F448436

General Info

Members Datasets Scaffolds Average Seq Length
459 365 264 371

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0003567|Ga0496116_0003567_13617_14852
Length 411
Sequence LRPVKARAFILGKRRALLLEVMLGHRNPRENCNVTADAGTLHHPPAGSLLRREWFLAISALTSVAFLFHGQALFALLANPFWLTLIFIWLFSVVLGSALSVVRHADHLAERLGEPYGTLILTLAITTIEVVAITAVMQHGENNPTLVRDTLFAVVMIILNGMVGLSLLLGAWRRHEQRHNLQGANAYLGVIVPLATLSMIMPNFTHPSGGPGYSTVQQTVLAFISVGLYGVFLTLQTGRHRGFFIDDTEEAMPQSHHTDHQGPLWWPIVMLALYMSLVVFLVEQLAPPIDYFIETLRAPAALGGVIMAVLVATPEAISAVRASVANHLQRSVNIFLGSVLSTIGLTVPAMLVISHLTGNPVILGLDHSSPIMLVLTLALSIITFSSGRTHLMQGAVHLVLFVAYVLLIFET

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2519899620 Rhizobium sp. Pop5 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
26 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
27 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
28 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
32 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
33 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
34 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
35 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
36 2643221599 Rhizobium sp. Root708 Isolate Unclassified
37 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
38 2718217882 Rhizobium sp. N741 Isolate Nodule
39 2718217927 Rhizobium sp. N324 Isolate Nodule
40 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
41 2718218009 Rhizobium sp. N561 Isolate Nodule
42 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
43 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
44 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
45 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
46 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
47 2718218363 Rhizobium sp. N113 Isolate Nodule
48 2718218365 Rhizobium sp. N731 Isolate Nodule
49 2718218366 Rhizobium sp. N621 Isolate Nodule
50 2718218423 Rhizobium sp. N941 Isolate Nodule
51 2721755514 Rhizobium sp. N6212 Isolate Nodule
52 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
53 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
54 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
55 2721755809 Rhizobium sp. N541 Isolate Nodule
56 2721755810 Rhizobium sp. N871 Isolate Nodule
57 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
58 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
59 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
60 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
61 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
62 2728369365 Rhizobium sp. N1341 Isolate Nodule
63 2728369397 Rhizobium sp. N1314 Isolate Nodule
64 2738541293 Rhizobium sp. GV031 Isolate Unclassified
65 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
66 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
67 2791355256 Rhizobium sp. M10 Isolate Nodule
68 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
69 2791355260 Rhizobium sp. L9 Isolate Nodule
70 2791355261 Rhizobium sp. J15 Isolate Nodule
71 2791355262 Rhizobium sp. M1 Isolate Nodule
72 2791355263 Rhizobium chutanense C5 Isolate Nodule
73 2791355264 Rhizobium sp. S9 Isolate Nodule
74 2791355265 Rhizobium sp. H4 Isolate Nodule
75 2791355266 Rhizobium sp. L43 Isolate Nodule
76 2791355267 Rhizobium sp. L18 Isolate Nodule
77 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
78 2802429633 Rhizobium anhuiense J3 Isolate Nodule
79 2802429634 Rhizobium anhuiense S10 Isolate Nodule
80 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
81 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
82 2802429637 Rhizobium anhuiense C15 Isolate Nodule
83 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
84 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
85 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
86 2838048938 Rhizobium pisi 27/80 Isolate Nodule
87 2838061910 Rhizobium phaseoli L15 Isolate Nodule
88 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
89 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
90 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
91 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
92 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
93 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
94 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
95 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
96 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
97 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
98 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
99 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
100 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
101 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
102 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
103 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
104 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
105 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
106 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
107 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
108 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
109 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
110 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
111 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
112 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
113 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
114 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
115 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
116 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
117 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
118 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
119 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
120 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
121 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
122 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
123 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
124 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
125 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
126 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
127 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
128 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
129 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
