F448451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 459 | 217 | 459 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_135757_c1|nmdc:mga05p37_135757_c1_888_2330 |
| Length | 480 |
| Sequence | MTCRRTAADTCRGVMVRMRIVLADIKGGDGFISKDTVVGGYGSRLKPFSKVTRLVAHVKGGFHELPSVHLAYAAALARQAGHETVSSSGALAEGDVAIMLSSLVDHRRETAWARAMRDRGVRVGFIGLAAQNLPHLFDTSADFIVVGEPESALQRLFRGDTLSGMASSPQISDLDSLPFPVWEPFLPSRRRVRVPFAGRPYGGSLPLLASRSCPEFCTYCPHRIQSTYRFRSVTNILDELSYLEDTRGRLHVVFRDPLFSQERDRVLELCDGIRARRLSHTFECETRLDRLDGDLLRVMHAAGLRAMSFGVESVAPTTLKKVGRRPIPEPHQRQVLRRCRELGIVTAAFYVIGFAEDTWESIGATIEYSIDLGSTVAQFKILTPYPGTPLFKRMQTTITETDWERFDGFTPTFTHPSLXXAELTFLLGNAYTQYYVRPSFLTNYLRIESPRVRALVKSLDAPVRRRHTREVALKERTLSC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 142 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 155 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 178 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 202 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 204 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.18 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 96.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000823 | 3300001977 | Bacteria | 4794 |
| 2 | Ga0065712_10073436 | 3300005290 | Bacteria | 4387 |
| 3 | Ga0070676_10002154 | 3300005328 | Bacteria | 10029 |
| 4 | Ga0070690_100006893 | 3300005330 | Bacteria | 6466 |
| 5 | Ga0070690_100051930 | 3300005330 | Bacteria | 2619 |
| 6 | Ga0070690_100073108 | 3300005330 | Unclassified | 2230 |
| 7 | Ga0070670_100078599 | 3300005331 | Unclassified | 2834 |
| 8 | Ga0070677_10004154 | 3300005333 | Bacteria | 4708 |
| 9 | Ga0070677_10010371 | 3300005333 | Bacteria | 3186 |
| 10 | Ga0068869_100005534 | 3300005334 | Bacteria | 7952 |
| 11 | Ga0068869_100021319 | 3300005334 | Bacteria | 4456 |
| 12 | Ga0070666_10007681 | 3300005335 | Bacteria | 6657 |
| 13 | Ga0068868_100009344 | 3300005338 | Bacteria | 7049 |
| 14 | Ga0068868_100063644 | 3300005338 | Bacteria | 2926 |
| 15 | Ga0068868_100067530 | 3300005338 | Bacteria | 2846 |
| 16 | Ga0070689_100182408 | 3300005340 | Bacteria | 1705 |
| 17 | Ga0070691_10002578 | 3300005341 | Bacteria | 8084 |
| 18 | Ga0070687_100007102 | 3300005343 | Bacteria | 4639 |
| 19 | Ga0070661_100082861 | 3300005344 | Unclassified | 2369 |
| 20 | Ga0070669_100011904 | 3300005353 | Bacteria | 6173 |
| 21 | Ga0070669_100012576 | 3300005353 | Bacteria | 6003 |
| 22 | Ga0070669_100022378 | 3300005353 | Bacteria | 4518 |
| 23 | Ga0070675_100003945 | 3300005354 | Bacteria | 11245 |
| 24 | Ga0070675_100009113 | 3300005354 | Bacteria | 7707 |
| 25 | Ga0070671_100011733 | 3300005355 | Bacteria | 7047 |
| 26 | Ga0070671_100025997 | 3300005355 | Bacteria | 4808 |
| 27 | Ga0070674_100005617 | 3300005356 | Bacteria | 7264 |
| 28 | Ga0070673_100000718 | 3300005364 | Bacteria | 18298 |
| 29 | Ga0070673_100001224 | 3300005364 | Bacteria | 14844 |
| 30 | Ga0070673_100015137 | 3300005364 | Bacteria | 5404 |
| 31 | Ga0070673_100058572 | 3300005364 | Unclassified | 3046 |
| 32 | Ga0070688_100007957 | 3300005365 | Bacteria | 5733 |
| 33 | Ga0070688_100008290 | 3300005365 | Bacteria | 5636 |
| 34 | Ga0070714_100020743 | 3300005435 | Bacteria | 5371 |
| 35 | Ga0070713_100167840 | 3300005436 | Unclassified | 1964 |
| 36 | Ga0070711_100097301 | 3300005439 | Unclassified | 2134 |
| 37 | Ga0070705_100014457 | 3300005440 | Bacteria | 4061 |
| 38 | Ga0070700_100001992 | 3300005441 | Bacteria | 10368 |
| 39 | Ga0070700_100009373 | 3300005441 | Bacteria | 5369 |
| 40 | Ga0070700_100067888 | 3300005441 | Unclassified | 2266 |
| 41 | Ga0070708_100005784 | 3300005445 | Bacteria | 9814 |
| 42 | Ga0070708_100011788 | 3300005445 | Bacteria | 7113 |
| 43 | Ga0070708_100013595 | 3300005445 | Bacteria | 6672 |
| 44 | Ga0070663_100064930 | 3300005455 | Bacteria | 2640 |
| 45 | Ga0070663_100161531 | 3300005455 | Bacteria | 1725 |
| 46 | Ga0070678_100022064 | 3300005456 | Bacteria | 4208 |
| 47 | Ga0070678_100026337 | 3300005456 | Bacteria | 3930 |
| 48 | Ga0070678_100122099 | 3300005456 | Bacteria | 2056 |
| 49 | Ga0070662_100047468 | 3300005457 | Bacteria | 3089 |
| 50 | Ga0070681_10098333 | 3300005458 | Bacteria | 2873 |
| 51 | Ga0068867_100010235 | 3300005459 | Bacteria | 6615 |
| 52 | Ga0068867_100019633 | 3300005459 | Bacteria | 4813 |
| 53 | Ga0070706_100055764 | 3300005467 | Bacteria | 3648 |
| 54 | Ga0070706_100232027 | 3300005467 | Bacteria | 1723 |
| 55 | Ga0070706_100241702 | 3300005467 | Bacteria | 1686 |
| 56 | Ga0070707_100001823 | 3300005468 | Bacteria | 20504 |
| 57 | Ga0070707_100057151 | 3300005468 | Unclassified | 3743 |
| 58 | Ga0070698_100116381 | 3300005471 | Bacteria | 2637 |
| 59 | Ga0070699_100000480 | 3300005518 | Bacteria | 38016 |
| 60 | Ga0070699_100005774 | 3300005518 | Bacteria | 10829 |
| 61 | Ga0070699_100031623 | 3300005518 | Bacteria | 4569 |
| 62 | Ga0070699_100069157 | 3300005518 | Unclassified | 3068 |
| 63 | Ga0070699_100155370 | 3300005518 | Bacteria | 2024 |
| 64 | Ga0070679_100035148 | 3300005530 | Bacteria | 4971 |
| 65 | Ga0070684_100047449 | 3300005535 | Bacteria | 3722 |
| 66 | Ga0070684_100103418 | 3300005535 | Unclassified | 2548 |
| 67 | Ga0070672_100009960 | 3300005543 | Bacteria | 6575 |
| 68 | Ga0070672_100066110 | 3300005543 | Unclassified | 2862 |
| 69 | Ga0070686_100004659 | 3300005544 | Bacteria | 7564 |
| 70 | Ga0070686_100021484 | 3300005544 | Bacteria | 3838 |
| 71 | Ga0070695_100018206 | 3300005545 | Bacteria | 4264 |
| 72 | Ga0070696_100003832 | 3300005546 | Bacteria | 10043 |
| 73 | Ga0070696_100004285 | 3300005546 | Bacteria | 9506 |
| 74 | Ga0070696_100006008 | 3300005546 | Bacteria | 8102 |
| 75 | Ga0070665_100006326 | 3300005548 | Bacteria | 12084 |
| 76 | Ga0070665_100018473 | 3300005548 | Bacteria | 6988 |
| 77 | Ga0070665_100173863 | 3300005548 | Bacteria | 2154 |
| 78 | Ga0070704_100082752 | 3300005549 | Unclassified | 2368 |
| 79 | Ga0070704_100158316 | 3300005549 | Bacteria | 1789 |
| 80 | Ga0068855_100144268 | 3300005563 | Bacteria | 2712 |
| 81 | Ga0070664_100014956 | 3300005564 | Bacteria | 6333 |
| 82 | Ga0070664_100023852 | 3300005564 | Bacteria | 5053 |
| 83 | Ga0068857_100151248 | 3300005577 | Bacteria | 2103 |
| 84 | Ga0068854_100004171 | 3300005578 | Bacteria | 9091 |
| 85 | Ga0068854_100005532 | 3300005578 | Bacteria | 7981 |
| 86 | Ga0068856_100259497 | 3300005614 | Unclassified | 1753 |
| 87 | Ga0070702_100013685 | 3300005615 | Bacteria | 4101 |
| 88 | Ga0070702_100021880 | 3300005615 | Bacteria | 3372 |
| 89 | Ga0068859_100005448 | 3300005617 | Bacteria | 12941 |
| 90 | Ga0068859_100016111 | 3300005617 | Bacteria | 7508 |
| 91 | Ga0068859_100111145 | 3300005617 | Bacteria | 2802 |
| 92 | Ga0068864_100026196 | 3300005618 | Bacteria | 4916 |
| 93 | Ga0068864_100038631 | 3300005618 | Unclassified | 4078 |
| 94 | Ga0068864_100207447 | 3300005618 | Unclassified | 1803 |
| 95 | Ga0068866_10007097 | 3300005718 | Bacteria | 4684 |
| 96 | Ga0068861_100003132 | 3300005719 | Bacteria | 10928 |
| 97 | Ga0068861_100013671 | 3300005719 | Bacteria | 5685 |
| 98 | Ga0068861_100025775 | 3300005719 | Bacteria | 4268 |
| 99 | Ga0068861_100058946 | 3300005719 | Unclassified | 2938 |
| 100 | Ga0068870_10003118 | 3300005840 | Bacteria | 6996 |
| 101 | Ga0068863_100062504 | 3300005841 | Bacteria | 3521 |
| 102 | Ga0068863_100145639 | 3300005841 | Unclassified | 2265 |
| 103 | Ga0068858_100017623 | 3300005842 | Bacteria | 6694 |
| 104 | Ga0068858_100061072 | 3300005842 | Unclassified | 3484 |
| 105 | Ga0068858_100071968 | 3300005842 | Bacteria | 3207 |
| 106 | Ga0068858_100092610 | 3300005842 | Bacteria | 2813 |
| 107 | Ga0068860_100018106 | 3300005843 | Bacteria | 6858 |
| 108 | Ga0068860_100019208 | 3300005843 | Bacteria | 6634 |
