_100138692 3300005842 Bacteria 2283
48 Ga0068860_100014855 3300005843 Bacteria 7613
49 Ga0068860_100032098 3300005843 Bacteria 5049
50 Ga0068860_100034008 3300005843 Bacteria 4890
51 Ga0068862_100025050 3300005844 Bacteria 5008
52 Ga0068862_100175772 3300005844 Bacteria 1919
53 Ga0081455_10005071 3300005937 Bacteria 14542
54 Ga0081455_10016283 3300005937 Bacteria 7184
55 Ga0081538_10000033 3300005981 Bacteria 121023
56 Ga0081538_10000913 3300005981 Bacteria 31836
57 Ga0081538_10037483 3300005981 Bacteria 3145
58 Ga0075365_10005361 3300006038 Bacteria 6909
59 Ga0075365_10008981 3300006038 Bacteria 5714
60 Ga0075365_10155354 3300006038 Bacteria 1592
61 Ga0075364_10001107 3300006051 Bacteria 14405
62 Ga0075364_10009503 3300006051 Bacteria 5835
63 Ga0075364_10071032 3300006051 Bacteria 2293
64 Ga0075364_10132025 3300006051 Bacteria 1676
65 Ga0075364_10186009 3300006051 Bacteria 1406
66 Ga0075362_10008789 3300006177 Bacteria 3880
67 Ga0075367_10125283 3300006178 Bacteria 1585
68 Ga0068871_100049240 3300006358 Bacteria 3405
69 Ga0075428_100003190 3300006844 Bacteria 17936
70 Ga0075428_100044028 3300006844 Bacteria 4906
71 Ga0075430_100002002 3300006846 Bacteria 16787
72 Ga0075430_100009368 3300006846 Bacteria 8278
73 Ga0075431_100000040 3300006847 Bacteria 67199
74 Ga0075431_100107512 3300006847 Bacteria 2878
75 Ga0075431_100189037 3300006847 Bacteria 2110
76 Ga0075433_10006613 3300006852 Bacteria 9176
77 Ga0075429_100000064 3300006880 Bacteria 52724
78 Ga0075429_100164201 3300006880 Bacteria 1945
79 Ga0068865_100001222 3300006881 Bacteria 14943
80 Ga0068865_100020190 3300006881 Bacteria 4320
81 Ga0097620_100245502 3300006931 Bacteria 1880
82 Ga0105240_10001524 3300009093 Bacteria 39410
83 Ga0105240_10028997 3300009093 Bacteria 7219
84 Ga0105240_10039432 3300009093 Bacteria 6049
85 Ga0105240_10064103 3300009093 Bacteria 4567
86 Ga0105240_10241927 3300009093 Bacteria 2092
87 Ga0111539_10000426 3300009094 Bacteria 52948
88 Ga0111539_10041035 3300009094 Bacteria 5567
89 Ga0111539_10090249 3300009094 Bacteria 3601
90 Ga0111539_10095464 3300009094 Bacteria 3493
91 Ga0105245_10029604 3300009098 Bacteria 4840
92 Ga0105245_10228779 3300009098 Bacteria 1798
93 Ga0114129_10013591 3300009147 Bacteria 11600
94 Ga0114129_10023131 3300009147 Bacteria 8815
95 Ga0114129_10055384 3300009147 Bacteria 5558
96 Ga0105243_10011406 3300009148 Bacteria 6725
97 Ga0105241_10020949 3300009174 Bacteria 4832
98 Ga0105241_10143108 3300009174 Bacteria 1949
99 Ga0105241_10163043 3300009174 Bacteria 1834
100 Ga0105242_10020453 3300009176 Bacteria 5190
101 Ga0105242_10055503 3300009176 Bacteria 3240
102 Ga0105237_10122859 3300009545 Bacteria 2590
103 Ga0105238_10001711 3300009551 Bacteria 22113
104 Ga0105238_10007163 3300009551 Bacteria 11153
105 Ga0105238_10010506 3300009551 Bacteria 9293
106 Ga0105238_10131389 3300009551 Bacteria 2482
107 Ga0105249_10086285 3300009553 Bacteria 2927
108 Ga0105249_10243032 3300009553 Bacteria 1781
109 Ga0105239_10052164 3300010375 Bacteria 4485
110 Ga0105239_10095636 3300010375 Bacteria 3281
111 Ga0105239_10183243 3300010375 Bacteria 2343
112 Ga0105239_10380539 3300010375 Bacteria 1596
113 Ga0105239_10461683 3300010375 Bacteria 1441
114 Ga0105246_10017251 3300011119 Bacteria 4587
115 Ga0157373_10135832 3300013100 Bacteria 1729
116 Ga0157370_10009981 3300013104 Bacteria 10047
117 Ga0157369_10000021 3300013105 Bacteria 239073
118 Ga0157369_10010042 3300013105 Bacteria 10812
119 Ga0157369_10026409 3300013105 Bacteria 6441
120 Ga0157369_10033171 3300013105 Bacteria 5676
121 Ga0157374_10078130 3300013296 Bacteria 3134
122 Ga0157378_10134944 3300013297 Bacteria 2287
123 Ga0163162_10000004 3300013306 Bacteria 505593
124 Ga0163162_10028026 3300013306 Bacteria 5572
125 Ga0163162_10040454 3300013306 Bacteria 4661
126 Ga0163162_10102351 3300013306 Bacteria 2957
127 Ga0157372_10006803 3300013307 Bacteria 12157
128 Ga0157372_10087346 3300013307 Bacteria 3538
129 Ga0157375_10000561 3300013308 Bacteria 33401
130 Ga0157375_10064129 3300013308 Bacteria 3657
131 Ga0163163_10003314 3300014325 Bacteria 13659
132 Ga0163163_10004441 3300014325 Bacteria 11964
133 Ga0157379_10022230 3300014968 Bacteria 5618
134 Ga0157376_10003027 3300014969 Bacteria 11520
135 Ga0157376_10010969 3300014969 Bacteria 6659
136 Ga0209233_1000714 3300025261 Bacteria 15470
137 Ga0209025_1000071 3300025294 Bacteria 287297
138 Ga0207656_10008975 3300025321 Bacteria 3704
139 Ga0207656_10035377 3300025321 Bacteria 2091
140 Ga0207680_10004100 3300025903 Bacteria 6891
141 Ga0207680_10008656 3300025903 Bacteria 5010
142 Ga0207680_10015685 3300025903 Bacteria 3961
143 Ga0207647_10000130 3300025904 Bacteria 58985
144 Ga0207654_10002661 3300025911 Bacteria 9070
145 Ga0207707_10047470 3300025912 Bacteria 3739
146 Ga0207707_10132176 3300025912 Bacteria 2182
147 Ga0207695_10000651 3300025913 Bacteria 68979
148 Ga0207695_10003828 3300025913 Bacteria 20854
149 Ga0207695_10005164 3300025913 Bacteria 17475
150 Ga0207695_10019605 3300025913 Bacteria 7782
151 Ga0207695_10022101 3300025913 Bacteria 7234
152 Ga0207671_10005233 3300025914 Bacteria 12050
153 Ga0207671_10019315 3300025914 Bacteria 5212
154 Ga0207671_10038966 3300025914 Bacteria 3521
155 Ga0207671_10062472 3300025914 Bacteria 2766
156 Ga0207671_10109345 3300025914 Bacteria 2102
157 Ga0207663_10090947 3300025916 Bacteria 2025
158 Ga0207657_10011362 3300025919 Bacteria 8845
159 Ga0207649_10005381 3300025920 Bacteria 6931
160 Ga0207694_10001209 3300025924 Bacteria 22391
161 Ga0207694_10007273 3300025924 Bacteria 8401
162 Ga0207694_10018145 3300025924 Bacteria 5320
163 Ga0207694_10052878 3300025924 Bacteria 3148
164 Ga0207650_10003659 3300025925 Bacteria 10514
165 Ga0207659_10015272 3300025926 Bacteria 4971
166 Ga0207644_10136654 3300025931 Bacteria 1883
167 Ga0207706_10001900 3300025933 Bacteria 20517
168 Ga0207686_10054773 3300025934 Bacteria 2500
169 Ga0207709_10021874 3300025935 Bacteria 3623
170 Ga0207704_10001141 3300025938 Bacteria 11810
171 Ga0207704_10022808 3300025938 Bacteria 3361
172 Ga0207704_10028630 3300025938 Bacteria 3094
173 Ga0207691_10044899 3300025940 Bacteria 4065
174 Ga0207689_10053831 3300025942 Bacteria 3315
175 Ga0207661_10082084 3300025944 Bacteria 2664