130 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
131 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
132 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
133 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
134 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
135 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
136 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
137 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
138 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
139 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
140 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
141 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
142 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
143 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
144 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
145 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
146 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
147 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
148 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
149 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
150 2933599457 Rhizobium phaseoli M3 Isolate Nodule
151 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
152 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
153 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
154 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
155 2936381700 Rhizobium chutanense C16 Isolate Unclassified
156 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
157 2996887358 Rhizobium sp. R711 Isolate Nodule
158 2996893221 Rhizobium sp. R635 Isolate Nodule
159 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
160 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
161 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
162 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
163 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
164 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
167 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
168 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
169 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
170 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
171 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
172 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
173 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
177 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
178 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
179 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
180 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
181 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
182 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
183 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
184 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
185 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
186 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
187 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
188 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
189 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
190 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
191 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
195 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
196 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
197 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
198 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
199 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
200 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
201 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
202 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
204 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
205 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
224 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
242 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
319 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
322 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
332 8005258706 Rhizobium sp. R693 Isolate Nodule
333 8005275841 Rhizobium sp. N4311 Isolate Nodule
334 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
335 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
336 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
337 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
338 8005321885 Rhizobium sp. R72 Isolate Nodule
339 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
340 8005382845 Rhizobium sp. R634 Isolate Nodule
341 8005395548 Rhizobium sp. R339 Isolate Nodule
342 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
343 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
344 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
345 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
346 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
347 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
348 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
349 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
350 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
351 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
352 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
353 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
354 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
355 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
356 8018176218 Rhizobium sp. N122 Isolate Nodule
357 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
358 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
359 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
360 8024501048 Rhizobium sp. H4 Isolate Nodule
361 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
362 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
363 8056382006 Rhizobium croatiense 13T Isolate Nodule
364 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
365 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.52
Metatranscriptomes 0
Isolates 42.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.52
Nodule 36.82
Rhizoplane 0.65
Rhizosphere 35.51
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000381 3300002773 Bacteria 27228
2 JGI25152J39213_1001079 3300002773 Bacteria 12856
3 JGI25152J39213_1010231 3300002773 Bacteria 2164