| 109 | Ga0068860_100083910 | 3300005843 | Unclassified | 3030 |
| 110 | Ga0068860_100156707 | 3300005843 | Unclassified | 2195 |
| 111 | Ga0068862_100012618 | 3300005844 | Bacteria | 6995 |
| 112 | Ga0068862_100222004 | 3300005844 | Unclassified | 1711 |
| 113 | Ga0081455_10016095 | 3300005937 | Bacteria | 7234 |
| 114 | Ga0081539_10005303 | 3300005985 | Bacteria | 13260 |
| 115 | Ga0075365_10016653 | 3300006038 | Bacteria | 4476 |
| 116 | Ga0075368_10039429 | 3300006042 | Unclassified | 1852 |
| 117 | Ga0075364_10057376 | 3300006051 | Bacteria | 2550 |
| 118 | Ga0075362_10001000 | 3300006177 | Bacteria | 8663 |
| 119 | Ga0075362_10010270 | 3300006177 | Bacteria | 3650 |
| 120 | Ga0068871_100000983 | 3300006358 | Bacteria | 19098 |
| 121 | Ga0075431_100011609 | 3300006847 | Bacteria | 8882 |
| 122 | Ga0075433_10016364 | 3300006852 | Bacteria | 6110 |
| 123 | Ga0075433_10025684 | 3300006852 | Bacteria | 4981 |
| 124 | Ga0075433_10030908 | 3300006852 | Bacteria | 4573 |
| 125 | Ga0075433_10060641 | 3300006852 | Bacteria | 3313 |
| 126 | Ga0075433_10127309 | 3300006852 | Bacteria | 2262 |
| 127 | Ga0075434_100002694 | 3300006871 | Bacteria | 15692 |
| 128 | Ga0075434_100002939 | 3300006871 | Bacteria | 15151 |
| 129 | Ga0075434_100003323 | 3300006871 | Bacteria | 14382 |
| 130 | Ga0075434_100012701 | 3300006871 | Bacteria | 7988 |
| 131 | Ga0075434_100020696 | 3300006871 | Bacteria | 6387 |
| 132 | Ga0075434_100148525 | 3300006871 | Archaea | 2364 |
| 133 | Ga0075434_100223126 | 3300006871 | Bacteria | 1904 |
| 134 | Ga0075434_100310853 | 3300006871 | Bacteria | 1596 |
| 135 | Ga0075429_100026436 | 3300006880 | Bacteria | 5039 |
| 136 | Ga0068865_100001604 | 3300006881 | Bacteria | 13249 |
| 137 | Ga0068865_100007245 | 3300006881 | Bacteria | 6814 |
| 138 | Ga0075436_100000305 | 3300006914 | Bacteria | 31481 |
| 139 | Ga0097620_100005448 | 3300006931 | Bacteria | 12941 |
| 140 | Ga0097620_100016111 | 3300006931 | Bacteria | 7508 |
| 141 | Ga0097620_100111144 | 3300006931 | Bacteria | 2802 |
| 142 | Ga0075435_100000012 | 3300007076 | Bacteria | 108852 |
| 143 | Ga0075435_100007358 | 3300007076 | Bacteria | 7842 |
| 144 | Ga0075435_100042563 | 3300007076 | Bacteria | 3633 |
| 145 | Ga0075435_100050282 | 3300007076 | Bacteria | 3354 |
| 146 | Ga0075435_100067359 | 3300007076 | Bacteria | 2915 |
| 147 | Ga0105240_10031654 | 3300009093 | Bacteria | 6855 |
| 148 | Ga0105240_10083102 | 3300009093 | Bacteria | 3931 |
| 149 | Ga0111539_10001681 | 3300009094 | Bacteria | 29485 |
| 150 | Ga0111539_10001822 | 3300009094 | Bacteria | 28383 |
| 151 | Ga0111539_10003099 | 3300009094 | Bacteria | 22033 |
| 152 | Ga0111539_10044245 | 3300009094 | Bacteria | 5334 |
| 153 | Ga0111539_10063153 | 3300009094 | Bacteria | 4383 |
| 154 | Ga0111539_10357233 | 3300009094 | Bacteria | 1700 |
| 155 | Ga0105245_10188397 | 3300009098 | Bacteria | 1975 |
| 156 | Ga0105247_10001308 | 3300009101 | Bacteria | 18279 |
| 157 | Ga0105247_10040234 | 3300009101 | Bacteria | 2857 |
| 158 | Ga0114129_10000153 | 3300009147 | Bacteria | 73434 |
| 159 | Ga0114129_10004368 | 3300009147 | Bacteria | 19946 |
| 160 | Ga0114129_10015794 | 3300009147 | Bacteria | 10735 |
| 161 | Ga0114129_10015833 | 3300009147 | Bacteria | 10723 |
| 162 | Ga0114129_10015886 | 3300009147 | Bacteria | 10706 |
| 163 | Ga0114129_10020625 | 3300009147 | Bacteria | 9370 |
| 164 | Ga0114129_10027372 | 3300009147 | Bacteria | 8072 |
| 165 | Ga0114129_10078510 | 3300009147 | Bacteria | 4592 |
| 166 | Ga0114129_10094228 | 3300009147 | Unclassified | 4147 |
| 167 | Ga0114129_10170132 | 3300009147 | Bacteria | 2971 |
| 168 | Ga0114129_10355801 | 3300009147 | Unclassified | 1939 |
| 169 | Ga0114129_10357169 | 3300009147 | Bacteria | 1934 |
| 170 | Ga0105243_10004496 | 3300009148 | Bacteria | 11020 |
| 171 | Ga0105243_10026162 | 3300009148 | Bacteria | 4465 |
| 172 | Ga0105242_10015625 | 3300009176 | Bacteria | 5897 |
| 173 | Ga0105242_10029826 | 3300009176 | Unclassified | 4353 |
| 174 | Ga0105242_10093831 | 3300009176 | Unclassified | 2531 |
| 175 | Ga0105242_10148635 | 3300009176 | Unclassified | 2041 |
| 176 | Ga0105242_10247047 | 3300009176 | Bacteria | 1606 |
| 177 | Ga0105248_10004152 | 3300009177 | Bacteria | 16021 |
| 178 | Ga0105248_10020608 | 3300009177 | Bacteria | 7307 |
| 179 | Ga0105248_10028166 | 3300009177 | Bacteria | 6256 |
| 180 | Ga0105248_10035993 | 3300009177 | Bacteria | 5537 |
| 181 | Ga0105248_10055467 | 3300009177 | Bacteria | 4445 |
| 182 | Ga0105248_10116668 | 3300009177 | Unclassified | 3011 |
| 183 | Ga0105238_10010227 | 3300009551 | Bacteria | 9408 |
| 184 | Ga0105249_10009530 | 3300009553 | Bacteria | 8508 |
| 185 | Ga0105249_10148245 | 3300009553 | Bacteria | 2256 |
| 186 | Ga0105246_10077231 | 3300011119 | Bacteria | 2362 |
| 187 | Ga0105246_10135493 | 3300011119 | Bacteria | 1845 |
| 188 | Ga0163162_10015046 | 3300013306 | Bacteria | 7557 |
| 189 | Ga0157375_10256897 | 3300013308 | Unclassified | 1909 |
| 190 | Ga0163163_10009290 | 3300014325 | Bacteria | 8771 |
| 191 | Ga0163163_10065882 | 3300014325 | Bacteria | 3597 |
| 192 | Ga0157380_10019511 | 3300014326 | Bacteria | 5053 |
| 193 | Ga0157380_10019677 | 3300014326 | Bacteria | 5035 |
| 194 | Ga0157380_10021741 | 3300014326 | Bacteria | 4817 |
| 195 | Ga0157380_10041398 | 3300014326 | Bacteria | 3595 |
| 196 | Ga0157380_10074855 | 3300014326 | Bacteria | 2750 |
| 197 | Ga0157380_10224041 | 3300014326 | Bacteria | 1684 |
| 198 | Ga0157377_10015151 | 3300014745 | Bacteria | 3936 |
| 199 | Ga0157377_10054341 | 3300014745 | Bacteria | 2267 |
| 200 | Ga0157379_10013635 | 3300014968 | Bacteria | 7122 |
| 201 | Ga0157379_10058203 | 3300014968 | Bacteria | 3455 |
| 202 | Ga0157379_10068979 | 3300014968 | Unclassified | 3161 |
| 203 | Ga0157376_10013440 | 3300014969 | Bacteria | 6108 |
| 204 | Ga0157376_10039983 | 3300014969 | Unclassified | 3830 |
| 205 | Ga0157376_10046424 | 3300014969 | Bacteria | 3582 |
| 206 | Ga0157376_10056086 | 3300014969 | Unclassified | 3290 |
| 207 | Ga0163161_10006838 | 3300017792 | Bacteria | 7891 |
| 208 | Ga0207697_10002571 | 3300025315 | Bacteria | 9337 |
| 209 | Ga0207682_10002778 | 3300025893 | Bacteria | 7748 |
| 210 | Ga0207682_10008735 | 3300025893 | Bacteria | 4008 |
| 211 | Ga0207688_10011624 | 3300025901 | Bacteria | 4787 |
| 212 | Ga0207645_10009335 | 3300025907 | Bacteria | 6790 |
| 213 | Ga0207645_10010470 | 3300025907 | Bacteria | 6367 |
| 214 | Ga0207645_10010472 | 3300025907 | Bacteria | 6366 |
| 215 | Ga0207643_10004226 | 3300025908 | Bacteria | 7736 |
| 216 | Ga0207643_10073516 | 3300025908 | Bacteria | 1971 |
| 217 | Ga0207684_10025242 | 3300025910 | Bacteria | 5065 |
| 218 | Ga0207695_10201532 | 3300025913 | Unclassified | 1904 |
| 219 | Ga0207662_10005323 | 3300025918 | Bacteria | 6844 |
| 220 | Ga0207662_10019468 | 3300025918 | Bacteria | 3864 |
| 221 | Ga0207662_10027644 | 3300025918 | Bacteria | 3274 |
| 222 | Ga0207662_10133577 | 3300025918 | Bacteria | 1567 |
| 223 | Ga0207649_10100213 | 3300025920 | Bacteria | 1915 |
| 224 | Ga0207652_10072038 | 3300025921 | Bacteria | 3004 |
| 225 | Ga0207646_10084164 | 3300025922 | Bacteria | 2846 |
| 226 | Ga0207646_10135785 | 3300025922 | Bacteria | 2215 |
| 227 | Ga0207646_10136974 | 3300025922 | Bacteria | 2204 |
| 228 | Ga0207646_10215204 | 3300025922 | Unclassified | 1735 |
| 229 | Ga0207681_10013300 | 3300025923 | Bacteria | 5090 |
| 230 | Ga0207681_10026199 | 3300025923 | Bacteria | 3758 |
| 231 | Ga0207681_10061785 | 3300025923 | Bacteria | 2577 |
| 232 | Ga0207694_10005515 | 3300025924 | Bacteria | 9710 |
| 233 | Ga0207650_10015686 | 3300025925 | Bacteria | 5282 |
| 234 | Ga0207650_10191688 | 3300025925 | Bacteria | 1633 |