176 Ga0207667_10012355 3300025949 Bacteria 9847
177 Ga0207667_10037227 3300025949 Bacteria 5202
178 Ga0207667_10091503 3300025949 Bacteria 3142
179 Ga0207712_10000207 3300025961 Bacteria 59439
180 Ga0207712_10163450 3300025961 Bacteria 1733
181 Ga0207668_10061534 3300025972 Bacteria 2641
182 Ga0207640_10079718 3300025981 Bacteria 2233
183 Ga0207658_10046510 3300025986 Bacteria 3169
184 Ga0207677_10229889 3300026023 Bacteria 1493
185 Ga0207703_10006601 3300026035 Bacteria 9257
186 Ga0207703_10032871 3300026035 Bacteria 4109
187 Ga0207639_10000114 3300026041 Bacteria 62176
188 Ga0207639_10010916 3300026041 Bacteria 6298
189 Ga0207639_10148117 3300026041 Bacteria 1963
190 Ga0207678_10000935 3300026067 Bacteria 26620
191 Ga0207678_10024674 3300026067 Bacteria 5251
192 Ga0207702_10072574 3300026078 Bacteria 2967
193 Ga0207648_10003839 3300026089 Bacteria 15698
194 Ga0207648_10018265 3300026089 Bacteria 6352
195 Ga0207676_10073242 3300026095 Bacteria 2756
196 Ga0207674_10025688 3300026116 Bacteria 6272
197 Ga0207683_10022519 3300026121 Bacteria 5408
198 Ga0207698_10008590 3300026142 Bacteria 6471
199 Ga0207698_10020973 3300026142 Bacteria 4510
200 Ga0207698_10053091 3300026142 Bacteria 3109
201 Ga0207428_10024096 3300027907 Bacteria 5110
202 Ga0268266_10000007 3300028379 Bacteria 1372921
203 Ga0268264_10024110 3300028381 Bacteria 4966
204 Ga0265327_10000222 3300031251 Bacteria 115792
205 Ga0307508_10009313 3300031616 Bacteria 9036
206 Ga0316576_10005229 3300031727 Bacteria 7897
207 Ga0316576_10007501 3300031727 Bacteria 6875
208 Ga0316576_10047466 3300031727 Bacteria 3112
209 Ga0316578_10032287 3300031728 Bacteria 2990
210 Ga0307414_10044095 3300032004 Bacteria 3042
211 Ga0307411_10037439 3300032005 Bacteria 3051
212 Ga0307415_100029669 3300032126 Bacteria 3499
213 Ga0373929_0000829 3300035085 Bacteria 6030
214 Ga0373932_0013072 3300035112 Bacteria 2057
215 Ga0373931_0000003 3300035691 Bacteria 560286
216 Ga0373931_0000198 3300035691 Bacteria 25659
217 Ga0373937_0022565 3300036401 Bacteria 5661
218 Ga0373937_0122878 3300036401 Bacteria 2420
219 Ga0316584_0126078 3300036712 Bacteria 1912
220 Ga0373925_0204291 3300037068 Bacteria 1572
221 Ga0395899_0001004 3300037312 Bacteria 25887
222 Ga0395899_0002787 3300037312 Bacteria 14085
223 Ga0395899_0004846 3300037312 Bacteria 10479
224 Ga0395900_0000656 3300037418 Bacteria 46333
225 Ga0395900_0006056 3300037418 Bacteria 12613
226 Ga0395898_0082118 3300037466 Bacteria 3107
227 Ga0395905_0041247 3300037471 Bacteria 4331
228 Ga0395905_0103282 3300037471 Bacteria 2676
229 Ga0436362_0589359 3300039453 Bacteria 2497
230 Ga0451837_1323892 3300041494 Bacteria 5138
231 Ga0439463_000634 3300042016 Bacteria 9721
232 Ga0450908_000141 3300042184 Bacteria 14773
233 Ga0451577_0012938 3300042876 Bacteria 7832
234 Ga0451577_0119244 3300042876 Bacteria 2363
235 Ga0466982_0002192 3300044672 Bacteria 7796
236 Ga0453684_0004550 3300044712 Bacteria 29029
237 Ga0466968_0001344 3300044735 Bacteria 8769
238 Ga0495629_0059659 3300046459 Bacteria 2667
239 Ga0495638_0006707 3300046460 Bacteria 8340
240 Ga0495651_0065704 3300046462 Bacteria 2769
241 Ga0495653_0082102 3300046463 Bacteria 2380
242 Ga0495580_0093311 3300046472 Bacteria 2095
243 Ga0495582_0074981 3300046473 Bacteria 1873
244 Ga0495582_0075210 3300046473 Bacteria 1870
245 Ga0495584_0106352 3300046491 Bacteria 1418
246 Ga0495585_0000525 3300046492 Bacteria 36200
247 Ga0495596_0002458 3300046500 Bacteria 9957
248 Ga0495583_0062324 3300046506 Bacteria 1661
249 Ga0495606_0003479 3300046507 Bacteria 16682
250 Ga0495608_0029543 3300046511 Bacteria 3717
251 Ga0495608_0053900 3300046511 Bacteria 2659
252 Ga0495616_0000831 3300046513 Bacteria 22547
253 Ga0495631_0008303 3300046518 Bacteria 5234
254 Ga0495631_0010538 3300046518 Bacteria 4571
255 Ga0495632_0009555 3300046519 Bacteria 5834
256 Ga0495665_0091743 3300046531 Bacteria 1596
257 Ga0495587_0015933 3300046536 Bacteria 4680
258 Ga0495609_0003842 3300046538 Bacteria 8452
259 Ga0495597_0008973 3300046542 Bacteria 4983
260 Ga0495667_0026936 3300046559 Bacteria 3874
261 Ga0495634_0152632 3300046642 Bacteria 1460
262 Ga0495611_0047882 3300046648 Bacteria 1919
263 Ga0495588_0063250 3300046674 Bacteria 1918
264 Ga0495657_0080963 3300046675 Bacteria 2101
265 Ga0495657_0123145 3300046675 Bacteria 1631
266 Ga0495623_0044057 3300046679 Bacteria 2836
267 Ga0495647_0022864 3300046681 Bacteria 2262
268 Ga0495658_0034055 3300046683 Bacteria 2793
269 Ga0495670_0002728 3300046691 Bacteria 8721
270 Ga0495670_0020993 3300046691 Bacteria 3220
271 Ga0495636_0005683 3300047318 Bacteria 4888
272 Ga0495672_0000884 3300047320 Bacteria 31539
273 Ga0495680_0295272 3300047322 Bacteria 1139
274 Ga0495675_0111780 3300047444 Bacteria 1705
275 Ga0495686_0016408 3300047472 Bacteria 5022
276 Ga0495602_0058621 3300048088 Bacteria 3369
277 Ga0496101_0031345 3300048904 Bacteria 3736
278 Ga0496102_0185919 3300048905 Bacteria 1958
279 Ga0496103_0031429 3300048906 Bacteria 3234
280 Ga0496104_0001740 3300048907 Bacteria 18804
281 Ga0496105_0000024 3300048908 Bacteria 153740
282 Ga0496105_0280928 3300048908 Bacteria 1342
283 Ga0496106_0012498 3300048909 Bacteria 6271
284 Ga0496106_0024568 3300048909 Bacteria 4481
285 Ga0496107_0085669 3300048910 Bacteria 2299
286 Ga0496109_0435282 3300048912 Bacteria 1239
287 Ga0496111_0007564 3300048914 Bacteria 7128
288 Ga0496117_0072422 3300048920 Bacteria 2304
289 Ga0496118_0042563 3300048921 Bacteria 3581
290 Ga0496121_0001206 3300048924 Bacteria 45212
291 Ga0496121_0008379 3300048924 Bacteria 12189
292 Ga0496121_0023206 3300048924 Bacteria 5985
293 Ga0496122_0029178 3300048925 Bacteria 4660
294 Ga0496122_0047496 3300048925 Bacteria 3314
295 Ga0496122_0174291 3300048925 Bacteria 1292
296 Ga0496123_0037794 3300048926 Bacteria 3404
297 Ga0496123_0044546 3300048926 Bacteria 3033
298 Ga0496124_0000088 3300048927 Bacteria 194644
299 Ga0496125_0004570 3300048928 Bacteria 15867
300 Ga0501031_0029682 3300049568 Bacteria 3568
301 Ga0501031_0067999 3300049568 Bacteria 2320
302 Ga0501032_0003038 3300049569 Bacteria 13010
303 Ga0501033_0003012 3300049570 Bacteria 14061
304 Ga0501033_0027934 3300049570 Bacteria 4241
305 Ga0501033_0030145 3300049570 Bacteria 4075
306 Ga0501033_0069952 3300049570 Bacteria 2579