4 JGI25152J39213_1014958 3300002773 Bacteria 1550
5 JGI25150J39212_1000103 3300002774 Bacteria 49029
6 JGI25159J45721_1000265 3300002987 Bacteria 24451
7 JGI25151J46595_10000085 3300003187 Bacteria 127212
8 JGI25151J46595_10000656 3300003187 Bacteria 29464
9 JGI25151J46595_10003065 3300003187 Bacteria 9436
10 JGI25153J46596_10000834 3300003215 Bacteria 18821
11 JGI25153J46596_10001010 3300003215 Bacteria 17125
12 JGI25153J46596_10001488 3300003215 Bacteria 13974
13 JGI25160J50197_1000006 3300003354 Bacteria 316247
14 JGI25160J50197_1005455 3300003354 Bacteria 5291
15 JGI25161J50226_1000004 3300003374 Bacteria 316212
16 JGI25161J50226_1002664 3300003374 Bacteria 4458
17 JGI25404J52841_10004706 3300003659 Bacteria 2785
18 Ga0055526_1002571 3300003771 Bacteria 12161
19 Ga0055526_1010448 3300003771 Bacteria 4318
20 Ga0055526_1016252 3300003771 Bacteria 2926
21 Ga0055524_1003358 3300003775 Bacteria 7801
22 Ga0055524_1006022 3300003775 Bacteria 5323
23 Ga0055524_1007350 3300003775 Bacteria 4688
24 Ga0055528_1000538 3300003790 Bacteria 28947
25 Ga0055528_1003130 3300003790 Bacteria 8489
26 Ga0055528_1013123 3300003790 Bacteria 3165
27 Ga0055540_1000895 3300003792 Bacteria 19643
28 Ga0055540_1011333 3300003792 Bacteria 2883
29 Ga0055543_1000002 3300004625 Bacteria 390020
30 Ga0055543_1000943 3300004625 Bacteria 13334
31 Ga0065165_1000341 3300005262 Bacteria 76483
32 Ga0070666_10009207 3300005335 Bacteria 6157
33 Ga0070661_100000243 3300005344 Bacteria 44937
34 Ga0070661_100082054 3300005344 Bacteria 2381
35 Ga0070711_100007824 3300005439 Bacteria 6513
36 Ga0070679_100027992 3300005530 Bacteria 5553
37 Ga0068853_100217857 3300005539 Bacteria 1742
38 Ga0070665_100380181 3300005548 Bacteria 1419
39 Ga0068855_100000006 3300005563 Bacteria 298092
40 Ga0068852_100132824 3300005616 Bacteria 2294
41 Ga0081540_1000085 3300005983 Bacteria 99716
42 Ga0075362_10004052 3300006177 Bacteria 5219
43 Ga0075362_10023129 3300006177 Bacteria 2626
44 Ga0075367_10063346 3300006178 Bacteria 2210
45 Ga0075367_10090010 3300006178 Bacteria 1866
46 Ga0075369_10006839 3300006186 Bacteria 4328
47 Ga0075366_10001571 3300006195 Bacteria 11419
48 Ga0075370_10044178 3300006353 Bacteria 2519
49 Ga0079104_1010896 3300006946 Bacteria 2957
50 Ga0105251_10015807 3300009011 Bacteria 4108
51 Ga0105240_10000080 3300009093 Bacteria 195633
52 Ga0105247_10075996 3300009101 Bacteria 2109
53 Ga0105241_10052551 3300009174 Bacteria 3112
54 Ga0105238_10224433 3300009551 Bacteria 1855
55 Ga0105249_10165754 3300009553 Unclassified 2139
56 Ga0123341_1000053 3300009765 Bacteria 49025
57 Ga0123342_1014528 3300009766 Bacteria 7475
58 Ga0123342_1017333 3300009766 Bacteria 6011
59 Ga0105239_10007891 3300010375 Bacteria 12170
60 Ga0105239_10057240 3300010375 Bacteria 4276
61 Ga0157369_10003197 3300013105 Bacteria 19534
62 Ga0157369_10043090 3300013105 Bacteria 4921
63 Ga0157378_10173513 3300013297 Unclassified 2024
64 Ga0157379_10001302 3300014968 Bacteria 20316
65 Ga0209672_110194 3300025228 Bacteria 1283
66 Ga0207425_1000065 3300025245 Bacteria 127264
67 Ga0207425_1001087 3300025245 Bacteria 12364
68 Ga0209129_1000019 3300025258 Bacteria 460802
69 Ga0209129_1000132 3300025258 Bacteria 127262
70 Ga0209129_1000315 3300025258 Bacteria 43061
71 Ga0209129_1000978 3300025258 Bacteria 17127
72 Ga0209673_1000182 3300025273 Bacteria 127522
73 Ga0209673_1001128 3300025273 Bacteria 29524
74 Ga0209673_1001989 3300025273 Bacteria 15819
75 Ga0209673_1007136 3300025273 Bacteria 5228
76 Ga0209673_1031821 3300025273 Bacteria 1634
77 Ga0209130_1000032 3300025284 Bacteria 316240
78 Ga0209676_1008982 3300025292 Bacteria 4378
79 Ga0209025_1000186 3300025294 Bacteria 155131
80 Ga0209025_1000247 3300025294 Bacteria 127264
81 Ga0209025_1001681 3300025294 Bacteria 27032
82 Ga0209025_1007119 3300025294 Bacteria 8457
83 Ga0209025_1008548 3300025294 Bacteria 7347
84 Ga0209025_1011484 3300025294 Bacteria 5828
85 Ga0209564_1001203 3300025295 Bacteria 29524
86 Ga0209564_1010187 3300025295 Bacteria 4366
87 Ga0209564_1010535 3300025295 Bacteria 4242
88 Ga0209758_1000212 3300025297 Bacteria 127597
89 Ga0209758_1001508 3300025297 Bacteria 27032
90 Ga0209758_1003158 3300025297 Bacteria 15483
91 Ga0209758_1009225 3300025297 Bacteria 6189
92 Ga0209256_1000853 3300025299 Bacteria 38008
93 Ga0209256_1001204 3300025299 Bacteria 28959
94 Ga0209256_1014485 3300025299 Bacteria 2833
95 Ga0207426_1000077 3300025302 Bacteria 316246
96 Ga0207426_1000863 3300025302 Bacteria 31669
97 Ga0207426_1001057 3300025302 Bacteria 26113
98 Ga0209051_1000643 3300025303 Bacteria 39847
99 Ga0209051_1000848 3300025303 Bacteria 31351
100 Ga0209051_1017026 3300025303 Bacteria 3263
101 Ga0209051_1020551 3300025303 Bacteria 2838
102 Ga0209257_1002863 3300025304 Bacteria 16100
103 Ga0207710_10113427 3300025900 Unclassified 1289
104 Ga0207707_10245222 3300025912 Bacteria 1557
105 Ga0207695_10000004 3300025913 Bacteria 1288665
106 Ga0207649_10000367 3300025920 Bacteria 33632
107 Ga0207649_10055025 3300025920 Bacteria 2479
108 Ga0207694_10000014 3300025924 Bacteria 374435
109 Ga0207667_10000396 3300025949 Bacteria 58871
110 Ga0207667_10099711 3300025949 Bacteria 2997
111 Ga0207712_10325754 3300025961 Bacteria 1269
112 Ga0207658_10022059 3300025986 Bacteria 4429
113 Ga0307515_10004490 3300028794 Bacteria 28866
114 Ga0265338_10002004 3300028800 Bacteria 31633
115 Ga0265338_10112318 3300028800 Bacteria 2191
116 Ga0265338_10186695 3300028800 Bacteria 1575
117 Ga0265338_10216061 3300028800 Bacteria 1436
118 Ga0265340_10020752 3300031247 Bacteria 3373
119 Ga0265340_10050483 3300031247 Bacteria 2018
120 Ga0265331_10000008 3300031250 Bacteria 324311
121 Ga0265331_10000020 3300031250 Bacteria 258149
122 Ga0265327_10000007 3300031251 Bacteria 678515
123 Ga0265327_10002101 3300031251 Bacteria 22168
124 Ga0307513_10036227 3300031456 Bacteria 5509
125 Ga0265314_10031025 3300031711 Bacteria 3950
126 Ga0307412_10019356 3300031911 Bacteria 4120
127 Ga0373934_0045311 3300035086 Bacteria 1739
128 Ga0373953_0006019 3300035117 Bacteria 3973
129 Ga0373955_0012096 3300035172 Bacteria 4139
130 Ga0373955_0094958 3300035172 Bacteria 1705
131 Ga0373933_0017682 3300035724 Bacteria 3999
132 Ga0373933_0019864 3300035724 Bacteria 3802
133 Ga0373933_0111898 3300035724 Bacteria 1704
134 Ga0373937_0000389 3300036401 Bacteria 40860