| 235 | Ga0207659_10002413 | 3300025926 | Bacteria | 11126 |
| 236 | Ga0207659_10006238 | 3300025926 | Bacteria | 7293 |
| 237 | Ga0207659_10009242 | 3300025926 | Bacteria | 6155 |
| 238 | Ga0207659_10015855 | 3300025926 | Bacteria | 4895 |
| 239 | Ga0207659_10109111 | 3300025926 | Bacteria | 2100 |
| 240 | Ga0207687_10028799 | 3300025927 | Bacteria | 3732 |
| 241 | Ga0207687_10066639 | 3300025927 | Unclassified | 2560 |
| 242 | Ga0207700_10131698 | 3300025928 | Unclassified | 2042 |
| 243 | Ga0207664_10036925 | 3300025929 | Bacteria | 3778 |
| 244 | Ga0207644_10004503 | 3300025931 | Bacteria | 9054 |
| 245 | Ga0207690_10027640 | 3300025932 | Bacteria | 3587 |
| 246 | Ga0207706_10006430 | 3300025933 | Bacteria | 10912 |
| 247 | Ga0207706_10025632 | 3300025933 | Bacteria | 5282 |
| 248 | Ga0207706_10043902 | 3300025933 | Bacteria | 3961 |
| 249 | Ga0207706_10208017 | 3300025933 | Bacteria | 1715 |
| 250 | Ga0207686_10043704 | 3300025934 | Unclassified | 2747 |
| 251 | Ga0207686_10157174 | 3300025934 | Bacteria | 1590 |
| 252 | Ga0207709_10012657 | 3300025935 | Bacteria | 4650 |
| 253 | Ga0207669_10005780 | 3300025937 | Bacteria | 5587 |
| 254 | Ga0207704_10008092 | 3300025938 | Bacteria | 5007 |
| 255 | Ga0207691_10013506 | 3300025940 | Bacteria | 7811 |
| 256 | Ga0207691_10015117 | 3300025940 | Bacteria | 7345 |
| 257 | Ga0207691_10018112 | 3300025940 | Bacteria | 6670 |
| 258 | Ga0207691_10041882 | 3300025940 | Bacteria | 4224 |
| 259 | Ga0207691_10077907 | 3300025940 | Unclassified | 2985 |
| 260 | Ga0207711_10002803 | 3300025941 | Bacteria | 15320 |
| 261 | Ga0207711_10002992 | 3300025941 | Bacteria | 14770 |
| 262 | Ga0207711_10071743 | 3300025941 | Bacteria | 3006 |
| 263 | Ga0207689_10003160 | 3300025942 | Bacteria | 15105 |
| 264 | Ga0207689_10003182 | 3300025942 | Bacteria | 15059 |
| 265 | Ga0207689_10004016 | 3300025942 | Bacteria | 13377 |
| 266 | Ga0207661_10012184 | 3300025944 | Bacteria | 6244 |
| 267 | Ga0207679_10006664 | 3300025945 | Bacteria | 7312 |
| 268 | Ga0207679_10029864 | 3300025945 | Bacteria | 3799 |
| 269 | Ga0207679_10148515 | 3300025945 | Unclassified | 1904 |
| 270 | Ga0207651_10040858 | 3300025960 | Unclassified | 3073 |
| 271 | Ga0207651_10078480 | 3300025960 | Bacteria | 2368 |
| 272 | Ga0207712_10012583 | 3300025961 | Bacteria | 5408 |
| 273 | Ga0207668_10045421 | 3300025972 | Bacteria | 2996 |
| 274 | Ga0207668_10085800 | 3300025972 | Unclassified | 2298 |
| 275 | Ga0207640_10145735 | 3300025981 | Bacteria | 1732 |
| 276 | Ga0207658_10010962 | 3300025986 | Bacteria | 6172 |
| 277 | Ga0207658_10169844 | 3300025986 | Bacteria | 1796 |
| 278 | Ga0207677_10010755 | 3300026023 | Bacteria | 5188 |
| 279 | Ga0207677_10052258 | 3300026023 | Bacteria | 2775 |
| 280 | Ga0207703_10013310 | 3300026035 | Bacteria | 6409 |
| 281 | Ga0207703_10014989 | 3300026035 | Bacteria | 6050 |
| 282 | Ga0207703_10045833 | 3300026035 | Bacteria | 3518 |
| 283 | Ga0207703_10131693 | 3300026035 | Unclassified | 2160 |
| 284 | Ga0207703_10173851 | 3300026035 | Bacteria | 1896 |
| 285 | Ga0207678_10063230 | 3300026067 | Bacteria | 3180 |
| 286 | Ga0207678_10087169 | 3300026067 | Bacteria | 2668 |
| 287 | Ga0207678_10138741 | 3300026067 | Unclassified | 2075 |
| 288 | Ga0207708_10000706 | 3300026075 | Bacteria | 25251 |
| 289 | Ga0207708_10009103 | 3300026075 | Bacteria | 7348 |
| 290 | Ga0207708_10050745 | 3300026075 | Bacteria | 3158 |
| 291 | Ga0207641_10010481 | 3300026088 | Bacteria | 7610 |
| 292 | Ga0207648_10006451 | 3300026089 | Bacteria | 11658 |
| 293 | Ga0207648_10007078 | 3300026089 | Bacteria | 11070 |
| 294 | Ga0207648_10016579 | 3300026089 | Bacteria | 6725 |
| 295 | Ga0207648_10042434 | 3300026089 | Bacteria | 3993 |
| 296 | Ga0207648_10059700 | 3300026089 | Bacteria | 3326 |
| 297 | Ga0207676_10027671 | 3300026095 | Unclassified | 4225 |
| 298 | Ga0207676_10030367 | 3300026095 | Bacteria | 4056 |
| 299 | Ga0207676_10037844 | 3300026095 | Bacteria | 3680 |
| 300 | Ga0207674_10193862 | 3300026116 | Bacteria | 1982 |
| 301 | Ga0207675_100001595 | 3300026118 | Bacteria | 22714 |
| 302 | Ga0207675_100011388 | 3300026118 | Bacteria | 8324 |
| 303 | Ga0207675_100013653 | 3300026118 | Bacteria | 7580 |
| 304 | Ga0207675_100025146 | 3300026118 | Bacteria | 5540 |
| 305 | Ga0207675_100039047 | 3300026118 | Bacteria | 4430 |
| 306 | Ga0207675_100067905 | 3300026118 | Unclassified | 3332 |
| 307 | Ga0207675_100100304 | 3300026118 | Unclassified | 2727 |
| 308 | Ga0207683_10012512 | 3300026121 | Bacteria | 7239 |
| 309 | Ga0207683_10019234 | 3300026121 | Bacteria | 5831 |
| 310 | Ga0207683_10093289 | 3300026121 | Unclassified | 2683 |
| 311 | Ga0207428_10000041 | 3300027907 | Bacteria | 203097 |
| 312 | Ga0207428_10004093 | 3300027907 | Bacteria | 13970 |
| 313 | Ga0207428_10012928 | 3300027907 | Bacteria | 7317 |
| 314 | Ga0207428_10036425 | 3300027907 | Bacteria | 4013 |
| 315 | Ga0268266_10009780 | 3300028379 | Bacteria | 8435 |
| 316 | Ga0268266_10042170 | 3300028379 | Bacteria | 3896 |
| 317 | Ga0268265_10055038 | 3300028380 | Bacteria | 3021 |
| 318 | Ga0268265_10078194 | 3300028380 | Bacteria | 2601 |
| 319 | Ga0268265_10193567 | 3300028380 | Bacteria | 1758 |
| 320 | Ga0268264_10150879 | 3300028381 | Bacteria | 2083 |
| 321 | Ga0268264_10209053 | 3300028381 | Bacteria | 1790 |
| 322 | Ga0373930_0001321 | 3300034816 | Bacteria | 3646 |
| 323 | Ga0373938_0001546 | 3300034957 | Bacteria | 3695 |
| 324 | Ga0373929_0000574 | 3300035085 | Bacteria | 7085 |
| 325 | Ga0373934_0030216 | 3300035086 | Bacteria | 2119 |
| 326 | Ga0373940_0000066 | 3300035088 | Bacteria | 11878 |
| 327 | Ga0373949_0000676 | 3300035090 | Bacteria | 11092 |
| 328 | Ga0373932_0000173 | 3300035112 | Bacteria | 18853 |
| 329 | Ga0373939_0000561 | 3300035114 | Bacteria | 9292 |
| 330 | Ga0373941_0003930 | 3300035115 | Bacteria | 3407 |
| 331 | Ga0373960_0022515 | 3300035121 | Bacteria | 1688 |
| 332 | Ga0373946_0006791 | 3300035171 | Unclassified | 4161 |
| 333 | Ga0373942_0000218 | 3300035207 | Bacteria | 15047 |
| 334 | Ga0373961_0000622 | 3300035241 | Bacteria | 12857 |
| 335 | Ga0373962_0000441 | 3300035242 | Bacteria | 9071 |
| 336 | Ga0373924_0016906 | 3300035410 | Unclassified | 2790 |
| 337 | Ga0373931_0006859 | 3300035691 | Bacteria | 5354 |
| 338 | Ga0373947_0072539 | 3300035725 | Unclassified | 2114 |
| 339 | Ga0373937_0227421 | 3300036401 | Bacteria | 1756 |
| 340 | Ga0453683_0047118 | 3300044673 | Bacteria | 2702 |
| 341 | Ga0451576_0025728 | 3300045051 | Bacteria | 6339 |
| 342 | Ga0451576_0389907 | 3300045051 | Unclassified | 1460 |
| 343 | Ga0495629_0123067 | 3300046459 | Bacteria | 1807 |
| 344 | Ga0495651_0099232 | 3300046462 | Bacteria | 2172 |
| 345 | Ga0495651_0188999 | 3300046462 | Bacteria | 1451 |
| 346 | Ga0495653_0038376 | 3300046463 | Bacteria | 3760 |
| 347 | Ga0495608_0005022 | 3300046511 | Bacteria | 9466 |
| 348 | Ga0495652_0041130 | 3300046529 | Bacteria | 3992 |
| 349 | Ga0495645_0002883 | 3300046543 | Bacteria | 11674 |
| 350 | Ga0495656_0023095 | 3300046615 | Bacteria | 2444 |
| 351 | Ga0495647_0006923 | 3300046681 | Bacteria | 3776 |
| 352 | Ga0495658_0014098 | 3300046683 | Bacteria | 4076 |
| 353 | Ga0495669_0013230 | 3300046684 | Unclassified | 3514 |
| 354 | Ga0495613_0002297 | 3300046689 | Bacteria | 14479 |
| 355 | Ga0495674_0008046 | 3300047319 | Bacteria | 10065 |
| 356 | Ga0495684_0000747 | 3300047471 | Bacteria | 26203 |
| 357 | Ga0495684_0057105 | 3300047471 | Bacteria | 2975 |
| 358 | Ga0496104_0030378 | 3300048907 | Bacteria | 5021 |
| 359 | Ga0496106_0094325 | 3300048909 | Unclassified | 2314 |
| 360 | Ga0496107_0058825 | 3300048910 | Viruses | 2780 |
| 361 | Ga0496113_0030081 | 3300048916 | Bacteria | 3928 |