307 Ga0501033_0138177 3300049570 Bacteria 1763
308 Ga0501034_0000282 3300049571 Bacteria 91445
309 Ga0501034_0006544 3300049571 Bacteria 12513
310 Ga0501034_0007675 3300049571 Bacteria 11480
311 Ga0501034_0010286 3300049571 Bacteria 9755
312 Ga0501034_0015625 3300049571 Bacteria 7797
313 Ga0501034_0024094 3300049571 Bacteria 6192
314 Ga0501034_0032217 3300049571 Bacteria 5324
315 Ga0501034_0058574 3300049571 Bacteria 3871
316 Ga0501034_0135837 3300049571 Bacteria 2440
317 Ga0501036_0001984 3300049572 Bacteria 15878
318 Ga0501036_0008011 3300049572 Bacteria 8648
319 Ga0501036_0011869 3300049572 Bacteria 7221
320 Ga0501036_0012524 3300049572 Bacteria 7033
321 Ga0501036_0152138 3300049572 Bacteria 1951
322 Ga0501036_0185960 3300049572 Bacteria 1748
323 Ga0501037_0012090 3300049573 Bacteria 6358
324 Ga0501037_0036445 3300049573 Bacteria 3625
325 Ga0501037_0064437 3300049573 Bacteria 2671
326 Ga0501038_0005233 3300049574 Bacteria 12058
327 Ga0501038_0005992 3300049574 Bacteria 11244
328 Ga0501038_0116030 3300049574 Bacteria 2213
329 Ga0501039_0017866 3300049575 Bacteria 5440
330 Ga0501039_0077501 3300049575 Bacteria 2585
331 Ga0501039_0078140 3300049575 Bacteria 2574
332 Ga0501040_0000391 3300049576 Bacteria 25895
333 Ga0501040_0002344 3300049576 Bacteria 12161
334 Ga0501041_0001397 3300049577 Bacteria 13348
335 Ga0501041_0002274 3300049577 Bacteria 10868
336 Ga0501041_0037044 3300049577 Bacteria 2955
337 Ga0501042_0016732 3300049578 Bacteria 5041
338 Ga0501042_0058986 3300049578 Bacteria 2740
339 Ga0501042_0071683 3300049578 Bacteria 2479
340 Ga0501043_0017919 3300049579 Bacteria 5554
341 Ga0501043_0027486 3300049579 Bacteria 4466
342 Ga0501043_0084964 3300049579 Bacteria 2487
343 Ga0501043_0157475 3300049579 Bacteria 1776
344 Ga0501046_0031560 3300049580 Bacteria 4293
345 Ga0501046_0171461 3300049580 Bacteria 1628
346 Ga0501047_0001965 3300049581 Bacteria 19740
347 Ga0501047_0010044 3300049581 Bacteria 8946
348 Ga0501047_0018368 3300049581 Bacteria 6703
349 Ga0501047_0081160 3300049581 Bacteria 3118
350 Ga0501048_0004193 3300049582 Bacteria 10990
351 Ga0501048_0014710 3300049582 Bacteria 5789
352 Ga0501048_0019034 3300049582 Bacteria 5045
353 Ga0501067_0002574 3300049583 Bacteria 10022
354 Ga0501068_0004213 3300049584 Bacteria 7802
355 Ga0501068_0004236 3300049584 Bacteria 7782
356 Ga0501068_0042357 3300049584 Bacteria 2738
357 Ga0501069_0003234 3300049585 Bacteria 8355
358 Ga0501070_0009340 3300049586 Bacteria 8292
359 Ga0501070_0009480 3300049586 Bacteria 8229
360 Ga0501070_0031287 3300049586 Bacteria 4458
361 Ga0501071_0001412 3300049587 Bacteria 13811
362 Ga0501071_0009766 3300049587 Bacteria 6403
363 Ga0501071_0022249 3300049587 Bacteria 4419
364 Ga0501071_0035254 3300049587 Bacteria 3563
365 Ga0501071_0097158 3300049587 Bacteria 2168
366 Ga0501072_0002421 3300049588 Bacteria 13966
367 Ga0501072_0002919 3300049588 Bacteria 12863
368 Ga0501072_0003011 3300049588 Bacteria 12704
369 Ga0501072_0051126 3300049588 Bacteria 3254
370 Ga0501073_0012226 3300049589 Bacteria 6267
371 Ga0501073_0013279 3300049589 Bacteria 6000
372 Ga0501073_0161927 3300049589 Bacteria 1550
373 Ga0501074_0000819 3300049590 Bacteria 19705
374 Ga0501074_0011749 3300049590 Bacteria 6363
375 Ga0501074_0011826 3300049590 Bacteria 6345
376 Ga0501074_0021929 3300049590 Bacteria 4638
377 Ga0501074_0038869 3300049590 Bacteria 3447
378 Ga0501074_0095757 3300049590 Bacteria 2126
379 Ga0501075_0000989 3300049591 Bacteria 18118
380 Ga0501075_0004251 3300049591 Bacteria 9679
381 Ga0501075_0031249 3300049591 Bacteria 3951
382 Ga0501075_0164257 3300049591 Bacteria 1694
383 Ga0501076_0002252 3300049592 Bacteria 13204
384 Ga0501076_0039532 3300049592 Bacteria 3703
385 Ga0501076_0114602 3300049592 Bacteria 2181
386 Ga0501076_0167934 3300049592 Bacteria 1788
387 Ga0501077_0000693 3300049593 Bacteria 20370
388 Ga0501077_0000767 3300049593 Bacteria 19373
389 Ga0501079_0006197 3300049741 Bacteria 8975
390 Ga0501079_0030305 3300049741 Bacteria 4157
391 Ga0501079_0260836 3300049741 Bacteria 1354
392 Ga0501080_0015184 3300049742 Bacteria 7096
393 Ga0501080_0015700 3300049742 Bacteria 6982
394 Ga0501080_0016184 3300049742 Bacteria 6884
395 Ga0501080_0020546 3300049742 Bacteria 6115
396 Ga0501080_0035021 3300049742 Bacteria 4688
397 Ga0501080_0037618 3300049742 Bacteria 4520
398 Ga0501080_0158355 3300049742 Bacteria 2092
399 Ga0501081_0018854 3300049743 Bacteria 4584
400 Ga0501083_0004043 3300049744 Bacteria 10319
401 Ga0501083_0008330 3300049744 Bacteria 7332
402 Ga0501083_0012313 3300049744 Bacteria 5986
403 Ga0501035_0011492 3300049822 Bacteria 8205
404 Ga0501035_0016137 3300049822 Bacteria 6892
405 Ga0501035_0030324 3300049822 Bacteria 4931
406 Ga0501035_0055489 3300049822 Bacteria 3537
407 Ga0501035_0139355 3300049822 Bacteria 2110
408 Ga0501044_0009991 3300049823 Bacteria 10310
409 Ga0501044_0011743 3300049823 Bacteria 9487
410 Ga0501044_0025529 3300049823 Bacteria 6263
411 Ga0501044_0033828 3300049823 Bacteria 5367
412 Ga0501044_0249264 3300049823 Bacteria 1717
413 Ga0501045_0002037 3300049824 Bacteria 13647
414 Ga0501045_0005829 3300049824 Bacteria 8530
415 Ga0501045_0007594 3300049824 Bacteria 7537
416 Ga0501045_0049444 3300049824 Bacteria 3066
417 nmdc:mga00v17_13254_c1 3300050491 Bacteria 4571
418 nmdc:mga00v17_4242_c1 3300050491 Bacteria 7440
419 nmdc:mga00v17_846_c1 3300050491 Bacteria 16583
420 nmdc:mga0yw44_40941_c1 3300050492 Bacteria 2756
421 nmdc:mga0yw44_466_c1 3300050492 Bacteria 14375
422 nmdc:mga0yw44_4813_c2 3300050492 Bacteria 5971
423 nmdc:mga0yw44_56520_c1 3300050492 Bacteria 2391
424 nmdc:mga0yw44_63682_c1 3300050492 Bacteria 2268
425 nmdc:mga06z11_89670_c1 3300050494 Bacteria 1667
426 nmdc:mga04h51_12535_c1 3300050495 Bacteria 2381
427 nmdc:mga09592_197338_c1 3300050508 Bacteria 1743
428 nmdc:mga09592_796_c1 3300050508 Bacteria 24402
429 nmdc:mga0qj67_12458_c1 3300050509 Bacteria 6406
430 nmdc:mga0qj67_6216_c1 3300050509 Bacteria 8767
431 nmdc:mga06r32_153866_c1 3300050510 Bacteria 2279
432 nmdc:mga06r32_32707_c1 3300050510 Bacteria 4896
433 nmdc:mga06r32_60827_c1 3300050510 Bacteria 3635
434 nmdc:mga06r32_810_c1 3300050510 Bacteria 27781
435 nmdc:mga08y16_19888_c1 3300050511 Bacteria 7082
436 nmdc:mga0a205_34854_c1 3300050515 Bacteria 4831