135 Ga0373937_0024035 3300036401 Bacteria 5494
136 Ga0373937_0043416 3300036401 Bacteria 4104
137 Ga0373937_0178767 3300036401 Bacteria 1992
138 Ga0373925_0025905 3300037068 Bacteria 4288
139 Ga0395900_0003453 3300037418 Bacteria 17082
140 Ga0395900_0008905 3300037418 Bacteria 10297
141 Ga0395898_0004798 3300037466 Bacteria 14714
142 Ga0395898_0008608 3300037466 Bacteria 10767
143 Ga0395901_0026186 3300038443 Bacteria 5987
144 Ga0395901_0050954 3300038443 Bacteria 4302
145 Ga0439465_0005914 3300041413 Bacteria 3890
146 Ga0451835_0550446 3300041492 Bacteria 3832
147 Ga0451851_0483473 3300041507 Bacteria 1977
148 Ga0451851_0811741 3300041507 Bacteria 2445
149 Ga0466963_0004386 3300044694 Bacteria 8197
150 Ga0466971_0070659 3300044719 Bacteria 1585
151 Ga0466970_0000568 3300044765 Bacteria 18086
152 Ga0466957_0032901 3300044842 Bacteria 3107
153 Ga0466959_0014684 3300045049 Bacteria 5700
154 Ga0466967_0016189 3300045976 Bacteria 5870
155 Ga0466967_0358173 3300045976 Bacteria 1413
156 Ga0495629_0040767 3300046459 Bacteria 3266
157 Ga0495638_0039250 3300046460 Bacteria 3006
158 Ga0495605_0032413 3300046474 Bacteria 2660
159 Ga0495662_0028939 3300046476 Bacteria 2675
160 Ga0495664_0034216 3300046477 Bacteria 2989
161 Ga0495664_0041432 3300046477 Bacteria 2725
162 Ga0495585_0005174 3300046492 Bacteria 8281
163 Ga0495606_0001618 3300046507 Bacteria 29389
164 Ga0495606_0049603 3300046507 Bacteria 2751
165 Ga0495616_0092509 3300046513 Bacteria 1430
166 Ga0495632_0002037 3300046519 Bacteria 15919
167 Ga0495632_0007360 3300046519 Bacteria 6927
168 Ga0495643_0003724 3300046522 Bacteria 11043
169 Ga0495643_0022898 3300046522 Bacteria 3557
170 Ga0495648_0151909 3300046524 Bacteria 1207
171 Ga0495652_0083518 3300046529 Bacteria 2629
172 Ga0495652_0135155 3300046529 Bacteria 1947
173 Ga0495652_0145434 3300046529 Bacteria 1859
174 Ga0495654_0026189 3300046530 Bacteria 3001
175 Ga0495587_0012693 3300046536 Bacteria 5298
176 Ga0495597_0007592 3300046542 Bacteria 5494
177 Ga0495668_0017354 3300046616 Bacteria 4176
178 Ga0495625_0016257 3300046660 Bacteria 5862
179 Ga0495625_0071710 3300046660 Bacteria 2430
180 Ga0495588_0080600 3300046674 Bacteria 1699
181 Ga0495670_0028566 3300046691 Bacteria 2765
182 Ga0495671_0093822 3300046692 Bacteria 1469
183 Ga0495649_0061902 3300046694 Bacteria 2012
184 Ga0495600_0041420 3300046809 Bacteria 3001
185 Ga0495600_0097306 3300046809 Bacteria 1918
186 Ga0495660_0032257 3300046810 Bacteria 2941
187 Ga0495683_0018368 3300047323 Bacteria 3617
188 Ga0495687_017762 3300047443 Bacteria 3534
189 Ga0495681_0057904 3300047470 Bacteria 1798
190 Ga0495686_0000795 3300047472 Bacteria 41055
191 Ga0495686_0015697 3300047472 Bacteria 5161
192 Ga0495602_0197193 3300048088 Bacteria 1539
193 Ga0495626_0025678 3300048091 Bacteria 2878
194 Ga0496104_0006464 3300048907 Bacteria 10301
195 Ga0496105_0035206 3300048908 Bacteria 4120
196 Ga0496107_0160898 3300048910 Bacteria 1664
197 Ga0496116_0003567 3300048919 Bacteria 15293
198 Ga0496117_0019395 3300048920 Bacteria 5585
199 Ga0496117_0026327 3300048920 Bacteria 4553
200 Ga0496118_0005425 3300048921 Bacteria 14494
201 Ga0496119_0054384 3300048922 Bacteria 2437
202 Ga0496121_0071665 3300048924 Bacteria 2785
203 Ga0496121_0121069 3300048924 Bacteria 1976
204 Ga0496122_0005576 3300048925 Bacteria 14901
205 Ga0496122_0023706 3300048925 Bacteria 5396
206 Ga0496122_0117678 3300048925 Bacteria 1724
207 Ga0496123_0004914 3300048926 Bacteria 13718
208 Ga0496124_0003541 3300048927 Bacteria 18992
209 Ga0496124_0021614 3300048927 Bacteria 5927
210 Ga0496125_0039077 3300048928 Bacteria 4094
211 Ga0496125_0210505 3300048928 Bacteria 1263
212 Ga0495682_0005301 3300049460 Bacteria 5378
213 Ga0501031_0164691 3300049568 Bacteria 1449
214 Ga0501032_0001288 3300049569 Bacteria 20109
215 Ga0501032_0032585 3300049569 Bacteria 3571
216 Ga0501033_0002562 3300049570 Bacteria 15353
217 Ga0501034_0005528 3300049571 Bacteria 13787
218 Ga0501034_0156065 3300049571 Bacteria 2256
219 Ga0501036_0007669 3300049572 Bacteria 8811
220 Ga0501037_0065045 3300049573 Bacteria 2657
221 Ga0501037_0142866 3300049573 Bacteria 1712
222 Ga0501038_0000585 3300049574 Bacteria 32370
223 Ga0501038_0093528 3300049574 Bacteria 2515
224 Ga0501039_0021701 3300049575 Bacteria 4927
225 Ga0501043_0003561 3300049579 Bacteria 12781
226 Ga0501046_0005796 3300049580 Bacteria 11023
227 Ga0501046_0127030 3300049580 Bacteria 1936
228 Ga0501047_0008201 3300049581 Bacteria 9868
229 Ga0501047_0111848 3300049581 Bacteria 2613
230 Ga0501048_0013365 3300049582 Bacteria 6092
231 Ga0501067_0042016 3300049583 Bacteria 2539
232 Ga0501068_0082619 3300049584 Bacteria 1973
233 Ga0501069_0012833 3300049585 Bacteria 4461
234 Ga0501070_0000382 3300049586 Bacteria 40489
235 Ga0501072_0186375 3300049588 Bacteria 1655
236 Ga0501073_0000674 3300049589 Bacteria 24026
237 Ga0501073_0060814 3300049589 Bacteria 2636
238 Ga0501074_0002926 3300049590 Bacteria 11992
239 Ga0501074_0200642 3300049590 Bacteria 1422
240 Ga0501079_0161915 3300049741 Bacteria 1745
241 Ga0501080_0002709 3300049742 Bacteria 15526
242 Ga0501083_0004812 3300049744 Bacteria 9543
243 Ga0501083_0023811 3300049744 Bacteria 4246
244 Ga0501083_0109571 3300049744 Bacteria 1816
245 Ga0501035_0007571 3300049822 Bacteria 10148
246 Ga0501035_0167298 3300049822 Bacteria 1901
247 Ga0501044_0003988 3300049823 Bacteria 16529
248 Ga0501044_0190467 3300049823 Bacteria 2014
249 nmdc:mga03683_26287_c1 3300050489 Bacteria 2295
250 nmdc:mga07m45_47974_c1 3300050496 Bacteria 2401
251 Ga0495612_0013177 3300053078 Bacteria 3330
252 Ga0495655_0002929 3300053083 Bacteria 2762
253 Ga0495595_0007970 3300053084 Bacteria 4338
254 Ga0495619_0006461 3300053085 Bacteria 7422
255 Ga0500569_000992 3300053109 Bacteria 5121
256 Ga0500614_019313 3300053123 Bacteria 1561
257 Ga0500618_007648 3300053125 Bacteria 3066
258 Ga0500658_0008145 3300053134 Bacteria 3875
259 Ga0500590_006457 3300053148 Bacteria 5717
260 Ga0500616_0002385 3300053153 Bacteria 15707
261 Ga0500622_0010515 3300053156 Bacteria 5077
262 Ga0500645_020942 3300053730 Bacteria 2021
263 Ga0501084_0010279 3300054114 Bacteria 7742
264 Ga0501082_0006656 3300060353 Bacteria 9998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0358173 Ga0466967_0358173_462_1388 267
2 3300031251 Ga0265327_10002101 Ga0265327_1000210116 279
3 3300048924 Ga0496121_0121069 Ga0496121_0121069_940_1944 280