| 362 | Ga0496113_0098977 | 3300048916 | Bacteria | 2258 |
| 363 | Ga0501031_0007356 | 3300049568 | Bacteria | 7177 |
| 364 | Ga0501032_0003211 | 3300049569 | Bacteria | 12566 |
| 365 | Ga0501032_0041472 | 3300049569 | Bacteria | 3125 |
| 366 | Ga0501033_0000840 | 3300049570 | Bacteria | 28057 |
| 367 | Ga0501033_0001633 | 3300049570 | Bacteria | 19683 |
| 368 | Ga0501034_0023851 | 3300049571 | Bacteria | 6230 |
| 369 | Ga0501034_0115041 | 3300049571 | Bacteria | 2678 |
| 370 | Ga0501034_0153403 | 3300049571 | Bacteria | 2278 |
| 371 | Ga0501036_0003227 | 3300049572 | Bacteria | 13005 |
| 372 | Ga0501036_0008827 | 3300049572 | Bacteria | 8276 |
| 373 | Ga0501037_0001117 | 3300049573 | Bacteria | 19932 |
| 374 | Ga0501037_0042919 | 3300049573 | Unclassified | 3323 |
| 375 | Ga0501038_0001068 | 3300049574 | Bacteria | 24735 |
| 376 | Ga0501042_0180387 | 3300049578 | Bacteria | 1523 |
| 377 | Ga0501043_0048876 | 3300049579 | Bacteria | 3324 |
| 378 | Ga0501046_0002503 | 3300049580 | Bacteria | 17207 |
| 379 | Ga0501047_0004378 | 3300049581 | Bacteria | 13290 |
| 380 | Ga0501047_0005191 | 3300049581 | Bacteria | 12226 |
| 381 | Ga0501047_0008268 | 3300049581 | Bacteria | 9821 |
| 382 | Ga0501048_0010355 | 3300049582 | Bacteria | 6965 |
| 383 | Ga0501048_0060347 | 3300049582 | Bacteria | 2687 |
| 384 | Ga0501067_0005668 | 3300049583 | Bacteria | 6932 |
| 385 | Ga0501068_0019638 | 3300049584 | Bacteria | 3927 |
| 386 | Ga0501070_0007239 | 3300049586 | Bacteria | 9422 |
| 387 | Ga0501070_0010639 | 3300049586 | Bacteria | 7776 |
| 388 | Ga0501073_0007229 | 3300049589 | Bacteria | 8266 |
| 389 | Ga0501073_0012179 | 3300049589 | Bacteria | 6279 |
| 390 | Ga0501073_0037576 | 3300049589 | Bacteria | 3436 |
| 391 | Ga0501074_0004313 | 3300049590 | Bacteria | 10156 |
| 392 | Ga0501076_0047978 | 3300049592 | Bacteria | 3376 |
| 393 | Ga0501076_0099080 | 3300049592 | Bacteria | 2348 |
| 394 | Ga0501079_0005515 | 3300049741 | Bacteria | 9432 |
| 395 | Ga0501079_0015532 | 3300049741 | Bacteria | 5812 |
| 396 | Ga0501080_0017331 | 3300049742 | Bacteria | 6658 |
| 397 | Ga0501080_0038776 | 3300049742 | Bacteria | 4446 |
| 398 | Ga0501083_0006968 | 3300049744 | Bacteria | 8018 |
| 399 | Ga0501083_0058812 | 3300049744 | Bacteria | 2571 |
| 400 | Ga0501083_0111790 | 3300049744 | Bacteria | 1795 |
| 401 | Ga0501035_0001367 | 3300049822 | Bacteria | 25092 |
| 402 | Ga0501044_0004959 | 3300049823 | Bacteria | 14884 |
| 403 | Ga0501044_0007308 | 3300049823 | Bacteria | 12137 |
| 404 | nmdc:mga03683_20801_c1 | 3300050489 | Bacteria | 2523 |
| 405 | nmdc:mga0yw44_6290_c1 | 3300050492 | Bacteria | 5723 |
| 406 | nmdc:mga0k408_388_c2 | 3300050493 | Bacteria | 14713 |
| 407 | nmdc:mga06z11_369_c1 | 3300050494 | Bacteria | 17005 |
| 408 | nmdc:mga07m45_8854_c1 | 3300050496 | Bacteria | 5193 |
| 409 | nmdc:mga05p37_135757_c1 | 3300050507 | Bacteria | 3017 |
| 410 | nmdc:mga05p37_142447_c1 | 3300050507 | Bacteria | 1668 |
| 411 | nmdc:mga05p37_148482_c1 | 3300050507 | Bacteria | 2869 |
| 412 | nmdc:mga05p37_17015_c1 | 3300050507 | Bacteria | 8769 |
| 413 | nmdc:mga05p37_17741_c1 | 3300050507 | Bacteria | 8590 |
| 414 | nmdc:mga05p37_19524_c1 | 3300050507 | Bacteria | 8199 |
| 415 | nmdc:mga05p37_20223_c1 | 3300050507 | Bacteria | 8058 |
| 416 | nmdc:mga05p37_21043_c1 | 3300050507 | Bacteria | 7894 |
| 417 | nmdc:mga05p37_3402_c1 | 3300050507 | Bacteria | 18563 |
| 418 | nmdc:mga05p37_39098_c1 | 3300050507 | Bacteria | 5821 |
| 419 | nmdc:mga05p37_42748_c1 | 3300050507 | Bacteria | 5570 |
| 420 | nmdc:mga05p37_44036_c1 | 3300050507 | Bacteria | 5491 |
| 421 | nmdc:mga05p37_48334_c1 | 3300050507 | Bacteria | 5233 |
| 422 | nmdc:mga05p37_52930_c1 | 3300050507 | Bacteria | 4993 |
| 423 | nmdc:mga05p37_76861_c1 | 3300050507 | Unclassified | 4110 |
| 424 | nmdc:mga09592_113114_c1 | 3300050508 | Unclassified | 2329 |
| 425 | nmdc:mga09592_14113_c1 | 3300050508 | Bacteria | 6520 |
| 426 | nmdc:mga06r32_175621_c1 | 3300050510 | Bacteria | 2126 |
| 427 | nmdc:mga08y16_121626_c1 | 3300050511 | Unclassified | 2717 |
| 428 | nmdc:mga08y16_1593_c1 | 3300050511 | Bacteria | 22918 |
| 429 | nmdc:mga08y16_22307_c1 | 3300050511 | Bacteria | 6681 |
| 430 | nmdc:mga08y16_78200_c1 | 3300050511 | Bacteria | 3449 |
| 431 | nmdc:mga08y16_925_c1 | 3300050511 | Bacteria | 28503 |
| 432 | nmdc:mga0n895_100358_c1 | 3300050512 | Bacteria | 2903 |
| 433 | nmdc:mga0n895_12_c1 | 3300050512 | Bacteria | 112043 |
| 434 | nmdc:mga0n895_33336_c1 | 3300050512 | Bacteria | 4949 |
| 435 | nmdc:mga0n895_4403_c1 | 3300050512 | Bacteria | 11565 |
| 436 | nmdc:mga0n895_53343_c1 | 3300050512 | Bacteria | 3973 |
| 437 | nmdc:mga0n895_94282_c1 | 3300050512 | Bacteria | 2997 |
| 438 | nmdc:mga0rr50_115973_c1 | 3300050513 | Bacteria | 2126 |
| 439 | nmdc:mga0rr50_191_c1 | 3300050513 | Bacteria | 33287 |
| 440 | nmdc:mga0rr50_1_c1 | 3300050513 | Bacteria | 558123 |
| 441 | nmdc:mga0rr50_97643_c1 | 3300050513 | Bacteria | 2301 |
| 442 | nmdc:mga08x19_13308_c1 | 3300050514 | Bacteria | 4971 |
| 443 | nmdc:mga08x19_87_c1 | 3300050514 | Bacteria | 83168 |
| 444 | nmdc:mga0a205_19785_c1 | 3300050515 | Bacteria | 6352 |
| 445 | nmdc:mga0a205_2346_c1 | 3300050515 | Bacteria | 16706 |
| 446 | nmdc:mga0a205_29871_c1 | 3300050515 | Bacteria | 4518 |
| 447 | nmdc:mga0a205_7003_c1 | 3300050515 | Bacteria | 10186 |
| 448 | nmdc:mga0a205_88182_c1 | 3300050515 | Bacteria | 2998 |
| 449 | Ga0495601_0006397 | 3300053077 | Bacteria | 6887 |
| 450 | Ga0495601_0009632 | 3300053077 | Bacteria | 5720 |
| 451 | Ga0495601_0057904 | 3300053077 | Bacteria | 2455 |
| 452 | Ga0495601_0078215 | 3300053077 | Bacteria | 2119 |
| 453 | Ga0495619_0001802 | 3300053085 | Bacteria | 14250 |
| 454 | Ga0495619_0027711 | 3300053085 | Bacteria | 3652 |
| 455 | Ga0495619_0135796 | 3300053085 | Unclassified | 1692 |
| 456 | Ga0501084_0007657 | 3300054114 | Bacteria | 8900 |
| 457 | Ga0501082_0015688 | 3300060353 | Bacteria | 6517 |
| 458 | Ga0501082_0043859 | 3300060353 | Bacteria | 3857 |
| 459 | Ga0501082_0079373 | 3300060353 | Bacteria | 2831 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_48334_c1 | nmdc:mga05p37_48334_c1_24_1157 | 370 |
| 2 | 3300006871 | Ga0075434_100310853 | Ga0075434_1003108532 | 389 |
| 3 | 3300009147 | Ga0114129_10027372 | Ga0114129_100273724 | 408 |
| 4 | 3300050507 | nmdc:mga05p37_44036_c1 | nmdc:mga05p37_44036_c1_95_1420 | 408 |
| 5 | 3300035086 | Ga0373934_0030216 | Ga0373934_0030216_35_1276 | 411 |
| 6 | 3300046462 | Ga0495651_0188999 | Ga0495651_0188999_176_1417 | 411 |
| 7 | 3300053077 | Ga0495601_0078215 | Ga0495601_0078215_860_2098 | 411 |
| 8 | 3300050513 | nmdc:mga0rr50_97643_c1 | nmdc:mga0rr50_97643_c1_995_2275 | 421 |
| 9 | 3300050510 | nmdc:mga06r32_175621_c1 | nmdc:mga06r32_175621_c1_31_1320 | 422 |
| 10 | 3300053085 | Ga0495619_0135796 | Ga0495619_0135796_381_1664 | 426 |
| 11 | 3300005518 | Ga0070699_100069157 | Ga0070699_1000691572 | 439 |
| 12 | 3300049578 | Ga0501042_0180387 | Ga0501042_0180387_23_1354 | 443 |
| 13 | 3300005458 | Ga0070681_10098333 | Ga0070681_100983332 | 445 |
| 14 | 3300005614 | Ga0068856_100259497 | Ga0068856_1002594972 | 445 |
| 15 | 3300025926 | Ga0207659_10006238 | Ga0207659_100062383 | 446 |
| 16 | 3300025933 | Ga0207706_10043902 | Ga0207706_100439023 | 446 |
| 17 | 3300025972 | Ga0207668_10085800 | Ga0207668_100858002 | 446 |
| 18 | 3300028380 | Ga0268265_10078194 | Ga0268265_100781943 | 446 |
| 19 | 3300036401 | Ga0373937_0227421 | Ga0373937_0227421_380_1732 | 449 |
| 20 | 3300046683 | Ga0495658_0014098 | Ga0495658_0014098_85_1479 | 450 |
| 21 | 3300006177 | Ga0075362_10001000 | Ga0075362_100010006 | 452 |
| 22 | 3300025908 | Ga0207643_10073516 | Ga0207643_100735161 | 454 |