437 Ga0495619_0017931 3300053085 Bacteria 4488
438 Ga0500566_0000443 3300053094 Bacteria 23094
439 Ga0500616_0000684 3300053153 Bacteria 39734
440 Ga0501084_0009817 3300054114 Bacteria 7912
441 Ga0501084_0010979 3300054114 Bacteria 7501
442 Ga0501084_0187711 3300054114 Bacteria 1744
443 Ga0501082_0005574 3300060353 Bacteria 10934
444 Ga0501082_0009701 3300060353 Bacteria 8289
445 Ga0501082_0022961 3300060353 Bacteria 5377
446 Ga0501082_0028851 3300060353 Bacteria 4781
447 Ga0501082_0047072 3300060353 Bacteria 3717
448 Ga0501082_0211962 3300060353 Bacteria 1685
449 Ga0530510_0000984 3300061734 Bacteria 18861
450 Ga0530510_0020922 3300061734 Bacteria 4653
451 Ga0530510_0021667 3300061734 Bacteria 4572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10241927 Ga0105240_102419273 355
2 3300047322 Ga0495680_0295272 Ga0495680_0295272_15_1106 355
3 3300009098 Ga0105245_10228779 Ga0105245_102287792 356
4 3300010375 Ga0105239_10183243 Ga0105239_101832433 356
5 3300013296 Ga0157374_10078130 Ga0157374_100781303 356
6 3300046642 Ga0495634_0152632 Ga0495634_0152632_346_1446 356
7 3300049575 Ga0501039_0077501 Ga0501039_0077501_1437_2543 356
8 3300049570 Ga0501033_0027934 Ga0501033_0027934_16_1155 365
9 3300046491 Ga0495584_0106352 Ga0495584_0106352_249_1400 374
10 3300048905 Ga0496102_0185919 Ga0496102_0185919_14_1156 374
11 3300049741 Ga0501079_0030305 Ga0501079_0030305_1963_3294 381
12 3300048912 Ga0496109_0435282 Ga0496109_0435282_28_1194 382
13 3300049741 Ga0501079_0260836 Ga0501079_0260836_15_1178 382
14 3300060353 Ga0501082_0211962 Ga0501082_0211962_505_1668 382
15 3300009094 Ga0111539_10041035 Ga0111539_100410355 385
16 3300037312 Ga0395899_0001004 Ga0395899_0001004_15121_16404 385
17 3300006178 Ga0075367_10125283 Ga0075367_101252832 386
18 3300050494 nmdc:mga06z11_89670_c1 nmdc:mga06z11_89670_c1_54_1352 386
19 3300050515 nmdc:mga0a205_34854_c1 nmdc:mga0a205_34854_c1_128_1327 389
20 3300005617 Ga0068859_100245506 Ga0068859_1002455062 391
21 3300006931 Ga0097620_100245502 Ga0097620_1002455022 391
22 3300031727 Ga0316576_10047466 Ga0316576_100474663 391
23 3300006051 Ga0075364_10186009 Ga0075364_101860091 396
24 3300005563 Ga0068855_100029349 Ga0068855_1000293495 398
25 3300013100 Ga0157373_10135832 Ga0157373_101358322 398
26 3300025949 Ga0207667_10091503 Ga0207667_100915034 398
27 3300037418 Ga0395900_0000656 Ga0395900_0000656_3174_4460 398
28 3300005981 Ga0081538_10000913 Ga0081538_1000091337 399
29 3300049568 Ga0501031_0067999 Ga0501031_0067999_939_2192 399
30 3300049570 Ga0501033_0030145 Ga0501033_0030145_1074_2327 399
31 3300049572 Ga0501036_0008011 Ga0501036_0008011_5300_6553 399
32 3300049573 Ga0501037_0036445 Ga0501037_0036445_548_1801 399
33 3300049574 Ga0501038_0005992 Ga0501038_0005992_7884_9137 399
34 3300049576 Ga0501040_0002344 Ga0501040_0002344_6256_7509 399
35 3300049577 Ga0501041_0002274 Ga0501041_0002274_7812_9065 399
36 3300049578 Ga0501042_0016732 Ga0501042_0016732_2638_3891 399
37 3300049582 Ga0501048_0004193 Ga0501048_0004193_6044_7297 399
38 3300049587 Ga0501071_0035254 Ga0501071_0035254_129_1382 399
39 3300049588 Ga0501072_0002421 Ga0501072_0002421_5303_6556 399
40 3300049589 Ga0501073_0161927 Ga0501073_0161927_46_1299 399
41 3300049590 Ga0501074_0021929 Ga0501074_0021929_1589_2842 399
42 3300049591 Ga0501075_0004251 Ga0501075_0004251_3912_5165 399
43 3300049591 Ga0501075_0031249 Ga0501075_0031249_2702_3913 399
44 3300049593 Ga0501077_0000693 Ga0501077_0000693_18643_19896 399
45 3300049824 Ga0501045_0005829 Ga0501045_0005829_4873_6126 399
46 3300060353 Ga0501082_0009701 Ga0501082_0009701_2524_3777 399
47 3300061734 Ga0530510_0021667 Ga0530510_0021667_1097_2350 399
48 3300005937 Ga0081455_10005071 Ga0081455_100050715 400
49 3300035085 Ga0373929_0000829 Ga0373929_0000829_1034_2299 401
50 3300035691 Ga0373931_0000003 Ga0373931_0000003_482338_483603 401
51 3300042016 Ga0439463_000634 Ga0439463_000634_5629_6882 403
52 3300048925 Ga0496122_0174291 Ga0496122_0174291_11_1252 403
53 3300042876 Ga0451577_0012938 Ga0451577_0012938_3872_5143 404
54 3300044712 Ga0453684_0004550 Ga0453684_0004550_1270_2541 404
55 3300049577 Ga0501041_0037044 Ga0501041_0037044_834_2207 404
56 3300050492 nmdc:mga0yw44_56520_c1 nmdc:mga0yw44_56520_c1_497_1762 404
57 3300036401 Ga0373937_0122878 Ga0373937_0122878_726_2048 405
58 3300046462 Ga0495651_0065704 Ga0495651_0065704_1240_2562 405
59 3300046463 Ga0495653_0082102 Ga0495653_0082102_262_1584 405
60 3300046511 Ga0495608_0053900 Ga0495608_0053900_132_1454 405
61 3300046536 Ga0495587_0015933 Ga0495587_0015933_1342_2664 405
62 3300046559 Ga0495667_0026936 Ga0495667_0026936_1228_2550 405
63 3300046675 Ga0495657_0123145 Ga0495657_0123145_235_1557 405
64 3300046679 Ga0495623_0044057 Ga0495623_0044057_725_2047 405
65 3300047444 Ga0495675_0111780 Ga0495675_0111780_127_1449 405
66 3300053085 Ga0495619_0017931 Ga0495619_0017931_1165_2487 405
67 3300005937 Ga0081455_10016283 Ga0081455_100162832 406
68 3300049584 Ga0501068_0042357 Ga0501068_0042357_261_1535 406
69 3300049585 Ga0501069_0003234 Ga0501069_0003234_3878_5152 406
70 3300049586 Ga0501070_0031287 Ga0501070_0031287_121_1395 406
71 3300049744 Ga0501083_0012313 Ga0501083_0012313_3546_4820 406
72 3300054114 Ga0501084_0009817 Ga0501084_0009817_5234_6508 406
73 3300006038 Ga0075365_10008981 Ga0075365_100089812 407
74 3300006177 Ga0075362_10008789 Ga0075362_100087892 407
75 3300037471 Ga0395905_0103282 Ga0395905_0103282_444_1727 407
76 3300048088 Ga0495602_0058621 Ga0495602_0058621_2011_3333 407
77 3300050491 nmdc:mga00v17_13254_c1 nmdc:mga00v17_13254_c1_1818_3116 407
78 3300050492 nmdc:mga0yw44_4813_c2 nmdc:mga0yw44_4813_c2_839_2137 407
79 3300006844 Ga0075428_100044028 Ga0075428_1000440283 408
80 3300013297 Ga0157378_10134944 Ga0157378_101349442 408
81 3300046681 Ga0495647_0022864 Ga0495647_0022864_230_1471 408
82 3300049568 Ga0501031_0029682 Ga0501031_0029682_555_1823 408
83 3300049572 Ga0501036_0012524 Ga0501036_0012524_4992_6260 408
84 3300049575 Ga0501039_0017866 Ga0501039_0017866_901_2169 408
85 3300049576 Ga0501040_0000391 Ga0501040_0000391_22121_23389 408
86 3300049577 Ga0501041_0001397 Ga0501041_0001397_9075_10343 408
87 3300049579 Ga0501043_0027486 Ga0501043_0027486_1825_3093 408