4 3300048928 Ga0496125_0039077 Ga0496125_0039077_2842_3972 280
5 3300028800 Ga0265338_10002004 Ga0265338_1000200418 283
6 3300046522 Ga0495643_0022898 Ga0495643_0022898_298_1428 284
7 3300002987 JGI25159J45721_1000265 JGI25159J45721_100026518 287
8 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006327 287
9 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004327 287
10 3300004625 Ga0055543_1000002 Ga0055543_10000028 287
11 3300005262 Ga0065165_1000341 Ga0065165_100034166 287
12 3300005344 Ga0070661_100000243 Ga0070661_10000024316 287
13 3300025284 Ga0209130_1000032 Ga0209130_1000032317 287
14 3300025302 Ga0207426_1000077 Ga0207426_1000077317 287
15 3300025920 Ga0207649_10000367 Ga0207649_100003674 287
16 3300049580 Ga0501046_0127030 Ga0501046_0127030_722_1864 287
17 3300035172 Ga0373955_0094958 Ga0373955_0094958_77_1201 288
18 3300035724 Ga0373933_0111898 Ga0373933_0111898_471_1595 288
19 3300036401 Ga0373937_0043416 Ga0373937_0043416_1866_2990 288
20 3300003659 JGI25404J52841_10004706 JGI25404J52841_100047062 291
21 3300005983 Ga0081540_1000085 Ga0081540_100008572 291
22 3300009766 Ga0123342_1014528 Ga0123342_10145283 292
23 3300009553 Ga0105249_10165754 Ga0105249_101657541 297
24 3300044694 Ga0466963_0004386 Ga0466963_0004386_2666_3760 301
25 3300044719 Ga0466971_0070659 Ga0466971_0070659_135_1229 301
26 3300044765 Ga0466970_0000568 Ga0466970_0000568_2181_3275 301
27 3300044842 Ga0466957_0032901 Ga0466957_0032901_1762_2856 301
28 3300045049 Ga0466959_0014684 Ga0466959_0014684_3215_4309 301
29 3300045976 Ga0466967_0016189 Ga0466967_0016189_2180_3274 301
30 3300046519 Ga0495632_0002037 Ga0495632_0002037_10799_11869 302
31 3300025302 Ga0207426_1001057 Ga0207426_100105712 303
32 3300048907 Ga0496104_0006464 Ga0496104_0006464_1348_2478 303
33 3300048908 Ga0496105_0035206 Ga0496105_0035206_1251_2381 303
34 3300048922 Ga0496119_0054384 Ga0496119_0054384_427_1557 303
35 3300048925 Ga0496122_0023706 Ga0496122_0023706_4056_5252 303
36 3300006177 Ga0075362_10023129 Ga0075362_100231292 304
37 3300006186 Ga0075369_10006839 Ga0075369_100068393 304
38 3300025228 Ga0209672_110194 Ga0209672_1101941 305
39 3300031247 Ga0265340_10050483 Ga0265340_100504832 305
40 3300037418 Ga0395900_0008905 Ga0395900_0008905_5528_6643 305
41 3300037466 Ga0395898_0004798 Ga0395898_0004798_5131_6246 305
42 3300046507 Ga0495606_0001618 Ga0495606_0001618_10798_11928 307
43 3300053730 Ga0500645_020942 Ga0500645_020942_861_1949 307
44 3300035086 Ga0373934_0045311 Ga0373934_0045311_71_1222 308
45 3300035117 Ga0373953_0006019 Ga0373953_0006019_1897_3048 308
46 3300035172 Ga0373955_0012096 Ga0373955_0012096_1670_2821 308
47 3300035724 Ga0373933_0019864 Ga0373933_0019864_827_1978 308
48 3300036401 Ga0373937_0024035 Ga0373937_0024035_1456_2607 308
49 3300046536 Ga0495587_0012693 Ga0495587_0012693_739_1890 308
50 3300046809 Ga0495600_0041420 Ga0495600_0041420_813_1964 308
51 3300053078 Ga0495612_0013177 Ga0495612_0013177_1048_2199 308
52 3300053084 Ga0495595_0007970 Ga0495595_0007970_784_1935 308
53 3300053085 Ga0495619_0006461 Ga0495619_0006461_4400_5551 308
54 3300028800 Ga0265338_10216061 Ga0265338_102160612 309
55 3300049590 Ga0501074_0200642 Ga0501074_0200642_187_1296 309
56 3300041507 Ga0451851_0483473 Ga0451851_0483473_414_1550 310
57 3300048925 Ga0496122_0117678 Ga0496122_0117678_108_1205 310
58 3300048927 Ga0496124_0021614 Ga0496124_0021614_1305_2501 310
59 3300005335 Ga0070666_10009207 Ga0070666_100092076 311
60 3300025986 Ga0207658_10022059 Ga0207658_100220593 311
61 3300005563 Ga0068855_100000006 Ga0068855_100000006167 312
62 3300025913 Ga0207695_10000004 Ga0207695_10000004706 312
63 3300025924 Ga0207694_10000014 Ga0207694_10000014255 312
64 3300025949 Ga0207667_10000396 Ga0207667_100003969 312
65 3300025949 Ga0207667_10099711 Ga0207667_100997115 312
66 3300005530 Ga0070679_100027992 Ga0070679_1000279923 314
67 3300005548 Ga0070665_100380181 Ga0070665_1003801812 314
68 3300009093 Ga0105240_10000080 Ga0105240_10000080126 314
69 3300009174 Ga0105241_10052551 Ga0105241_100525515 314
70 3300009551 Ga0105238_10224433 Ga0105238_102244332 314
71 3300010375 Ga0105239_10007891 Ga0105239_100078917 314
72 3300025912 Ga0207707_10245222 Ga0207707_102452222 314
73 3300005539 Ga0068853_100217857 Ga0068853_1002178572 315
74 3300046459 Ga0495629_0040767 Ga0495629_0040767_1635_2765 315
75 3300046476 Ga0495662_0028939 Ga0495662_0028939_566_1696 315
76 3300046477 Ga0495664_0041432 Ga0495664_0041432_746_1876 315
77 3300046529 Ga0495652_0145434 Ga0495652_0145434_118_1248 315
78 3300046674 Ga0495588_0080600 Ga0495588_0080600_231_1361 315
79 3300046809 Ga0495600_0097306 Ga0495600_0097306_367_1497 315
80 3300048088 Ga0495602_0197193 Ga0495602_0197193_130_1260 315
81 3300053123 Ga0500614_019313 Ga0500614_019313_390_1520 315
82 3300053148 Ga0500590_006457 Ga0500590_006457_3135_4265 315
83 3300003215 JGI25153J46596_10000834 JGI25153J46596_100008346 316
84 3300005344 Ga0070661_100082054 Ga0070661_1000820542 316
85 3300005616 Ga0068852_100132824 Ga0068852_1001328242 316
86 3300009101 Ga0105247_10075996 Ga0105247_100759962 316
87 3300013105 Ga0157369_10003197 Ga0157369_100031975 316
88 3300013297 Ga0157378_10173513 Ga0157378_101735132 316
89 3300025297 Ga0209758_1003158 Ga0209758_10031589 316
90 3300025900 Ga0207710_10113427 Ga0207710_101134271 316
91 3300025920 Ga0207649_10055025 Ga0207649_100550252 316
92 3300028800 Ga0265338_10112318 Ga0265338_101123182 316
93 3300038443 Ga0395901_0050954 Ga0395901_0050954_1283_2413 316
94 3300049568 Ga0501031_0164691 Ga0501031_0164691_229_1374 316
95 3300049569 Ga0501032_0001288 Ga0501032_0001288_7791_8936 316
96 3300049570 Ga0501033_0002562 Ga0501033_0002562_9043_10188 316
97 3300049571 Ga0501034_0005528 Ga0501034_0005528_6095_7240 316
98 3300049572 Ga0501036_0007669 Ga0501036_0007669_1789_2934 316
99 3300049573 Ga0501037_0142866 Ga0501037_0142866_265_1410 316
100 3300049574 Ga0501038_0000585 Ga0501038_0000585_18249_19394 316
101 3300049575 Ga0501039_0021701 Ga0501039_0021701_115_1260 316
102 3300049579 Ga0501043_0003561 Ga0501043_0003561_7476_8621 316
103 3300049580 Ga0501046_0005796 Ga0501046_0005796_1490_2635 316
104 3300049581 Ga0501047_0008201 Ga0501047_0008201_3956_5101 316
105 3300049582 Ga0501048_0013365 Ga0501048_0013365_652_1797 316
106 3300049583 Ga0501067_0042016 Ga0501067_0042016_819_1964 316