| 23 | 3300005467 | Ga0070706_100232027 | Ga0070706_1002320271 | 455 |
| 24 | 3300005518 | Ga0070699_100005774 | Ga0070699_1000057749 | 455 |
| 25 | 3300005546 | Ga0070696_100003832 | Ga0070696_1000038327 | 455 |
| 26 | 3300005549 | Ga0070704_100158316 | Ga0070704_1001583162 | 455 |
| 27 | 3300007076 | Ga0075435_100050282 | Ga0075435_1000502823 | 455 |
| 28 | 3300009147 | Ga0114129_10015833 | Ga0114129_100158337 | 455 |
| 29 | 3300025922 | Ga0207646_10136974 | Ga0207646_101369742 | 455 |
| 30 | 3300050507 | nmdc:mga05p37_52930_c1 | nmdc:mga05p37_52930_c1_311_1756 | 455 |
| 31 | 3300006852 | Ga0075433_10016364 | Ga0075433_100163647 | 456 |
| 32 | 3300007076 | Ga0075435_100067359 | Ga0075435_1000673592 | 456 |
| 33 | 3300009147 | Ga0114129_10000153 | Ga0114129_1000015321 | 456 |
| 34 | 3300046681 | Ga0495647_0006923 | Ga0495647_0006923_89_1462 | 456 |
| 35 | 3300050512 | nmdc:mga0n895_33336_c1 | nmdc:mga0n895_33336_c1_2915_4306 | 456 |
| 36 | 3300050515 | nmdc:mga0a205_2346_c1 | nmdc:mga0a205_2346_c1_7099_8490 | 456 |
| 37 | 3300035691 | Ga0373931_0006859 | Ga0373931_0006859_3491_4888 | 458 |
| 38 | 3300044673 | Ga0453683_0047118 | Ga0453683_0047118_191_1585 | 458 |
| 39 | 3300009094 | Ga0111539_10063153 | Ga0111539_100631534 | 459 |
| 40 | 3300009147 | Ga0114129_10078510 | Ga0114129_100785103 | 459 |
| 41 | 3300011119 | Ga0105246_10077231 | Ga0105246_100772312 | 459 |
| 42 | 3300027907 | Ga0207428_10036425 | Ga0207428_100364253 | 459 |
| 43 | 3300050507 | nmdc:mga05p37_17741_c1 | nmdc:mga05p37_17741_c1_6576_7976 | 459 |
| 44 | 3300050507 | nmdc:mga05p37_19524_c1 | nmdc:mga05p37_19524_c1_2146_3546 | 459 |
| 45 | 3300050511 | nmdc:mga08y16_22307_c1 | nmdc:mga08y16_22307_c1_5217_6599 | 459 |
| 46 | 3300005328 | Ga0070676_10002154 | Ga0070676_100021543 | 460 |
| 47 | 3300005330 | Ga0070690_100073108 | Ga0070690_1000731082 | 460 |
| 48 | 3300005334 | Ga0068869_100005534 | Ga0068869_1000055342 | 460 |
| 49 | 3300005338 | Ga0068868_100067530 | Ga0068868_1000675302 | 460 |
| 50 | 3300005341 | Ga0070691_10002578 | Ga0070691_100025786 | 460 |
| 51 | 3300005353 | Ga0070669_100022378 | Ga0070669_1000223782 | 460 |
| 52 | 3300005356 | Ga0070674_100005617 | Ga0070674_1000056172 | 460 |
| 53 | 3300005365 | Ga0070688_100007957 | Ga0070688_1000079572 | 460 |
| 54 | 3300005440 | Ga0070705_100014457 | Ga0070705_1000144574 | 460 |
| 55 | 3300005441 | Ga0070700_100001992 | Ga0070700_1000019923 | 460 |
| 56 | 3300005445 | Ga0070708_100005784 | Ga0070708_1000057846 | 460 |
| 57 | 3300005455 | Ga0070663_100064930 | Ga0070663_1000649302 | 460 |
| 58 | 3300005459 | Ga0068867_100010235 | Ga0068867_1000102354 | 460 |
| 59 | 3300005467 | Ga0070706_100055764 | Ga0070706_1000557642 | 460 |
| 60 | 3300005468 | Ga0070707_100057151 | Ga0070707_1000571513 | 460 |
| 61 | 3300005471 | Ga0070698_100116381 | Ga0070698_1001163812 | 460 |
| 62 | 3300005518 | Ga0070699_100031623 | Ga0070699_1000316234 | 460 |
| 63 | 3300005545 | Ga0070695_100018206 | Ga0070695_1000182061 | 460 |
| 64 | 3300005546 | Ga0070696_100004285 | Ga0070696_1000042856 | 460 |
| 65 | 3300005549 | Ga0070704_100082752 | Ga0070704_1000827522 | 460 |
| 66 | 3300005577 | Ga0068857_100151248 | Ga0068857_1001512481 | 460 |
| 67 | 3300005578 | Ga0068854_100005532 | Ga0068854_1000055324 | 460 |
| 68 | 3300005615 | Ga0070702_100013685 | Ga0070702_1000136853 | 460 |
| 69 | 3300005615 | Ga0070702_100021880 | Ga0070702_1000218802 | 460 |
| 70 | 3300005719 | Ga0068861_100003132 | Ga0068861_1000031325 | 460 |
| 71 | 3300005719 | Ga0068861_100025775 | Ga0068861_1000257753 | 460 |
| 72 | 3300005841 | Ga0068863_100062504 | Ga0068863_1000625042 | 460 |
| 73 | 3300005842 | Ga0068858_100092610 | Ga0068858_1000926102 | 460 |
| 74 | 3300005844 | Ga0068862_100222004 | Ga0068862_1002220041 | 460 |
| 75 | 3300006038 | Ga0075365_10016653 | Ga0075365_100166533 | 460 |
| 76 | 3300006042 | Ga0075368_10039429 | Ga0075368_100394292 | 460 |
| 77 | 3300006051 | Ga0075364_10057376 | Ga0075364_100573762 | 460 |
| 78 | 3300006177 | Ga0075362_10010270 | Ga0075362_100102703 | 460 |
| 79 | 3300006847 | Ga0075431_100011609 | Ga0075431_1000116096 | 460 |
| 80 | 3300006852 | Ga0075433_10030908 | Ga0075433_100309082 | 460 |
| 81 | 3300006871 | Ga0075434_100012701 | Ga0075434_1000127015 | 460 |
| 82 | 3300006880 | Ga0075429_100026436 | Ga0075429_1000264364 | 460 |
| 83 | 3300009094 | Ga0111539_10001822 | Ga0111539_100018225 | 460 |
| 84 | 3300009094 | Ga0111539_10003099 | Ga0111539_100030997 | 460 |
| 85 | 3300009147 | Ga0114129_10015886 | Ga0114129_100158869 | 460 |
| 86 | 3300009148 | Ga0105243_10004496 | Ga0105243_100044962 | 460 |
| 87 | 3300009148 | Ga0105243_10026162 | Ga0105243_100261622 | 460 |
| 88 | 3300009176 | Ga0105242_10093831 | Ga0105242_100938313 | 460 |
| 89 | 3300009176 | Ga0105242_10247047 | Ga0105242_102470471 | 460 |
| 90 | 3300013308 | Ga0157375_10256897 | Ga0157375_102568972 | 460 |
| 91 | 3300014326 | Ga0157380_10041398 | Ga0157380_100413981 | 460 |
| 92 | 3300014968 | Ga0157379_10058203 | Ga0157379_100582032 | 460 |
| 93 | 3300025907 | Ga0207645_10009335 | Ga0207645_100093353 | 460 |
| 94 | 3300025910 | Ga0207684_10025242 | Ga0207684_100252423 | 460 |
| 95 | 3300025918 | Ga0207662_10005323 | Ga0207662_100053234 | 460 |
| 96 | 3300025918 | Ga0207662_10133577 | Ga0207662_101335772 | 460 |
| 97 | 3300025927 | Ga0207687_10028799 | Ga0207687_100287993 | 460 |
| 98 | 3300025933 | Ga0207706_10025632 | Ga0207706_100256322 | 460 |
| 99 | 3300025934 | Ga0207686_10043704 | Ga0207686_100437043 | 460 |
| 100 | 3300025934 | Ga0207686_10157174 | Ga0207686_101571742 | 460 |
| 101 | 3300025935 | Ga0207709_10012657 | Ga0207709_100126574 | 460 |
| 102 | 3300025937 | Ga0207669_10005780 | Ga0207669_100057804 | 460 |
| 103 | 3300025940 | Ga0207691_10041882 | Ga0207691_100418822 | 460 |
| 104 | 3300025942 | Ga0207689_10004016 | Ga0207689_100040165 | 460 |
| 105 | 3300026023 | Ga0207677_10052258 | Ga0207677_100522583 | 460 |
| 106 | 3300026035 | Ga0207703_10014989 | Ga0207703_100149895 | 460 |
| 107 | 3300026067 | Ga0207678_10063230 | Ga0207678_100632303 | 460 |
| 108 | 3300026075 | Ga0207708_10009103 | Ga0207708_100091035 | 460 |
| 109 | 3300026075 | Ga0207708_10050745 | Ga0207708_100507452 | 460 |
| 110 | 3300026089 | Ga0207648_10007078 | Ga0207648_100070789 | 460 |
| 111 | 3300026089 | Ga0207648_10016579 | Ga0207648_100165794 | 460 |
| 112 | 3300026118 | Ga0207675_100001595 | Ga0207675_1000015955 | 460 |
| 113 | 3300026118 | Ga0207675_100039047 | Ga0207675_1000390472 | 460 |
| 114 | 3300026121 | Ga0207683_10012512 | Ga0207683_100125126 | 460 |
| 115 | 3300027907 | Ga0207428_10000041 | Ga0207428_1000004112 | 460 |
| 116 | 3300027907 | Ga0207428_10004093 | Ga0207428_100040934 | 460 |
| 117 | 3300028380 | Ga0268265_10193567 | Ga0268265_101935672 | 460 |
| 118 | 3300050489 | nmdc:mga03683_20801_c1 | nmdc:mga03683_20801_c1_101_1492 | 460 |
| 119 | 3300050492 | nmdc:mga0yw44_6290_c1 | nmdc:mga0yw44_6290_c1_2395_3786 | 460 |
| 120 | 3300050493 | nmdc:mga0k408_388_c2 | nmdc:mga0k408_388_c2_12502_13893 | 460 |
| 121 | 3300050494 | nmdc:mga06z11_369_c1 | nmdc:mga06z11_369_c1_14695_16086 | 460 |
| 122 | 3300050496 | nmdc:mga07m45_8854_c1 | nmdc:mga07m45_8854_c1_3572_4963 | 460 |
| 123 | 3300050507 | nmdc:mga05p37_148482_c1 | nmdc:mga05p37_148482_c1_260_1654 | 460 |
| 124 | 3300050507 | nmdc:mga05p37_21043_c1 | nmdc:mga05p37_21043_c1_3312_4712 | 460 |
| 125 | 3300050508 | nmdc:mga09592_14113_c1 | nmdc:mga09592_14113_c1_833_2224 | 460 |
| 126 | 3300050511 | nmdc:mga08y16_925_c1 | nmdc:mga08y16_925_c1_5946_7337 | 460 |
| 127 | 3300050512 | nmdc:mga0n895_94282_c1 | nmdc:mga0n895_94282_c1_570_1970 | 460 |
| 128 | 3300050515 | nmdc:mga0a205_19785_c1 | nmdc:mga0a205_19785_c1_66_1466 | 460 |