88 3300049582 Ga0501048_0014710 Ga0501048_0014710_984_2252 408
89 3300049587 Ga0501071_0001412 Ga0501071_0001412_7325_8593 408
90 3300049588 Ga0501072_0003011 Ga0501072_0003011_9874_11142 408
91 3300049590 Ga0501074_0038869 Ga0501074_0038869_1667_2935 408
92 3300049591 Ga0501075_0000989 Ga0501075_0000989_6688_7956 408
93 3300049593 Ga0501077_0000767 Ga0501077_0000767_9128_10396 408
94 3300049741 Ga0501079_0006197 Ga0501079_0006197_3244_4512 408
95 3300049742 Ga0501080_0037618 Ga0501080_0037618_3200_4468 408
96 3300049743 Ga0501081_0018854 Ga0501081_0018854_2495_3763 408
97 3300049824 Ga0501045_0002037 Ga0501045_0002037_3141_4409 408
98 3300050510 nmdc:mga06r32_60827_c1 nmdc:mga06r32_60827_c1_201_1559 408
99 3300060353 Ga0501082_0005574 Ga0501082_0005574_2158_3426 408
100 3300061734 Ga0530510_0000984 Ga0530510_0000984_16118_17386 408
101 3300006038 Ga0075365_10005361 Ga0075365_100053613 409
102 3300050492 nmdc:mga0yw44_466_c1 nmdc:mga0yw44_466_c1_9511_10776 409
103 3300006880 Ga0075429_100164201 Ga0075429_1001642011 410
104 3300009094 Ga0111539_10090249 Ga0111539_100902492 410
105 3300037471 Ga0395905_0041247 Ga0395905_0041247_2375_3658 410
106 3300049592 Ga0501076_0002252 Ga0501076_0002252_661_1929 410
107 3300049822 Ga0501035_0030324 Ga0501035_0030324_508_1776 410
108 3300050508 nmdc:mga09592_197338_c1 nmdc:mga09592_197338_c1_86_1366 410
109 3300054114 Ga0501084_0010979 Ga0501084_0010979_2411_3679 410
110 3300037418 Ga0395900_0006056 Ga0395900_0006056_2527_3813 411
111 3300049571 Ga0501034_0135837 Ga0501034_0135837_726_1970 411
112 3300049824 Ga0501045_0049444 Ga0501045_0049444_636_1910 411
113 3300006846 Ga0075430_100009368 Ga0075430_1000093684 413
114 3300009147 Ga0114129_10013591 Ga0114129_1001359111 413
115 3300050508 nmdc:mga09592_796_c1 nmdc:mga09592_796_c1_14935_16188 413
116 3300050509 nmdc:mga0qj67_12458_c1 nmdc:mga0qj67_12458_c1_3487_4740 413
117 3300050510 nmdc:mga06r32_810_c1 nmdc:mga06r32_810_c1_24625_25878 413
118 iso_pu_bacteria 2855730933 2855735109 413
119 iso_pu_bacteria 2855767633 2855770893 413
120 iso_pu_bacteria 2857542790 2857547524 413
121 iso_pu_bacteria 2887375801 2887375852 413
122 iso_pu_bacteria 2941471342 2941474671 413
123 iso_pu_bacteria 8002392321 8002395584 413
124 iso_pu_bacteria 8048746797 8048748647 413
125 3300005347 Ga0070668_100098389 Ga0070668_1000983892 414
126 3300005843 Ga0068860_100032098 Ga0068860_1000320984 414
127 3300005844 Ga0068862_100025050 Ga0068862_1000250502 414
128 3300006847 Ga0075431_100107512 Ga0075431_1001075123 414
129 3300025972 Ga0207668_10061534 Ga0207668_100615342 414
130 3300050510 nmdc:mga06r32_32707_c1 nmdc:mga06r32_32707_c1_1315_2595 414
131 iso_pu_bacteria 2574179768 2574431154 414
132 3300049744 Ga0501083_0004043 Ga0501083_0004043_8686_9948 415
133 3300005354 Ga0070675_100039830 Ga0070675_1000398303 416
134 3300005355 Ga0070671_100136409 Ga0070671_1001364092 416
135 3300005456 Ga0070678_100059020 Ga0070678_1000590202 416
136 3300005456 Ga0070678_100059075 Ga0070678_1000590753 416
137 3300005539 Ga0068853_100048560 Ga0068853_1000485604 416
138 3300005543 Ga0070672_100005969 Ga0070672_1000059696 416
139 3300005548 Ga0070665_100048846 Ga0070665_1000488461 416
140 3300006038 Ga0075365_10155354 Ga0075365_101553542 416
141 3300006358 Ga0068871_100049240 Ga0068871_1000492402 416
142 3300006881 Ga0068865_100001222 Ga0068865_1000012227 416
143 3300009098 Ga0105245_10029604 Ga0105245_100296045 416
144 3300009176 Ga0105242_10020453 Ga0105242_100204532 416
145 3300009551 Ga0105238_10131389 Ga0105238_101313893 416
146 3300010375 Ga0105239_10461683 Ga0105239_104616831 416
147 3300013306 Ga0163162_10028026 Ga0163162_100280262 416
148 3300013308 Ga0157375_10000561 Ga0157375_1000056125 416
149 3300014969 Ga0157376_10003027 Ga0157376_1000302710 416
150 3300014969 Ga0157376_10010969 Ga0157376_100109697 416
151 3300025916 Ga0207663_10090947 Ga0207663_100909472 416
152 3300025924 Ga0207694_10018145 Ga0207694_100181451 416
153 3300025926 Ga0207659_10015272 Ga0207659_100152724 416
154 3300025931 Ga0207644_10136654 Ga0207644_101366541 416
155 3300025934 Ga0207686_10054773 Ga0207686_100547732 416
156 3300025938 Ga0207704_10001141 Ga0207704_100011416 416
157 3300025938 Ga0207704_10028630 Ga0207704_100286302 416
158 3300026095 Ga0207676_10073242 Ga0207676_100732422 416
159 3300036401 Ga0373937_0022565 Ga0373937_0022565_1287_2561 416
160 3300046472 Ga0495580_0093311 Ga0495580_0093311_527_1801 416
161 3300046473 Ga0495582_0075210 Ga0495582_0075210_347_1621 416
162 3300046531 Ga0495665_0091743 Ga0495665_0091743_253_1527 416
163 3300046675 Ga0495657_0080963 Ga0495657_0080963_781_2055 416
164 3300048907 Ga0496104_0001740 Ga0496104_0001740_2977_4251 416
165 3300048908 Ga0496105_0000024 Ga0496105_0000024_3005_4279 416
166 3300050495 nmdc:mga04h51_12535_c1 nmdc:mga04h51_12535_c1_499_1845 416
167 3300003373 JGI25407J50210_10000013 JGI25407J50210_100000135 417
168 3300003781 Ga0055536_1004973 Ga0055536_10049734 417
169 3300005327 Ga0070658_10171246 Ga0070658_101712461 417
170 3300005329 Ga0070683_100118941 Ga0070683_1001189413 417
171 3300005331 Ga0070670_100006824 Ga0070670_10000682413 417
172 3300005334 Ga0068869_100077037 Ga0068869_1000770374 417
173 3300005335 Ga0070666_10000481 Ga0070666_100004813 417
174 3300005335 Ga0070666_10036691 Ga0070666_100366915 417
175 3300005338 Ga0068868_100157190 Ga0068868_1001571902 417
176 3300005344 Ga0070661_100001549 Ga0070661_1000015499 417
177 3300005344 Ga0070661_100143385 Ga0070661_1001433852 417
178 3300005355 Ga0070671_100031730 Ga0070671_1000317304 417
179 3300005367 Ga0070667_100047272 Ga0070667_1000472724 417
180 3300005367 Ga0070667_100134076 Ga0070667_1001340762 417
181 3300005455 Ga0070663_100026993 Ga0070663_1000269933 417
182 3300005457 Ga0070662_100156817 Ga0070662_1001568172 417
183 3300005458 Ga0070681_10000799 Ga0070681_100007995 417
184 3300005518 Ga0070699_100000027 Ga0070699_100000027116 417
185 3300005535 Ga0070684_100063291 Ga0070684_1000632912 417
186 3300005539 Ga0068853_100119571 Ga0068853_1001195712 417
187 3300005547 Ga0070693_100028394 Ga0070693_1000283943 417
188 3300005548 Ga0070665_100001471 Ga0070665_10000147119 417
189 3300005563 Ga0068855_100088873 Ga0068855_1000888733 417