107 3300049584 Ga0501068_0082619 Ga0501068_0082619_682_1827 316
108 3300049585 Ga0501069_0012833 Ga0501069_0012833_103_1248 316
109 3300049586 Ga0501070_0000382 Ga0501070_0000382_4034_5179 316
110 3300049588 Ga0501072_0186375 Ga0501072_0186375_118_1263 316
111 3300049589 Ga0501073_0000674 Ga0501073_0000674_1621_2766 316
112 3300049590 Ga0501074_0002926 Ga0501074_0002926_6828_7973 316
113 3300049741 Ga0501079_0161915 Ga0501079_0161915_585_1730 316
114 3300049742 Ga0501080_0002709 Ga0501080_0002709_12761_13906 316
115 3300049744 Ga0501083_0004812 Ga0501083_0004812_4627_5772 316
116 3300049822 Ga0501035_0007571 Ga0501035_0007571_1749_2894 316
117 3300049823 Ga0501044_0003988 Ga0501044_0003988_10084_11229 316
118 3300054114 Ga0501084_0010279 Ga0501084_0010279_880_2025 316
119 3300060353 Ga0501082_0006656 Ga0501082_0006656_1085_2230 316
120 3300006946 Ga0079104_1010896 Ga0079104_10108965 317
121 3300025299 Ga0209256_1014485 Ga0209256_10144853 317
122 3300046460 Ga0495638_0039250 Ga0495638_0039250_1198_2331 317
123 3300046474 Ga0495605_0032413 Ga0495605_0032413_392_1525 317
124 3300046477 Ga0495664_0034216 Ga0495664_0034216_1725_2852 317
125 3300046507 Ga0495606_0049603 Ga0495606_0049603_582_1715 317
126 3300046513 Ga0495616_0092509 Ga0495616_0092509_122_1255 317
127 3300046519 Ga0495632_0007360 Ga0495632_0007360_5369_6502 317
128 3300046522 Ga0495643_0003724 Ga0495643_0003724_4989_6122 317
129 3300046524 Ga0495648_0151909 Ga0495648_0151909_28_1161 317
130 3300046529 Ga0495652_0083518 Ga0495652_0083518_401_1528 317
131 3300046529 Ga0495652_0135155 Ga0495652_0135155_514_1641 317
132 3300046542 Ga0495597_0007592 Ga0495597_0007592_707_1840 317
133 3300046616 Ga0495668_0017354 Ga0495668_0017354_1639_2772 317
134 3300046660 Ga0495625_0071710 Ga0495625_0071710_580_1713 317
135 3300046694 Ga0495649_0061902 Ga0495649_0061902_637_1770 317
136 3300046810 Ga0495660_0032257 Ga0495660_0032257_1651_2784 317
137 3300047443 Ga0495687_017762 Ga0495687_017762_1366_2499 317
138 3300047472 Ga0495686_0015697 Ga0495686_0015697_386_1519 317
139 3300048091 Ga0495626_0025678 Ga0495626_0025678_1044_2177 317
140 3300049571 Ga0501034_0156065 Ga0501034_0156065_873_1997 317
141 3300049574 Ga0501038_0093528 Ga0501038_0093528_305_1429 317
142 3300049581 Ga0501047_0111848 Ga0501047_0111848_23_1147 317
143 3300049589 Ga0501073_0060814 Ga0501073_0060814_547_1671 317
144 3300049744 Ga0501083_0109571 Ga0501083_0109571_13_1137 317
145 3300049823 Ga0501044_0190467 Ga0501044_0190467_405_1529 317
146 3300053083 Ga0495655_0002929 Ga0495655_0002929_507_1640 317
147 3300053109 Ga0500569_000992 Ga0500569_000992_1789_2922 317
148 3300053134 Ga0500658_0008145 Ga0500658_0008145_49_1182 317
149 3300053153 Ga0500616_0002385 Ga0500616_0002385_5244_6377 317
150 iso_pu_bacteria 2524023209 2524460965 317
151 iso_pu_bacteria 2718217882 2719182740 317
152 iso_pu_bacteria 2718218009 2719733457 317
153 iso_pu_bacteria 2718218363 2721148852 317
154 iso_pu_bacteria 2718218365 2721160236 317
155 iso_pu_bacteria 2718218366 2721165665 317
156 iso_pu_bacteria 2721755514 2722841835 317
157 iso_pu_bacteria 2721755810 2724046213 317
158 iso_pu_bacteria 2728369365 2730165975 317
159 iso_pu_bacteria 2728369397 2730299868 317
160 iso_pu_bacteria 2791355263 2793344360 317
161 iso_pu_bacteria 2791355264 2793351181 317
162 iso_pu_bacteria 2838022645 2838024158 317
163 iso_pu_bacteria 2842198810 2842205301 317
164 iso_pu_bacteria 2842298080 2842298900 317
165 iso_pu_bacteria 2842357229 2842359232 317
166 iso_pu_bacteria 2842509118 2842510920 317
167 iso_pu_bacteria 2852387548 2852391442 317
168 iso_pu_bacteria 2936381700 2936387760 317
169 iso_pu_bacteria 2996893221 2996897161 317
170 iso_pu_bacteria 8005382845 8005386411 317
171 iso_pu_bacteria 8046767195 8046773987 317
172 iso_pu_bacteria 8057575449 8057578583 317
173 3300010375 Ga0105239_10057240 Ga0105239_100572402 318
174 3300013105 Ga0157369_10043090 Ga0157369_100430903 318
175 3300031250 Ga0265331_10000008 Ga0265331_1000000833 318
176 3300031250 Ga0265331_10000020 Ga0265331_1000002077 318
177 3300031251 Ga0265327_10000007 Ga0265327_10000007545 318
178 3300031711 Ga0265314_10031025 Ga0265314_100310253 318
179 3300037418 Ga0395900_0003453 Ga0395900_0003453_12113_13243 318
180 3300037466 Ga0395898_0008608 Ga0395898_0008608_2696_3826 318
181 3300038443 Ga0395901_0026186 Ga0395901_0026186_66_1196 318
182 3300046530 Ga0495654_0026189 Ga0495654_0026189_405_1604 318
183 3300047323 Ga0495683_0018368 Ga0495683_0018368_854_2053 318
184 3300049460 Ga0495682_0005301 Ga0495682_0005301_3656_4876 318
185 iso_pu_bacteria 2509276021 2509389673 318
186 iso_pu_bacteria 2509276033 2509445895 318
187 iso_pu_bacteria 2510065019 2510134992 318
188 iso_pu_bacteria 2510461076 2510896416 318
189 iso_pu_bacteria 2513237084 2513574209 318
190 iso_pu_bacteria 2513237085 2513581154 318
191 iso_pu_bacteria 2513237088 2513595921 318
192 iso_pu_bacteria 2513237093 2513636460 318
193 iso_pu_bacteria 2513237103 2513714061 318
194 iso_pu_bacteria 2513237162 2514024565 318
195 iso_pu_bacteria 2515075009 2515114078 318
196 iso_pu_bacteria 2515154113 2515638724 318
197 iso_pu_bacteria 2515154114 2515646119 318
198 iso_pu_bacteria 2515154116 2515661724 318
199 iso_pu_bacteria 2515154134 2515744280 318
200 iso_pu_bacteria 2516653077 2517037715 318
201 iso_pu_bacteria 2516653085 2517078003 318
202 iso_pu_bacteria 2517093000 2517096797 318
203 iso_pu_bacteria 2517287029 2517410504 318
204 iso_pu_bacteria 2519899620 2520381305 318
205 iso_pu_bacteria 2529292951 2530647095 318
206 iso_pu_bacteria 2582581294 2585200799 318
207 iso_pu_bacteria 2585427526 2585530053 318
208 iso_pu_bacteria 2585427528 2585543786 318
209 iso_pu_bacteria 2585427593 2585842172 318
210 iso_pu_bacteria 2718217927 2719387405 318
211 iso_pu_bacteria 2718217997 2719667066 318
212 iso_pu_bacteria 2718218199 2720493486 318
213 iso_pu_bacteria 2718218232 2720614943 318
214 iso_pu_bacteria 2718218233 2720621714 318
215 iso_pu_bacteria 2718218235 2720633044 318
216 iso_pu_bacteria 2718218269 2720776768 318
217 iso_pu_bacteria 2718218423 2721401040 318
218 iso_pu_bacteria 2721755556 2723028357 318
219 iso_pu_bacteria 2721755684 2723561984 318
220 iso_pu_bacteria 2721755685 2723568616 318
221 iso_pu_bacteria 2721755809 2724039853 318
222 iso_pu_bacteria 2721755819 2724091375 318