| 129 | 3300005445 | Ga0070708_100013595 | Ga0070708_1000135956 | 461 |
| 130 | 3300005518 | Ga0070699_100000480 | Ga0070699_10000048025 | 461 |
| 131 | 3300005842 | Ga0068858_100061072 | Ga0068858_1000610723 | 461 |
| 132 | 3300006852 | Ga0075433_10127309 | Ga0075433_101273091 | 461 |
| 133 | 3300006871 | Ga0075434_100003323 | Ga0075434_1000033233 | 461 |
| 134 | 3300007076 | Ga0075435_100042563 | Ga0075435_1000425633 | 461 |
| 135 | 3300009147 | Ga0114129_10170132 | Ga0114129_101701321 | 461 |
| 136 | 3300025972 | Ga0207668_10045421 | Ga0207668_100454211 | 461 |
| 137 | 3300026035 | Ga0207703_10131693 | Ga0207703_101316932 | 461 |
| 138 | 3300050507 | nmdc:mga05p37_142447_c1 | nmdc:mga05p37_142447_c1_140_1540 | 461 |
| 139 | 3300050512 | nmdc:mga0n895_53343_c1 | nmdc:mga0n895_53343_c1_1582_2982 | 461 |
| 140 | 3300050515 | nmdc:mga0a205_88182_c1 | nmdc:mga0a205_88182_c1_108_1508 | 461 |
| 141 | 3300005331 | Ga0070670_100078599 | Ga0070670_1000785991 | 462 |
| 142 | 3300005530 | Ga0070679_100035148 | Ga0070679_1000351483 | 462 |
| 143 | 3300005535 | Ga0070684_100047449 | Ga0070684_1000474493 | 462 |
| 144 | 3300005719 | Ga0068861_100058946 | Ga0068861_1000589461 | 462 |
| 145 | 3300006852 | Ga0075433_10025684 | Ga0075433_100256843 | 462 |
| 146 | 3300006871 | Ga0075434_100020696 | Ga0075434_1000206965 | 462 |
| 147 | 3300009098 | Ga0105245_10188397 | Ga0105245_101883972 | 462 |
| 148 | 3300009147 | Ga0114129_10004368 | Ga0114129_100043689 | 462 |
| 149 | 3300009147 | Ga0114129_10357169 | Ga0114129_103571691 | 462 |
| 150 | 3300025913 | Ga0207695_10201532 | Ga0207695_102015322 | 462 |
| 151 | 3300025921 | Ga0207652_10072038 | Ga0207652_100720382 | 462 |
| 152 | 3300025932 | Ga0207690_10027640 | Ga0207690_100276402 | 462 |
| 153 | 3300025944 | Ga0207661_10012184 | Ga0207661_100121845 | 462 |
| 154 | 3300026121 | Ga0207683_10093289 | Ga0207683_100932893 | 462 |
| 155 | 3300046463 | Ga0495653_0038376 | Ga0495653_0038376_1209_2621 | 462 |
| 156 | 3300046615 | Ga0495656_0023095 | Ga0495656_0023095_547_1935 | 462 |
| 157 | 3300049568 | Ga0501031_0007356 | Ga0501031_0007356_5417_6805 | 462 |
| 158 | 3300049569 | Ga0501032_0003211 | Ga0501032_0003211_3902_5290 | 462 |
| 159 | 3300049569 | Ga0501032_0041472 | Ga0501032_0041472_1459_2847 | 462 |
| 160 | 3300049570 | Ga0501033_0000840 | Ga0501033_0000840_7862_9250 | 462 |
| 161 | 3300049570 | Ga0501033_0001633 | Ga0501033_0001633_8877_10265 | 462 |
| 162 | 3300049571 | Ga0501034_0115041 | Ga0501034_0115041_873_2261 | 462 |
| 163 | 3300049571 | Ga0501034_0153403 | Ga0501034_0153403_461_1849 | 462 |
| 164 | 3300049572 | Ga0501036_0003227 | Ga0501036_0003227_8748_10136 | 462 |
| 165 | 3300049572 | Ga0501036_0008827 | Ga0501036_0008827_35_1423 | 462 |
| 166 | 3300049573 | Ga0501037_0001117 | Ga0501037_0001117_14425_15813 | 462 |
| 167 | 3300049573 | Ga0501037_0042919 | Ga0501037_0042919_1537_2925 | 462 |
| 168 | 3300049574 | Ga0501038_0001068 | Ga0501038_0001068_4588_5976 | 462 |
| 169 | 3300049579 | Ga0501043_0048876 | Ga0501043_0048876_1538_2926 | 462 |
| 170 | 3300049580 | Ga0501046_0002503 | Ga0501046_0002503_9471_10859 | 462 |
| 171 | 3300049581 | Ga0501047_0008268 | Ga0501047_0008268_4346_5734 | 462 |
| 172 | 3300049582 | Ga0501048_0010355 | Ga0501048_0010355_641_2029 | 462 |
| 173 | 3300049582 | Ga0501048_0060347 | Ga0501048_0060347_611_1999 | 462 |
| 174 | 3300049584 | Ga0501068_0019638 | Ga0501068_0019638_436_1824 | 462 |
| 175 | 3300049586 | Ga0501070_0007239 | Ga0501070_0007239_4321_5709 | 462 |
| 176 | 3300049586 | Ga0501070_0010639 | Ga0501070_0010639_1903_3291 | 462 |
| 177 | 3300049589 | Ga0501073_0012179 | Ga0501073_0012179_490_1878 | 462 |
| 178 | 3300049589 | Ga0501073_0037576 | Ga0501073_0037576_1588_2976 | 462 |
| 179 | 3300049590 | Ga0501074_0004313 | Ga0501074_0004313_4681_6069 | 462 |
| 180 | 3300049592 | Ga0501076_0047978 | Ga0501076_0047978_797_2185 | 462 |
| 181 | 3300049592 | Ga0501076_0099080 | Ga0501076_0099080_34_1422 | 462 |
| 182 | 3300049741 | Ga0501079_0005515 | Ga0501079_0005515_6757_8145 | 462 |
| 183 | 3300049741 | Ga0501079_0015532 | Ga0501079_0015532_3952_5340 | 462 |
| 184 | 3300049742 | Ga0501080_0017331 | Ga0501080_0017331_4088_5476 | 462 |
| 185 | 3300049742 | Ga0501080_0038776 | Ga0501080_0038776_1835_3223 | 462 |
| 186 | 3300049744 | Ga0501083_0006968 | Ga0501083_0006968_4594_5982 | 462 |
| 187 | 3300049744 | Ga0501083_0111790 | Ga0501083_0111790_34_1422 | 462 |
| 188 | 3300049822 | Ga0501035_0001367 | Ga0501035_0001367_18808_20196 | 462 |
| 189 | 3300049823 | Ga0501044_0004959 | Ga0501044_0004959_5783_7171 | 462 |
| 190 | 3300050507 | nmdc:mga05p37_3402_c1 | nmdc:mga05p37_3402_c1_12602_14008 | 462 |
| 191 | 3300050507 | nmdc:mga05p37_42748_c1 | nmdc:mga05p37_42748_c1_2017_3438 | 462 |
| 192 | 3300050515 | nmdc:mga0a205_29871_c1 | nmdc:mga0a205_29871_c1_906_2312 | 462 |
| 193 | 3300054114 | Ga0501084_0007657 | Ga0501084_0007657_2866_4254 | 462 |
| 194 | 3300060353 | Ga0501082_0015688 | Ga0501082_0015688_3373_4761 | 462 |
| 195 | 3300060353 | Ga0501082_0043859 | Ga0501082_0043859_621_2009 | 462 |
| 196 | 3300001977 | JGI24746J21847_1000823 | JGI24746J21847_10008234 | 463 |
| 197 | 3300005290 | Ga0065712_10073436 | Ga0065712_100734362 | 463 |
| 198 | 3300005330 | Ga0070690_100006893 | Ga0070690_1000068931 | 463 |
| 199 | 3300005330 | Ga0070690_100051930 | Ga0070690_1000519302 | 463 |
| 200 | 3300005333 | Ga0070677_10004154 | Ga0070677_100041544 | 463 |
| 201 | 3300005333 | Ga0070677_10010371 | Ga0070677_100103713 | 463 |
| 202 | 3300005334 | Ga0068869_100021319 | Ga0068869_1000213193 | 463 |
| 203 | 3300005335 | Ga0070666_10007681 | Ga0070666_100076813 | 463 |
| 204 | 3300005338 | Ga0068868_100009344 | Ga0068868_1000093444 | 463 |
| 205 | 3300005338 | Ga0068868_100063644 | Ga0068868_1000636442 | 463 |
| 206 | 3300005340 | Ga0070689_100182408 | Ga0070689_1001824081 | 463 |
| 207 | 3300005343 | Ga0070687_100007102 | Ga0070687_1000071023 | 463 |
| 208 | 3300005344 | Ga0070661_100082861 | Ga0070661_1000828612 | 463 |
| 209 | 3300005353 | Ga0070669_100011904 | Ga0070669_1000119046 | 463 |
| 210 | 3300005353 | Ga0070669_100012576 | Ga0070669_1000125762 | 463 |
| 211 | 3300005354 | Ga0070675_100003945 | Ga0070675_1000039452 | 463 |
| 212 | 3300005354 | Ga0070675_100009113 | Ga0070675_1000091136 | 463 |
| 213 | 3300005355 | Ga0070671_100011733 | Ga0070671_1000117332 | 463 |
| 214 | 3300005355 | Ga0070671_100025997 | Ga0070671_1000259974 | 463 |
| 215 | 3300005364 | Ga0070673_100000718 | Ga0070673_10000071811 | 463 |
| 216 | 3300005364 | Ga0070673_100001224 | Ga0070673_1000012247 | 463 |
| 217 | 3300005364 | Ga0070673_100015137 | Ga0070673_1000151374 | 463 |
| 218 | 3300005364 | Ga0070673_100058572 | Ga0070673_1000585723 | 463 |
| 219 | 3300005365 | Ga0070688_100008290 | Ga0070688_1000082904 | 463 |
| 220 | 3300005435 | Ga0070714_100020743 | Ga0070714_1000207432 | 463 |
| 221 | 3300005436 | Ga0070713_100167840 | Ga0070713_1001678402 | 463 |
| 222 | 3300005439 | Ga0070711_100097301 | Ga0070711_1000973012 | 463 |
| 223 | 3300005441 | Ga0070700_100009373 | Ga0070700_1000093735 | 463 |
| 224 | 3300005441 | Ga0070700_100067888 | Ga0070700_1000678882 | 463 |
| 225 | 3300005445 | Ga0070708_100011788 | Ga0070708_1000117883 | 463 |
| 226 | 3300005455 | Ga0070663_100161531 | Ga0070663_1001615312 | 463 |
| 227 | 3300005456 | Ga0070678_100022064 | Ga0070678_1000220642 | 463 |
| 228 | 3300005456 | Ga0070678_100026337 | Ga0070678_1000263373 | 463 |
| 229 | 3300005456 | Ga0070678_100122099 | Ga0070678_1001220991 | 463 |
| 230 | 3300005457 | Ga0070662_100047468 | Ga0070662_1000474681 | 463 |
| 231 | 3300005459 | Ga0068867_100019633 | Ga0068867_1000196333 | 463 |