190 3300005563 Ga0068855_100265279 Ga0068855_1002652792 417
191 3300005564 Ga0070664_100067001 Ga0070664_1000670012 417
192 3300005577 Ga0068857_100157676 Ga0068857_1001576762 417
193 3300005578 Ga0068854_100165855 Ga0068854_1001658552 417
194 3300005614 Ga0068856_100024075 Ga0068856_1000240751 417
195 3300005616 Ga0068852_100028657 Ga0068852_1000286572 417
196 3300005616 Ga0068852_100122015 Ga0068852_1001220152 417
197 3300005618 Ga0068864_100013511 Ga0068864_1000135118 417
198 3300005718 Ga0068866_10074670 Ga0068866_100746702 417
199 3300005834 Ga0068851_10000993 Ga0068851_1000099312 417
200 3300005841 Ga0068863_100055943 Ga0068863_1000559434 417
201 3300005842 Ga0068858_100008779 Ga0068858_10000877913 417
202 3300005842 Ga0068858_100046290 Ga0068858_1000462902 417
203 3300005842 Ga0068858_100138692 Ga0068858_1001386922 417
204 3300005843 Ga0068860_100014855 Ga0068860_1000148555 417
205 3300005843 Ga0068860_100034008 Ga0068860_1000340086 417
206 3300005844 Ga0068862_100175772 Ga0068862_1001757722 417
207 3300005981 Ga0081538_10000033 Ga0081538_1000003337 417
208 3300005981 Ga0081538_10037483 Ga0081538_100374833 417
209 3300006051 Ga0075364_10001107 Ga0075364_100011077 417
210 3300006051 Ga0075364_10009503 Ga0075364_100095032 417
211 3300006051 Ga0075364_10071032 Ga0075364_100710322 417
212 3300006051 Ga0075364_10132025 Ga0075364_101320252 417
213 3300006844 Ga0075428_100003190 Ga0075428_1000031903 417
214 3300006846 Ga0075430_100002002 Ga0075430_1000020024 417
215 3300006847 Ga0075431_100000040 Ga0075431_10000004075 417
216 3300006847 Ga0075431_100189037 Ga0075431_1001890372 417
217 3300006852 Ga0075433_10006613 Ga0075433_100066137 417
218 3300006880 Ga0075429_100000064 Ga0075429_10000006419 417
219 3300006881 Ga0068865_100020190 Ga0068865_1000201903 417
220 3300009093 Ga0105240_10001524 Ga0105240_1000152434 417
221 3300009093 Ga0105240_10028997 Ga0105240_100289975 417
222 3300009093 Ga0105240_10039432 Ga0105240_100394325 417
223 3300009093 Ga0105240_10064103 Ga0105240_100641032 417
224 3300009094 Ga0111539_10000426 Ga0111539_1000042614 417
225 3300009094 Ga0111539_10095464 Ga0111539_100954643 417
226 3300009147 Ga0114129_10023131 Ga0114129_100231315 417
227 3300009147 Ga0114129_10055384 Ga0114129_100553842 417
228 3300009148 Ga0105243_10011406 Ga0105243_100114063 417
229 3300009174 Ga0105241_10020949 Ga0105241_100209495 417
230 3300009174 Ga0105241_10143108 Ga0105241_101431082 417
231 3300009174 Ga0105241_10163043 Ga0105241_101630432 417
232 3300009176 Ga0105242_10055503 Ga0105242_100555032 417
233 3300009545 Ga0105237_10122859 Ga0105237_101228592 417
234 3300009551 Ga0105238_10001711 Ga0105238_100017113 417
235 3300009551 Ga0105238_10007163 Ga0105238_1000716314 417
236 3300009551 Ga0105238_10010506 Ga0105238_1001050610 417
237 3300009553 Ga0105249_10086285 Ga0105249_100862852 417
238 3300009553 Ga0105249_10243032 Ga0105249_102430322 417
239 3300010375 Ga0105239_10052164 Ga0105239_100521643 417
240 3300010375 Ga0105239_10095636 Ga0105239_100956362 417
241 3300010375 Ga0105239_10380539 Ga0105239_103805392 417
242 3300011119 Ga0105246_10017251 Ga0105246_100172512 417
243 3300013104 Ga0157370_10009981 Ga0157370_100099815 417
244 3300013105 Ga0157369_10000021 Ga0157369_100000216 417
245 3300013105 Ga0157369_10010042 Ga0157369_100100425 417
246 3300013105 Ga0157369_10026409 Ga0157369_100264098 417
247 3300013105 Ga0157369_10033171 Ga0157369_100331713 417
248 3300013306 Ga0163162_10000004 Ga0163162_10000004149 417
249 3300013306 Ga0163162_10040454 Ga0163162_100404543 417
250 3300013306 Ga0163162_10102351 Ga0163162_101023513 417
251 3300013307 Ga0157372_10006803 Ga0157372_100068039 417
252 3300013307 Ga0157372_10087346 Ga0157372_100873464 417
253 3300013308 Ga0157375_10064129 Ga0157375_100641293 417
254 3300014325 Ga0163163_10003314 Ga0163163_100033146 417
255 3300014325 Ga0163163_10004441 Ga0163163_1000444112 417
256 3300014968 Ga0157379_10022230 Ga0157379_100222302 417
257 3300025261 Ga0209233_1000714 Ga0209233_10007142 417
258 3300025294 Ga0209025_1000071 Ga0209025_1000071134 417
259 3300025321 Ga0207656_10008975 Ga0207656_100089754 417
260 3300025321 Ga0207656_10035377 Ga0207656_100353772 417
261 3300025903 Ga0207680_10004100 Ga0207680_1000410010 417
262 3300025903 Ga0207680_10008656 Ga0207680_100086562 417
263 3300025903 Ga0207680_10015685 Ga0207680_100156852 417
264 3300025904 Ga0207647_10000130 Ga0207647_100001305 417
265 3300025911 Ga0207654_10002661 Ga0207654_100026617 417
266 3300025912 Ga0207707_10047470 Ga0207707_100474701 417
267 3300025912 Ga0207707_10132176 Ga0207707_101321761 417
268 3300025913 Ga0207695_10000651 Ga0207695_1000065134 417
269 3300025913 Ga0207695_10003828 Ga0207695_1000382816 417
270 3300025913 Ga0207695_10005164 Ga0207695_1000516412 417
271 3300025913 Ga0207695_10019605 Ga0207695_100196057 417
272 3300025913 Ga0207695_10022101 Ga0207695_100221015 417
273 3300025914 Ga0207671_10005233 Ga0207671_100052339 417
274 3300025914 Ga0207671_10019315 Ga0207671_100193152 417
275 3300025914 Ga0207671_10038966 Ga0207671_100389662 417
276 3300025914 Ga0207671_10062472 Ga0207671_100624722 417
277 3300025914 Ga0207671_10109345 Ga0207671_101093452 417
278 3300025919 Ga0207657_10011362 Ga0207657_100113629 417
279 3300025920 Ga0207649_10005381 Ga0207649_100053813 417
280 3300025924 Ga0207694_10001209 Ga0207694_100012093 417
281 3300025924 Ga0207694_10007273 Ga0207694_100072736 417
282 3300025924 Ga0207694_10052878 Ga0207694_100528784 417
283 3300025925 Ga0207650_10003659 Ga0207650_1000365913 417
284 3300025933 Ga0207706_10001900 Ga0207706_1000190018 417
285 3300025935 Ga0207709_10021874 Ga0207709_100218743 417
286 3300025938 Ga0207704_10022808 Ga0207704_100228084 417
287 3300025940 Ga0207691_10044899 Ga0207691_100448991 417
288 3300025942 Ga0207689_10053831 Ga0207689_100538312 417
289 3300025944 Ga0207661_10082084 Ga0207661_100820842 417
290 3300025949 Ga0207667_10012355 Ga0207667_100123552 417
291 3300025949 Ga0207667_10037227 Ga0207667_100372272 417
292 3300025961 Ga0207712_10000207 Ga0207712_100002076 417
293 3300025961 Ga0207712_10163450 Ga0207712_101634502 417
294 3300025981 Ga0207640_10079718 Ga0207640_100797182 417
295 3300025986 Ga0207658_10046510 Ga0207658_100465102 417