223 iso_pu_bacteria 2721755822 2724105881 318
224 iso_pu_bacteria 2721755823 2724111707 318
225 iso_pu_bacteria 2724679232 2725952163 318
226 iso_pu_bacteria 2728369352 2730109293 318
227 iso_pu_bacteria 2738541333 2739038987 318
228 iso_pu_bacteria 2765235942 2766065166 318
229 iso_pu_bacteria 2791355256 2793299721 318
230 iso_pu_bacteria 2791355259 2793318365 318
231 iso_pu_bacteria 2791355260 2793325373 318
232 iso_pu_bacteria 2791355262 2793338192 318
233 iso_pu_bacteria 2791355265 2793356444 318
234 iso_pu_bacteria 2791355266 2793364292 318
235 iso_pu_bacteria 2791355267 2793371150 318
236 iso_pu_bacteria 2802429606 2805938196 318
237 iso_pu_bacteria 2802429633 2806049463 318
238 iso_pu_bacteria 2802429634 2806056523 318
239 iso_pu_bacteria 2802429635 2806063626 318
240 iso_pu_bacteria 2802429636 2806071126 318
241 iso_pu_bacteria 2802429637 2806077929 318
242 iso_pu_bacteria 2838016132 2838022442 318
243 iso_pu_bacteria 2838042994 2838048510 318
244 iso_pu_bacteria 2838048938 2838054542 318
245 iso_pu_bacteria 2838061910 2838068308 318
246 iso_pu_bacteria 2838068647 2838074654 318
247 iso_pu_bacteria 2838668709 2838675145 318
248 iso_pu_bacteria 2838680041 2838686412 318
249 iso_pu_bacteria 2838686498 2838693758 318
250 iso_pu_bacteria 2838694306 2838700994 318
251 iso_pu_bacteria 2838701080 2838707482 318
252 iso_pu_bacteria 2838707686 2838714123 318
253 iso_pu_bacteria 2838729681 2838736434 318
254 iso_pu_bacteria 2838742623 2838749244 318
255 iso_pu_bacteria 2841851746 2841858679 318
256 iso_pu_bacteria 2841864319 2841868007 318
257 iso_pu_bacteria 2842077413 2842083776 318
258 iso_pu_bacteria 2842110456 2842117793 318
259 iso_pu_bacteria 2842118031 2842124812 318
260 iso_pu_bacteria 2842146304 2842152054 318
261 iso_pu_bacteria 2842156927 2842163367 318
262 iso_pu_bacteria 2842163707 2842170280 318
263 iso_pu_bacteria 2842180545 2842186995 318
264 iso_pu_bacteria 2842192696 2842198792 318
265 iso_pu_bacteria 2842205361 2842211451 318
266 iso_pu_bacteria 2842217011 2842223661 318
267 iso_pu_bacteria 2842229732 2842236445 318
268 iso_pu_bacteria 2842237096 2842243535 318
269 iso_pu_bacteria 2842243621 2842250143 318
270 iso_pu_bacteria 2842250916 2842257278 318
271 iso_pu_bacteria 2842257432 2842264153 318
272 iso_pu_bacteria 2842264693 2842270847 318
273 iso_pu_bacteria 2842271015 2842278286 318
274 iso_pu_bacteria 2842278818 2842284899 318
275 iso_pu_bacteria 2842285085 2842290948 318
276 iso_pu_bacteria 2842291075 2842297924 318
277 iso_pu_bacteria 2842304105 2842310414 318
278 iso_pu_bacteria 2842311132 2842317361 318
279 iso_pu_bacteria 2842317721 2842324260 318
280 iso_pu_bacteria 2842341865 2842348591 318
281 iso_pu_bacteria 2842363717 2842370358 318
282 iso_pu_bacteria 2842370503 2842377302 318
283 iso_pu_bacteria 2842377471 2842384396 318
284 iso_pu_bacteria 2842384541 2842391415 318
285 iso_pu_bacteria 2842395702 2842402023 318
286 iso_pu_bacteria 2842402390 2842408873 318
287 iso_pu_bacteria 2842409023 2842415554 318
288 iso_pu_bacteria 2842415677 2842422104 318
289 iso_pu_bacteria 2842422224 2842428260 318
290 iso_pu_bacteria 2842428310 2842434730 318
291 iso_pu_bacteria 2842434925 2842441108 318
292 iso_pu_bacteria 2842441272 2842447726 318
293 iso_pu_bacteria 2842447887 2842454411 318
294 iso_pu_bacteria 2842462802 2842469091 318
295 iso_pu_bacteria 2842469257 2842475655 318
296 iso_pu_bacteria 2842489311 2842495730 318
297 iso_pu_bacteria 2842495871 2842502496 318
298 iso_pu_bacteria 2844454524 2844457334 318
299 iso_pu_bacteria 2857516855 2857524396 318
300 iso_pu_bacteria 2933570622 2933576854 318
301 iso_pu_bacteria 2933586486 2933593820 318
302 iso_pu_bacteria 2933599457 2933605109 318
303 iso_pu_bacteria 2935894831 2935901252 318
304 iso_pu_bacteria 2935901341 2935908004 318
305 iso_pu_bacteria 2936367885 2936370914 318
306 iso_pu_bacteria 2936375103 2936379959 318
307 iso_pu_bacteria 2989771324 2989775040 318
308 iso_pu_bacteria 639633055 639650151 318
309 iso_pu_bacteria 8005275841 8005282153 318
310 iso_pu_bacteria 8005282627 8005286982 318
311 iso_pu_bacteria 8005289223 8005293094 318
312 iso_pu_bacteria 8005307578 8005311376 318
313 iso_pu_bacteria 8005376324 8005378474 318
314 iso_pu_bacteria 8005430974 8005435445 318
315 iso_pu_bacteria 8005460587 8005464767 318
316 iso_pu_bacteria 8005497431 8005501806 318
317 iso_pu_bacteria 8005556819 8005560822 318
318 iso_pu_bacteria 8005563573 8005566935 318
319 iso_pu_bacteria 8005570704 8005571025 318
320 iso_pu_bacteria 8005619151 8005623161 318
321 iso_pu_bacteria 8005626139 8005628992 318
322 iso_pu_bacteria 8005668836 8005673229 318
323 iso_pu_bacteria 8005695170 8005699126 318
324 iso_pu_bacteria 8018163183 8018169493 318
325 iso_pu_bacteria 8018176218 8018181064 318
326 iso_pu_bacteria 8023680758 8023683708 318
327 iso_pu_bacteria 8024479707 8024482544 318
328 iso_pu_bacteria 8024486573 8024490141 318
329 iso_pu_bacteria 8024501048 8024504896 318
330 iso_pu_bacteria 8056375014 8056379707 318
331 iso_pu_bacteria 8056382006 8056385738 318
332 iso_pu_bacteria 8057874678 8057880435 318
333 3300025303 Ga0209051_1000643 Ga0209051_100064314 319
334 3300035724 Ga0373933_0017682 Ga0373933_0017682_26_1171 319
335 3300036401 Ga0373937_0178767 Ga0373937_0178767_138_1283 319
336 iso_pu_bacteria 2510917028 2511186722 319
337 iso_pu_bacteria 2513237138 2513869853 319
338 iso_pu_bacteria 2534681796 2535520408 319
339 iso_pu_bacteria 2582581304 2585255693 319
340 iso_pu_bacteria 2582581867 2585402933 319
341 iso_pu_bacteria 2585427590 2585820091 319
342 iso_pu_bacteria 2585427594 2585842469 319
343 iso_pu_bacteria 2643221599 2644006587 319
344 iso_pu_bacteria 2643221643 2644239383 319
345 iso_pu_bacteria 2738541293 2738802545 319
346 iso_pu_bacteria 2923556063 2923559770 319
347 iso_pu_bacteria 2996887358 2996887834 319
348 iso_pu_bacteria 3005452660 3005457858 319
349 iso_pu_bacteria 8005258706 8005259193 319
350 iso_pu_bacteria 8005321885 8005322361 319
351 iso_pu_bacteria 8005395548 8005399388 319
352 iso_pu_bacteria 8005542996 8005548157 319
353 3300005439 Ga0070711_100007824 Ga0070711_1000078246 320
354 3300014968 Ga0157379_10001302 Ga0157379_1000130217 320
355 3300036401 Ga0373937_0000389 Ga0373937_0000389_39216_40349 320
356 3300037068 Ga0373925_0025905 Ga0373925_0025905_1430_2563 320
357 iso_pu_bacteria 3003930520 3003934239 320