| 232 | 3300005467 | Ga0070706_100241702 | Ga0070706_1002417021 | 463 |
| 233 | 3300005468 | Ga0070707_100001823 | Ga0070707_1000018237 | 463 |
| 234 | 3300005518 | Ga0070699_100155370 | Ga0070699_1001553702 | 463 |
| 235 | 3300005535 | Ga0070684_100103418 | Ga0070684_1001034182 | 463 |
| 236 | 3300005543 | Ga0070672_100009960 | Ga0070672_1000099602 | 463 |
| 237 | 3300005543 | Ga0070672_100066110 | Ga0070672_1000661104 | 463 |
| 238 | 3300005544 | Ga0070686_100004659 | Ga0070686_1000046593 | 463 |
| 239 | 3300005544 | Ga0070686_100021484 | Ga0070686_1000214841 | 463 |
| 240 | 3300005546 | Ga0070696_100006008 | Ga0070696_1000060083 | 463 |
| 241 | 3300005548 | Ga0070665_100006326 | Ga0070665_1000063265 | 463 |
| 242 | 3300005548 | Ga0070665_100018473 | Ga0070665_1000184732 | 463 |
| 243 | 3300005548 | Ga0070665_100173863 | Ga0070665_1001738632 | 463 |
| 244 | 3300005563 | Ga0068855_100144268 | Ga0068855_1001442683 | 463 |
| 245 | 3300005564 | Ga0070664_100014956 | Ga0070664_1000149564 | 463 |
| 246 | 3300005564 | Ga0070664_100023852 | Ga0070664_1000238523 | 463 |
| 247 | 3300005578 | Ga0068854_100004171 | Ga0068854_1000041715 | 463 |
| 248 | 3300005617 | Ga0068859_100005448 | Ga0068859_1000054486 | 463 |
| 249 | 3300005617 | Ga0068859_100016111 | Ga0068859_1000161116 | 463 |
| 250 | 3300005617 | Ga0068859_100111145 | Ga0068859_1001111452 | 463 |
| 251 | 3300005618 | Ga0068864_100026196 | Ga0068864_1000261961 | 463 |
| 252 | 3300005618 | Ga0068864_100038631 | Ga0068864_1000386314 | 463 |
| 253 | 3300005618 | Ga0068864_100207447 | Ga0068864_1002074472 | 463 |
| 254 | 3300005718 | Ga0068866_10007097 | Ga0068866_100070975 | 463 |
| 255 | 3300005719 | Ga0068861_100013671 | Ga0068861_1000136712 | 463 |
| 256 | 3300005840 | Ga0068870_10003118 | Ga0068870_100031186 | 463 |
| 257 | 3300005841 | Ga0068863_100145639 | Ga0068863_1001456392 | 463 |
| 258 | 3300005842 | Ga0068858_100017623 | Ga0068858_1000176232 | 463 |
| 259 | 3300005842 | Ga0068858_100071968 | Ga0068858_1000719683 | 463 |
| 260 | 3300005843 | Ga0068860_100018106 | Ga0068860_1000181064 | 463 |
| 261 | 3300005843 | Ga0068860_100019208 | Ga0068860_1000192082 | 463 |
| 262 | 3300005843 | Ga0068860_100083910 | Ga0068860_1000839102 | 463 |
| 263 | 3300005843 | Ga0068860_100156707 | Ga0068860_1001567071 | 463 |
| 264 | 3300005844 | Ga0068862_100012618 | Ga0068862_1000126185 | 463 |
| 265 | 3300005937 | Ga0081455_10016095 | Ga0081455_100160952 | 463 |
| 266 | 3300005985 | Ga0081539_10005303 | Ga0081539_1000530310 | 463 |
| 267 | 3300006358 | Ga0068871_100000983 | Ga0068871_10000098310 | 463 |
| 268 | 3300006852 | Ga0075433_10060641 | Ga0075433_100606411 | 463 |
| 269 | 3300006871 | Ga0075434_100002694 | Ga0075434_1000026947 | 463 |
| 270 | 3300006871 | Ga0075434_100002939 | Ga0075434_1000029394 | 463 |
| 271 | 3300006871 | Ga0075434_100148525 | Ga0075434_1001485252 | 463 |
| 272 | 3300006871 | Ga0075434_100223126 | Ga0075434_1002231261 | 463 |
| 273 | 3300006881 | Ga0068865_100001604 | Ga0068865_1000016046 | 463 |
| 274 | 3300006881 | Ga0068865_100007245 | Ga0068865_1000072451 | 463 |
| 275 | 3300006914 | Ga0075436_100000305 | Ga0075436_1000003053 | 463 |
| 276 | 3300006931 | Ga0097620_100005448 | Ga0097620_1000054486 | 463 |
| 277 | 3300006931 | Ga0097620_100016111 | Ga0097620_1000161116 | 463 |
| 278 | 3300006931 | Ga0097620_100111144 | Ga0097620_1001111442 | 463 |
| 279 | 3300007076 | Ga0075435_100000012 | Ga0075435_10000001275 | 463 |
| 280 | 3300007076 | Ga0075435_100007358 | Ga0075435_1000073583 | 463 |
| 281 | 3300009093 | Ga0105240_10031654 | Ga0105240_100316543 | 463 |
| 282 | 3300009093 | Ga0105240_10083102 | Ga0105240_100831023 | 463 |
| 283 | 3300009094 | Ga0111539_10001681 | Ga0111539_1000168114 | 463 |
| 284 | 3300009094 | Ga0111539_10044245 | Ga0111539_100442455 | 463 |
| 285 | 3300009094 | Ga0111539_10357233 | Ga0111539_103572331 | 463 |
| 286 | 3300009101 | Ga0105247_10001308 | Ga0105247_1000130813 | 463 |
| 287 | 3300009101 | Ga0105247_10040234 | Ga0105247_100402342 | 463 |
| 288 | 3300009147 | Ga0114129_10015794 | Ga0114129_100157947 | 463 |
| 289 | 3300009147 | Ga0114129_10020625 | Ga0114129_100206255 | 463 |
| 290 | 3300009147 | Ga0114129_10094228 | Ga0114129_100942283 | 463 |
| 291 | 3300009147 | Ga0114129_10355801 | Ga0114129_103558012 | 463 |
| 292 | 3300009176 | Ga0105242_10015625 | Ga0105242_100156253 | 463 |
| 293 | 3300009176 | Ga0105242_10029826 | Ga0105242_100298263 | 463 |
| 294 | 3300009176 | Ga0105242_10148635 | Ga0105242_101486352 | 463 |
| 295 | 3300009177 | Ga0105248_10004152 | Ga0105248_100041529 | 463 |
| 296 | 3300009177 | Ga0105248_10020608 | Ga0105248_100206083 | 463 |
| 297 | 3300009177 | Ga0105248_10028166 | Ga0105248_100281663 | 463 |
| 298 | 3300009177 | Ga0105248_10035993 | Ga0105248_100359932 | 463 |
| 299 | 3300009177 | Ga0105248_10055467 | Ga0105248_100554674 | 463 |
| 300 | 3300009177 | Ga0105248_10116668 | Ga0105248_101166682 | 463 |
| 301 | 3300009551 | Ga0105238_10010227 | Ga0105238_100102275 | 463 |
| 302 | 3300009553 | Ga0105249_10009530 | Ga0105249_100095302 | 463 |
| 303 | 3300009553 | Ga0105249_10148245 | Ga0105249_101482452 | 463 |
| 304 | 3300011119 | Ga0105246_10135493 | Ga0105246_101354931 | 463 |
| 305 | 3300013306 | Ga0163162_10015046 | Ga0163162_100150464 | 463 |
| 306 | 3300014325 | Ga0163163_10009290 | Ga0163163_100092902 | 463 |
| 307 | 3300014325 | Ga0163163_10065882 | Ga0163163_100658823 | 463 |
| 308 | 3300014326 | Ga0157380_10019511 | Ga0157380_100195114 | 463 |
| 309 | 3300014326 | Ga0157380_10019677 | Ga0157380_100196775 | 463 |
| 310 | 3300014326 | Ga0157380_10021741 | Ga0157380_100217412 | 463 |
| 311 | 3300014326 | Ga0157380_10074855 | Ga0157380_100748552 | 463 |
| 312 | 3300014326 | Ga0157380_10224041 | Ga0157380_102240411 | 463 |
| 313 | 3300014745 | Ga0157377_10015151 | Ga0157377_100151512 | 463 |
| 314 | 3300014745 | Ga0157377_10054341 | Ga0157377_100543412 | 463 |
| 315 | 3300014968 | Ga0157379_10013635 | Ga0157379_100136355 | 463 |
| 316 | 3300014968 | Ga0157379_10068979 | Ga0157379_100689792 | 463 |
| 317 | 3300014969 | Ga0157376_10013440 | Ga0157376_100134405 | 463 |
| 318 | 3300014969 | Ga0157376_10039983 | Ga0157376_100399834 | 463 |
| 319 | 3300014969 | Ga0157376_10046424 | Ga0157376_100464243 | 463 |
| 320 | 3300014969 | Ga0157376_10056086 | Ga0157376_100560863 | 463 |
| 321 | 3300017792 | Ga0163161_10006838 | Ga0163161_100068385 | 463 |
| 322 | 3300025315 | Ga0207697_10002571 | Ga0207697_100025715 | 463 |
| 323 | 3300025893 | Ga0207682_10002778 | Ga0207682_100027782 | 463 |
| 324 | 3300025893 | Ga0207682_10008735 | Ga0207682_100087353 | 463 |
| 325 | 3300025901 | Ga0207688_10011624 | Ga0207688_100116244 | 463 |
| 326 | 3300025907 | Ga0207645_10010470 | Ga0207645_100104702 | 463 |
| 327 | 3300025907 | Ga0207645_10010472 | Ga0207645_100104722 | 463 |
| 328 | 3300025908 | Ga0207643_10004226 | Ga0207643_100042263 | 463 |
| 329 | 3300025918 | Ga0207662_10019468 | Ga0207662_100194682 | 463 |
| 330 | 3300025918 | Ga0207662_10027644 | Ga0207662_100276443 | 463 |
| 331 | 3300025920 | Ga0207649_10100213 | Ga0207649_101002132 | 463 |
| 332 | 3300025922 | Ga0207646_10084164 | Ga0207646_100841643 | 463 |
| 333 | 3300025922 | Ga0207646_10135785 | Ga0207646_101357852 | 463 |
| 334 | 3300025922 | Ga0207646_10215204 | Ga0207646_102152042 | 463 |
| 335 | 3300025923 | Ga0207681_10013300 | Ga0207681_100133002 | 463 |
| 336 | 3300025923 | Ga0207681_10026199 | Ga0207681_100261991 | 463 |
| 337 | 3300025923 | Ga0207681_10061785 | Ga0207681_100617853 | 463 |
| 338 | 3300025924 | Ga0207694_10005515 | Ga0207694_100055157 | 463 |
| 339 | 3300025925 | Ga0207650_10015686 | Ga0207650_100156864 | 463 |
| 340 | 3300025925 | Ga0207650_10191688 | Ga0207650_101916882 | 463 |