296 3300026023 Ga0207677_10229889 Ga0207677_102298891 417
297 3300026035 Ga0207703_10006601 Ga0207703_100066013 417
298 3300026035 Ga0207703_10032871 Ga0207703_100328713 417
299 3300026041 Ga0207639_10000114 Ga0207639_100001148 417
300 3300026041 Ga0207639_10010916 Ga0207639_100109162 417
301 3300026041 Ga0207639_10148117 Ga0207639_101481172 417
302 3300026067 Ga0207678_10000935 Ga0207678_100009356 417
303 3300026067 Ga0207678_10024674 Ga0207678_100246742 417
304 3300026078 Ga0207702_10072574 Ga0207702_100725743 417
305 3300026089 Ga0207648_10003839 Ga0207648_1000383911 417
306 3300026089 Ga0207648_10018265 Ga0207648_100182653 417
307 3300026116 Ga0207674_10025688 Ga0207674_100256887 417
308 3300026121 Ga0207683_10022519 Ga0207683_100225197 417
309 3300026142 Ga0207698_10008590 Ga0207698_100085902 417
310 3300026142 Ga0207698_10020973 Ga0207698_100209732 417
311 3300026142 Ga0207698_10053091 Ga0207698_100530913 417
312 3300027907 Ga0207428_10024096 Ga0207428_100240961 417
313 3300028379 Ga0268266_10000007 Ga0268266_1000000751 417
314 3300028381 Ga0268264_10024110 Ga0268264_100241102 417
315 3300031251 Ga0265327_10000222 Ga0265327_1000022289 417
316 3300031616 Ga0307508_10009313 Ga0307508_100093139 417
317 3300031727 Ga0316576_10005229 Ga0316576_100052297 417
318 3300031727 Ga0316576_10007501 Ga0316576_100075016 417
319 3300031728 Ga0316578_10032287 Ga0316578_100322873 417
320 3300032004 Ga0307414_10044095 Ga0307414_100440952 417
321 3300032005 Ga0307411_10037439 Ga0307411_100374392 417
322 3300032126 Ga0307415_100029669 Ga0307415_1000296692 417
323 3300035112 Ga0373932_0013072 Ga0373932_0013072_543_1808 417
324 3300035691 Ga0373931_0000198 Ga0373931_0000198_1214_2479 417
325 3300036712 Ga0316584_0126078 Ga0316584_0126078_12_1316 417
326 3300037068 Ga0373925_0204291 Ga0373925_0204291_146_1426 417
327 3300037312 Ga0395899_0002787 Ga0395899_0002787_1460_2782 417
328 3300037312 Ga0395899_0004846 Ga0395899_0004846_5747_7030 417
329 3300037466 Ga0395898_0082118 Ga0395898_0082118_1424_2707 417
330 3300039453 Ga0436362_0589359 Ga0436362_0589359_248_1540 417
331 3300041494 Ga0451837_1323892 Ga0451837_1323892_1446_2864 417
332 3300042184 Ga0450908_000141 Ga0450908_000141_1895_3172 417
333 3300042876 Ga0451577_0119244 Ga0451577_0119244_1022_2317 417
334 3300044672 Ga0466982_0002192 Ga0466982_0002192_5471_6748 417
335 3300044735 Ga0466968_0001344 Ga0466968_0001344_1681_2967 417
336 3300046459 Ga0495629_0059659 Ga0495629_0059659_951_2219 417
337 3300046460 Ga0495638_0006707 Ga0495638_0006707_183_1487 417
338 3300046473 Ga0495582_0074981 Ga0495582_0074981_256_1557 417
339 3300046492 Ga0495585_0000525 Ga0495585_0000525_20294_21598 417
340 3300046500 Ga0495596_0002458 Ga0495596_0002458_6259_7563 417
341 3300046506 Ga0495583_0062324 Ga0495583_0062324_353_1618 417
342 3300046507 Ga0495606_0003479 Ga0495606_0003479_1920_3197 417
343 3300046511 Ga0495608_0029543 Ga0495608_0029543_2034_3290 417
344 3300046513 Ga0495616_0000831 Ga0495616_0000831_2014_3291 417
345 3300046518 Ga0495631_0008303 Ga0495631_0008303_792_2090 417
346 3300046518 Ga0495631_0010538 Ga0495631_0010538_1087_2391 417
347 3300046519 Ga0495632_0009555 Ga0495632_0009555_705_1982 417
348 3300046538 Ga0495609_0003842 Ga0495609_0003842_6521_7825 417
349 3300046542 Ga0495597_0008973 Ga0495597_0008973_1168_2466 417
350 3300046648 Ga0495611_0047882 Ga0495611_0047882_177_1481 417
351 3300046674 Ga0495588_0063250 Ga0495588_0063250_273_1574 417
352 3300046683 Ga0495658_0034055 Ga0495658_0034055_782_2050 417
353 3300046691 Ga0495670_0002728 Ga0495670_0002728_2963_4273 417
354 3300046691 Ga0495670_0020993 Ga0495670_0020993_868_2145 417
355 3300047318 Ga0495636_0005683 Ga0495636_0005683_842_2131 417
356 3300047320 Ga0495672_0000884 Ga0495672_0000884_8001_9272 417
357 3300047472 Ga0495686_0016408 Ga0495686_0016408_1719_2996 417
358 3300048904 Ga0496101_0031345 Ga0496101_0031345_544_1821 417
359 3300048906 Ga0496103_0031429 Ga0496103_0031429_1326_2666 417
360 3300048908 Ga0496105_0280928 Ga0496105_0280928_53_1324 417
361 3300048909 Ga0496106_0012498 Ga0496106_0012498_3087_4364 417
362 3300048909 Ga0496106_0024568 Ga0496106_0024568_1665_2936 417
363 3300048910 Ga0496107_0085669 Ga0496107_0085669_53_1324 417
364 3300048914 Ga0496111_0007564 Ga0496111_0007564_1261_2532 417
365 3300048920 Ga0496117_0072422 Ga0496117_0072422_976_2259 417
366 3300048921 Ga0496118_0042563 Ga0496118_0042563_58_1341 417
367 3300048924 Ga0496121_0001206 Ga0496121_0001206_41694_42977 417
368 3300048924 Ga0496121_0008379 Ga0496121_0008379_9114_10391 417
369 3300048924 Ga0496121_0023206 Ga0496121_0023206_2545_3828 417
370 3300048925 Ga0496122_0029178 Ga0496122_0029178_2119_3399 417
371 3300048925 Ga0496122_0047496 Ga0496122_0047496_113_1399 417
372 3300048926 Ga0496123_0037794 Ga0496123_0037794_1898_3175 417
373 3300048926 Ga0496123_0044546 Ga0496123_0044546_53_1333 417
374 3300048927 Ga0496124_0000088 Ga0496124_0000088_150882_152168 417
375 3300048928 Ga0496125_0004570 Ga0496125_0004570_2053_3333 417
376 3300049569 Ga0501032_0003038 Ga0501032_0003038_8944_10245 417
377 3300049570 Ga0501033_0003012 Ga0501033_0003012_10289_11563 417
378 3300049570 Ga0501033_0069952 Ga0501033_0069952_453_1826 417
379 3300049570 Ga0501033_0138177 Ga0501033_0138177_338_1615 417
380 3300049571 Ga0501034_0000282 Ga0501034_0000282_85807_87102 417
381 3300049571 Ga0501034_0006544 Ga0501034_0006544_3347_4636 417
382 3300049571 Ga0501034_0007675 Ga0501034_0007675_7195_8484 417
383 3300049571 Ga0501034_0010286 Ga0501034_0010286_5673_6956 417
384 3300049571 Ga0501034_0015625 Ga0501034_0015625_3354_4643 417
385 3300049571 Ga0501034_0024094 Ga0501034_0024094_4724_6013 417
386 3300049571 Ga0501034_0032217 Ga0501034_0032217_3100_4392 417
387 3300049571 Ga0501034_0058574 Ga0501034_0058574_2043_3344 417
388 3300049572 Ga0501036_0001984 Ga0501036_0001984_2429_3718 417
389 3300049572 Ga0501036_0011869 Ga0501036_0011869_5937_7196 417
390 3300049572 Ga0501036_0152138 Ga0501036_0152138_512_1852 417
391 3300049572 Ga0501036_0185960 Ga0501036_0185960_268_1533 417
392 3300049573 Ga0501037_0012090 Ga0501037_0012090_4157_5458 417
393 3300049573 Ga0501037_0064437 Ga0501037_0064437_601_1890 417
394 3300049574 Ga0501038_0005233 Ga0501038_0005233_7965_9254 417