358 3300002773 JGI25152J39213_1014958 JGI25152J39213_10149582 321
359 3300003187 JGI25151J46595_10003065 JGI25151J46595_100030654 321
360 3300003771 Ga0055526_1010448 Ga0055526_10104485 321
361 3300003771 Ga0055526_1016252 Ga0055526_10162522 321
362 3300003775 Ga0055524_1006022 Ga0055524_10060224 321
363 3300003775 Ga0055524_1007350 Ga0055524_10073503 321
364 3300003790 Ga0055528_1000538 Ga0055528_10005388 321
365 3300003790 Ga0055528_1003130 Ga0055528_10031303 321
366 3300025258 Ga0209129_1000019 Ga0209129_1000019213 321
367 3300025273 Ga0209673_1000182 Ga0209673_100018258 321
368 3300025273 Ga0209673_1001128 Ga0209673_10011288 321
369 3300025292 Ga0209676_1008982 Ga0209676_10089822 321
370 3300025294 Ga0209025_1000186 Ga0209025_100018684 321
371 3300025294 Ga0209025_1008548 Ga0209025_10085485 321
372 3300025295 Ga0209564_1001203 Ga0209564_10012038 321
373 3300025295 Ga0209564_1010535 Ga0209564_10105355 321
374 3300025299 Ga0209256_1000853 Ga0209256_100085325 321
375 3300025299 Ga0209256_1001204 Ga0209256_10012048 321
376 3300025303 Ga0209051_1017026 Ga0209051_10170263 321
377 3300028800 Ga0265338_10186695 Ga0265338_101866952 321
378 3300031247 Ga0265340_10020752 Ga0265340_100207523 321
379 3300048910 Ga0496107_0160898 Ga0496107_0160898_40_1170 321
380 3300002773 JGI25152J39213_1010231 JGI25152J39213_10102311 322
381 3300003187 JGI25151J46595_10000656 JGI25151J46595_1000065622 322
382 3300003215 JGI25153J46596_10001010 JGI25153J46596_100010106 322
383 3300003354 JGI25160J50197_1005455 JGI25160J50197_10054552 322
384 3300003374 JGI25161J50226_1002664 JGI25161J50226_10026645 322
385 3300003771 Ga0055526_1002571 Ga0055526_10025711 322
386 3300003775 Ga0055524_1003358 Ga0055524_10033586 322
387 3300003790 Ga0055528_1013123 Ga0055528_10131232 322
388 3300003792 Ga0055540_1000895 Ga0055540_100089511 322
389 3300003792 Ga0055540_1011333 Ga0055540_10113334 322
390 3300004625 Ga0055543_1000943 Ga0055543_10009433 322
391 3300006177 Ga0075362_10004052 Ga0075362_100040522 322
392 3300006178 Ga0075367_10063346 Ga0075367_100633462 322
393 3300006178 Ga0075367_10090010 Ga0075367_100900102 322
394 3300006195 Ga0075366_10001571 Ga0075366_100015712 322
395 3300006353 Ga0075370_10044178 Ga0075370_100441782 322
396 3300009765 Ga0123341_1000053 Ga0123341_100005326 322
397 3300009766 Ga0123342_1017333 Ga0123342_10173334 322
398 3300025245 Ga0207425_1001087 Ga0207425_10010877 322
399 3300025258 Ga0209129_1000978 Ga0209129_10009786 322
400 3300025273 Ga0209673_1001989 Ga0209673_10019897 322
401 3300025294 Ga0209025_1001681 Ga0209025_100168121 322
402 3300025295 Ga0209564_1010187 Ga0209564_10101872 322
403 3300025297 Ga0209758_1001508 Ga0209758_10015086 322
404 3300025302 Ga0207426_1000863 Ga0207426_100086321 322
405 3300025303 Ga0209051_1000848 Ga0209051_100084821 322
406 3300025303 Ga0209051_1020551 Ga0209051_10205512 322
407 3300025304 Ga0209257_1002863 Ga0209257_100286310 322
408 3300028794 Ga0307515_10004490 Ga0307515_100044905 322
409 3300031456 Ga0307513_10036227 Ga0307513_100362273 322
410 3300041507 Ga0451851_0811741 Ga0451851_0811741_1031_2164 322
411 3300046692 Ga0495671_0093822 Ga0495671_0093822_227_1360 322
412 3300047472 Ga0495686_0000795 Ga0495686_0000795_12147_13277 322
413 3300049569 Ga0501032_0032585 Ga0501032_0032585_2206_3339 322
414 3300050489 nmdc:mga03683_26287_c1 nmdc:mga03683_26287_c1_1099_2232 322
415 3300050496 nmdc:mga07m45_47974_c1 nmdc:mga07m45_47974_c1_197_1330 322
416 3300053125 Ga0500618_007648 Ga0500618_007648_1560_2711 322
417 iso_pu_bacteria 2791355261 2793331601 322
418 iso_pu_bacteria 8005301065 8005303802 322
419 iso_pu_bacteria 8005688590 8005691513 322
420 3300002773 JGI25152J39213_1000381 JGI25152J39213_100038120 323
421 3300002773 JGI25152J39213_1001079 JGI25152J39213_100107911 323
422 3300002774 JGI25150J39212_1000103 JGI25150J39212_100010334 323
423 3300003187 JGI25151J46595_10000085 JGI25151J46595_10000085109 323
424 3300003215 JGI25153J46596_10001488 JGI25153J46596_100014883 323
425 3300009011 Ga0105251_10015807 Ga0105251_100158073 323
426 3300025245 Ga0207425_1000065 Ga0207425_1000065106 323
427 3300025258 Ga0209129_1000132 Ga0209129_1000132106 323
428 3300025258 Ga0209129_1000315 Ga0209129_100031536 323
429 3300025273 Ga0209673_1007136 Ga0209673_10071363 323
430 3300025273 Ga0209673_1031821 Ga0209673_10318212 323
431 3300025294 Ga0209025_1000247 Ga0209025_1000247106 323
432 3300025294 Ga0209025_1007119 Ga0209025_10071194 323
433 3300025294 Ga0209025_1011484 Ga0209025_10114846 323
434 3300025297 Ga0209758_1000212 Ga0209758_1000212107 323
435 3300025297 Ga0209758_1009225 Ga0209758_10092253 323
436 3300025961 Ga0207712_10325754 Ga0207712_103257541 323
437 3300031911 Ga0307412_10019356 Ga0307412_100193562 323
438 3300041413 Ga0439465_0005914 Ga0439465_0005914_1788_2933 323
439 3300041492 Ga0451835_0550446 Ga0451835_0550446_1603_2802 323
440 3300046492 Ga0495585_0005174 Ga0495585_0005174_6356_7555 323
441 3300046660 Ga0495625_0016257 Ga0495625_0016257_2979_4178 323
442 3300046691 Ga0495670_0028566 Ga0495670_0028566_526_1725 323
443 3300047470 Ga0495681_0057904 Ga0495681_0057904_392_1591 323
444 3300048919 Ga0496116_0003567 Ga0496116_0003567_13617_14852 323
445 3300048920 Ga0496117_0019395 Ga0496117_0019395_2977_4176 323
446 3300048920 Ga0496117_0026327 Ga0496117_0026327_954_2189 323
447 3300048921 Ga0496118_0005425 Ga0496118_0005425_12235_13371 323
448 3300048924 Ga0496121_0071665 Ga0496121_0071665_1499_2698 323
449 3300048925 Ga0496122_0005576 Ga0496122_0005576_737_1972 323
450 3300048926 Ga0496123_0004914 Ga0496123_0004914_11877_13112 323
451 3300048927 Ga0496124_0003541 Ga0496124_0003541_13693_14928 323
452 3300048928 Ga0496125_0210505 Ga0496125_0210505_64_1236 323
453 3300049573 Ga0501037_0065045 Ga0501037_0065045_1434_2579 323
454 3300049744 Ga0501083_0023811 Ga0501083_0023811_521_1666 323
455 3300049822 Ga0501035_0167298 Ga0501035_0167298_259_1404 323
456 3300053156 Ga0500622_0010515 Ga0500622_0010515_989_2137 323
457 iso_pu_bacteria 2582581299 2585232590 323
458 iso_pu_bacteria 2615840624 2616298282 323
459 iso_pu_bacteria 8018127388 8018131689 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

82

238

0.95

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

266

410

0.87

Feature Viewer

pLDDT pTM Quality
52.68 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map