395 3300049574 Ga0501038_0116030 Ga0501038_0116030_299_1600 417
396 3300049575 Ga0501039_0078140 Ga0501039_0078140_283_1656 417
397 3300049578 Ga0501042_0058986 Ga0501042_0058986_43_1323 417
398 3300049578 Ga0501042_0071683 Ga0501042_0071683_535_1875 417
399 3300049579 Ga0501043_0017919 Ga0501043_0017919_1083_2372 417
400 3300049579 Ga0501043_0084964 Ga0501043_0084964_662_1963 417
401 3300049579 Ga0501043_0157475 Ga0501043_0157475_421_1704 417
402 3300049580 Ga0501046_0031560 Ga0501046_0031560_579_1868 417
403 3300049580 Ga0501046_0171461 Ga0501046_0171461_138_1496 417
404 3300049581 Ga0501047_0001965 Ga0501047_0001965_15183_16472 417
405 3300049581 Ga0501047_0010044 Ga0501047_0010044_5981_7264 417
406 3300049581 Ga0501047_0018368 Ga0501047_0018368_1144_2433 417
407 3300049581 Ga0501047_0081160 Ga0501047_0081160_1695_2975 417
408 3300049582 Ga0501048_0019034 Ga0501048_0019034_1836_3209 417
409 3300049583 Ga0501067_0002574 Ga0501067_0002574_5910_7199 417
410 3300049584 Ga0501068_0004213 Ga0501068_0004213_2446_3720 417
411 3300049584 Ga0501068_0004236 Ga0501068_0004236_2793_4082 417
412 3300049586 Ga0501070_0009340 Ga0501070_0009340_2747_4036 417
413 3300049586 Ga0501070_0009480 Ga0501070_0009480_3245_4534 417
414 3300049587 Ga0501071_0009766 Ga0501071_0009766_1454_2719 417
415 3300049587 Ga0501071_0022249 Ga0501071_0022249_970_2310 417
416 3300049587 Ga0501071_0097158 Ga0501071_0097158_47_1327 417
417 3300049588 Ga0501072_0002919 Ga0501072_0002919_8111_9400 417
418 3300049588 Ga0501072_0051126 Ga0501072_0051126_56_1321 417
419 3300049589 Ga0501073_0012226 Ga0501073_0012226_2758_4047 417
420 3300049589 Ga0501073_0013279 Ga0501073_0013279_2093_3382 417
421 3300049590 Ga0501074_0000819 Ga0501074_0000819_15205_16494 417
422 3300049590 Ga0501074_0011749 Ga0501074_0011749_3540_4829 417
423 3300049590 Ga0501074_0011826 Ga0501074_0011826_3512_4801 417
424 3300049590 Ga0501074_0095757 Ga0501074_0095757_22_1362 417
425 3300049591 Ga0501075_0164257 Ga0501075_0164257_173_1513 417
426 3300049592 Ga0501076_0039532 Ga0501076_0039532_1841_3106 417
427 3300049592 Ga0501076_0114602 Ga0501076_0114602_176_1549 417
428 3300049592 Ga0501076_0167934 Ga0501076_0167934_116_1456 417
429 3300049742 Ga0501080_0015184 Ga0501080_0015184_2794_4083 417
430 3300049742 Ga0501080_0015700 Ga0501080_0015700_5467_6756 417
431 3300049742 Ga0501080_0016184 Ga0501080_0016184_2619_3908 417
432 3300049742 Ga0501080_0020546 Ga0501080_0020546_3026_4315 417
433 3300049742 Ga0501080_0035021 Ga0501080_0035021_1624_2925 417
434 3300049742 Ga0501080_0158355 Ga0501080_0158355_139_1479 417
435 3300049744 Ga0501083_0008330 Ga0501083_0008330_522_1811 417
436 3300049822 Ga0501035_0011492 Ga0501035_0011492_43_1320 417
437 3300049822 Ga0501035_0016137 Ga0501035_0016137_2214_3497 417
438 3300049822 Ga0501035_0055489 Ga0501035_0055489_375_1676 417
439 3300049822 Ga0501035_0139355 Ga0501035_0139355_392_1732 417
440 3300049823 Ga0501044_0009991 Ga0501044_0009991_6754_8037 417
441 3300049823 Ga0501044_0011743 Ga0501044_0011743_5439_6740 417
442 3300049823 Ga0501044_0025529 Ga0501044_0025529_863_2137 417
443 3300049823 Ga0501044_0033828 Ga0501044_0033828_1385_2674 417
444 3300049823 Ga0501044_0249264 Ga0501044_0249264_276_1553 417
445 3300049824 Ga0501045_0007594 Ga0501045_0007594_4124_5389 417
446 3300050491 nmdc:mga00v17_4242_c1 nmdc:mga00v17_4242_c1_5899_7194 417
447 3300050491 nmdc:mga00v17_846_c1 nmdc:mga00v17_846_c1_14685_15971 417
448 3300050492 nmdc:mga0yw44_40941_c1 nmdc:mga0yw44_40941_c1_342_1688 417
449 3300050492 nmdc:mga0yw44_63682_c1 nmdc:mga0yw44_63682_c1_561_1829 417
450 3300050509 nmdc:mga0qj67_6216_c1 nmdc:mga0qj67_6216_c1_4567_5847 417
451 3300050510 nmdc:mga06r32_153866_c1 nmdc:mga06r32_153866_c1_734_2047 417
452 3300050511 nmdc:mga08y16_19888_c1 nmdc:mga08y16_19888_c1_82_1335 417
453 3300053094 Ga0500566_0000443 Ga0500566_0000443_13520_14794 417
454 3300053153 Ga0500616_0000684 Ga0500616_0000684_36574_37833 417
455 3300054114 Ga0501084_0187711 Ga0501084_0187711_407_1672 417
456 3300060353 Ga0501082_0022961 Ga0501082_0022961_1498_2787 417
457 3300060353 Ga0501082_0028851 Ga0501082_0028851_319_1584 417
458 3300060353 Ga0501082_0047072 Ga0501082_0047072_1490_2848 417
459 3300061734 Ga0530510_0020922 Ga0530510_0020922_121_1386 417

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

49

440

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gsa-assembly1.cif.gz_A crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase) reduced with cyanoborohydrate 0.9748 5 417
4gsa-assembly1.cif.gz_A crystal structure of glutamate-1-semialdehyde aminomutase (aminotransferase) reduced with cyanoborohydrate 0.9634 5 417
3k28-assembly2.cif.gz_D crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate 0.9626 4 415
2hp1-assembly1.cif.gz_A inter-subunit signaling in gsam 0.9619 4 417
3fq8-assembly1.cif.gz_B m248i mutant of gsam 0.9611 4 417
ID Description Score Start End Superfamily
af_Q58020_328_422_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9753 320 413 3.90.1150.10
af_P23893_318_423_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9657 312 413 3.90.1150.10
af_Q2G283_321_426_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9616 310 414 3.90.1150.10
2cfbA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9573 309 415 3.90.1150.10
af_Q58020_328_422_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9555 320 413 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A535EA48-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9819 193 416 GO:0008483
GO:0030170
AF-A0A813BXZ7-F1-model_v4 glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) 0.9795 7 417 GO:0005247
GO:0006782
GO:0008483
GO:0016020
GO:0030170
GO:0042286
AF-A0A7S3X2I9-F1-model_v4 glutamate-1-semialdehyde 2,1-aminomutase (EC 5.4.3.8) 0.9785 5 417 GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A2V7KVM8-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (GSA) (EC 5.4.3.8) (Glutamate-1-semialdehyde aminotransferase) (GSA-AT) 0.978 1 415 GO:0005737
GO:0006782
GO:0008483
GO:0030170
GO:0042286
AF-A0A833ECS5-F1-model_v4 deleted 0.9761 201 414

Feature Viewer

pLDDT pTM Quality
89.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map