| 341 | 3300025926 | Ga0207659_10002413 | Ga0207659_100024133 | 463 |
| 342 | 3300025926 | Ga0207659_10009242 | Ga0207659_100092425 | 463 |
| 343 | 3300025926 | Ga0207659_10015855 | Ga0207659_100158555 | 463 |
| 344 | 3300025926 | Ga0207659_10109111 | Ga0207659_101091112 | 463 |
| 345 | 3300025927 | Ga0207687_10066639 | Ga0207687_100666392 | 463 |
| 346 | 3300025928 | Ga0207700_10131698 | Ga0207700_101316982 | 463 |
| 347 | 3300025929 | Ga0207664_10036925 | Ga0207664_100369253 | 463 |
| 348 | 3300025931 | Ga0207644_10004503 | Ga0207644_100045037 | 463 |
| 349 | 3300025933 | Ga0207706_10006430 | Ga0207706_100064305 | 463 |
| 350 | 3300025933 | Ga0207706_10208017 | Ga0207706_102080171 | 463 |
| 351 | 3300025938 | Ga0207704_10008092 | Ga0207704_100080921 | 463 |
| 352 | 3300025940 | Ga0207691_10013506 | Ga0207691_100135062 | 463 |
| 353 | 3300025940 | Ga0207691_10015117 | Ga0207691_100151175 | 463 |
| 354 | 3300025940 | Ga0207691_10018112 | Ga0207691_100181129 | 463 |
| 355 | 3300025940 | Ga0207691_10077907 | Ga0207691_100779072 | 463 |
| 356 | 3300025941 | Ga0207711_10002803 | Ga0207711_100028039 | 463 |
| 357 | 3300025941 | Ga0207711_10002992 | Ga0207711_100029925 | 463 |
| 358 | 3300025941 | Ga0207711_10071743 | Ga0207711_100717433 | 463 |
| 359 | 3300025942 | Ga0207689_10003160 | Ga0207689_100031605 | 463 |
| 360 | 3300025942 | Ga0207689_10003182 | Ga0207689_100031823 | 463 |
| 361 | 3300025945 | Ga0207679_10006664 | Ga0207679_100066644 | 463 |
| 362 | 3300025945 | Ga0207679_10029864 | Ga0207679_100298641 | 463 |
| 363 | 3300025945 | Ga0207679_10148515 | Ga0207679_101485151 | 463 |
| 364 | 3300025960 | Ga0207651_10040858 | Ga0207651_100408582 | 463 |
| 365 | 3300025960 | Ga0207651_10078480 | Ga0207651_100784801 | 463 |
| 366 | 3300025961 | Ga0207712_10012583 | Ga0207712_100125832 | 463 |
| 367 | 3300025981 | Ga0207640_10145735 | Ga0207640_101457352 | 463 |
| 368 | 3300025986 | Ga0207658_10010962 | Ga0207658_100109625 | 463 |
| 369 | 3300025986 | Ga0207658_10169844 | Ga0207658_101698442 | 463 |
| 370 | 3300026023 | Ga0207677_10010755 | Ga0207677_100107554 | 463 |
| 371 | 3300026035 | Ga0207703_10013310 | Ga0207703_100133105 | 463 |
| 372 | 3300026035 | Ga0207703_10045833 | Ga0207703_100458332 | 463 |
| 373 | 3300026035 | Ga0207703_10173851 | Ga0207703_101738512 | 463 |
| 374 | 3300026067 | Ga0207678_10087169 | Ga0207678_100871693 | 463 |
| 375 | 3300026067 | Ga0207678_10138741 | Ga0207678_101387412 | 463 |
| 376 | 3300026075 | Ga0207708_10000706 | Ga0207708_100007063 | 463 |
| 377 | 3300026088 | Ga0207641_10010481 | Ga0207641_100104815 | 463 |
| 378 | 3300026089 | Ga0207648_10006451 | Ga0207648_100064514 | 463 |
| 379 | 3300026089 | Ga0207648_10042434 | Ga0207648_100424343 | 463 |
| 380 | 3300026089 | Ga0207648_10059700 | Ga0207648_100597003 | 463 |
| 381 | 3300026095 | Ga0207676_10027671 | Ga0207676_100276714 | 463 |
| 382 | 3300026095 | Ga0207676_10030367 | Ga0207676_100303673 | 463 |
| 383 | 3300026095 | Ga0207676_10037844 | Ga0207676_100378443 | 463 |
| 384 | 3300026116 | Ga0207674_10193862 | Ga0207674_101938621 | 463 |
| 385 | 3300026118 | Ga0207675_100011388 | Ga0207675_1000113885 | 463 |
| 386 | 3300026118 | Ga0207675_100013653 | Ga0207675_1000136533 | 463 |
| 387 | 3300026118 | Ga0207675_100025146 | Ga0207675_1000251463 | 463 |
| 388 | 3300026118 | Ga0207675_100067905 | Ga0207675_1000679053 | 463 |
| 389 | 3300026118 | Ga0207675_100100304 | Ga0207675_1001003043 | 463 |
| 390 | 3300026121 | Ga0207683_10019234 | Ga0207683_100192344 | 463 |
| 391 | 3300027907 | Ga0207428_10012928 | Ga0207428_100129286 | 463 |
| 392 | 3300028379 | Ga0268266_10009780 | Ga0268266_100097803 | 463 |
| 393 | 3300028379 | Ga0268266_10042170 | Ga0268266_100421702 | 463 |
| 394 | 3300028380 | Ga0268265_10055038 | Ga0268265_100550383 | 463 |
| 395 | 3300028381 | Ga0268264_10150879 | Ga0268264_101508791 | 463 |
| 396 | 3300028381 | Ga0268264_10209053 | Ga0268264_102090531 | 463 |
| 397 | 3300034816 | Ga0373930_0001321 | Ga0373930_0001321_655_2052 | 463 |
| 398 | 3300034957 | Ga0373938_0001546 | Ga0373938_0001546_1107_2504 | 463 |
| 399 | 3300035085 | Ga0373929_0000574 | Ga0373929_0000574_3792_5189 | 463 |
| 400 | 3300035088 | Ga0373940_0000066 | Ga0373940_0000066_8991_10388 | 463 |
| 401 | 3300035090 | Ga0373949_0000676 | Ga0373949_0000676_5155_6552 | 463 |
| 402 | 3300035112 | Ga0373932_0000173 | Ga0373932_0000173_4443_5840 | 463 |
| 403 | 3300035114 | Ga0373939_0000561 | Ga0373939_0000561_6288_7685 | 463 |
| 404 | 3300035115 | Ga0373941_0003930 | Ga0373941_0003930_1735_3132 | 463 |
| 405 | 3300035121 | Ga0373960_0022515 | Ga0373960_0022515_77_1468 | 463 |
| 406 | 3300035171 | Ga0373946_0006791 | Ga0373946_0006791_2047_3444 | 463 |
| 407 | 3300035207 | Ga0373942_0000218 | Ga0373942_0000218_7260_8657 | 463 |
| 408 | 3300035241 | Ga0373961_0000622 | Ga0373961_0000622_1595_2992 | 463 |
| 409 | 3300035242 | Ga0373962_0000441 | Ga0373962_0000441_4896_6293 | 463 |
| 410 | 3300035410 | Ga0373924_0016906 | Ga0373924_0016906_520_1917 | 463 |
| 411 | 3300035725 | Ga0373947_0072539 | Ga0373947_0072539_542_1939 | 463 |
| 412 | 3300045051 | Ga0451576_0025728 | Ga0451576_0025728_2039_3430 | 463 |
| 413 | 3300045051 | Ga0451576_0389907 | Ga0451576_0389907_24_1415 | 463 |
| 414 | 3300046459 | Ga0495629_0123067 | Ga0495629_0123067_64_1458 | 463 |
| 415 | 3300046462 | Ga0495651_0099232 | Ga0495651_0099232_313_1710 | 463 |
| 416 | 3300046511 | Ga0495608_0005022 | Ga0495608_0005022_4746_6143 | 463 |
| 417 | 3300046529 | Ga0495652_0041130 | Ga0495652_0041130_2044_3441 | 463 |
| 418 | 3300046543 | Ga0495645_0002883 | Ga0495645_0002883_7276_8673 | 463 |
| 419 | 3300046684 | Ga0495669_0013230 | Ga0495669_0013230_2034_3431 | 463 |
| 420 | 3300046689 | Ga0495613_0002297 | Ga0495613_0002297_9015_10412 | 463 |
| 421 | 3300047319 | Ga0495674_0008046 | Ga0495674_0008046_4283_5680 | 463 |
| 422 | 3300047471 | Ga0495684_0000747 | Ga0495684_0000747_17679_19076 | 463 |
| 423 | 3300047471 | Ga0495684_0057105 | Ga0495684_0057105_505_1902 | 463 |
| 424 | 3300048907 | Ga0496104_0030378 | Ga0496104_0030378_3066_4460 | 463 |
| 425 | 3300048909 | Ga0496106_0094325 | Ga0496106_0094325_273_1670 | 463 |
| 426 | 3300048910 | Ga0496107_0058825 | Ga0496107_0058825_303_1700 | 463 |
| 427 | 3300048916 | Ga0496113_0030081 | Ga0496113_0030081_538_1935 | 463 |
| 428 | 3300048916 | Ga0496113_0098977 | Ga0496113_0098977_165_1565 | 463 |
| 429 | 3300049571 | Ga0501034_0023851 | Ga0501034_0023851_2470_3861 | 463 |
| 430 | 3300049581 | Ga0501047_0004378 | Ga0501047_0004378_1374_2768 | 463 |
| 431 | 3300049581 | Ga0501047_0005191 | Ga0501047_0005191_10468_11859 | 463 |
| 432 | 3300049583 | Ga0501067_0005668 | Ga0501067_0005668_3325_4719 | 463 |
| 433 | 3300049589 | Ga0501073_0007229 | Ga0501073_0007229_6706_8100 | 463 |
| 434 | 3300049744 | Ga0501083_0058812 | Ga0501083_0058812_60_1454 | 463 |
| 435 | 3300049823 | Ga0501044_0007308 | Ga0501044_0007308_5452_6843 | 463 |
| 436 | 3300050507 | nmdc:mga05p37_135757_c1 | nmdc:mga05p37_135757_c1_888_2330 | 463 |
| 437 | 3300050507 | nmdc:mga05p37_17015_c1 | nmdc:mga05p37_17015_c1_2381_3775 | 463 |
| 438 | 3300050507 | nmdc:mga05p37_20223_c1 | nmdc:mga05p37_20223_c1_5447_6841 | 463 |
| 439 | 3300050507 | nmdc:mga05p37_39098_c1 | nmdc:mga05p37_39098_c1_1295_2692 | 463 |
| 440 | 3300050507 | nmdc:mga05p37_76861_c1 | nmdc:mga05p37_76861_c1_379_1773 | 463 |
| 441 | 3300050508 | nmdc:mga09592_113114_c1 | nmdc:mga09592_113114_c1_663_2057 | 463 |
| 442 | 3300050511 | nmdc:mga08y16_121626_c1 | nmdc:mga08y16_121626_c1_1315_2706 | 463 |
| 443 | 3300050511 | nmdc:mga08y16_1593_c1 | nmdc:mga08y16_1593_c1_17400_18800 | 463 |
| 444 | 3300050511 | nmdc:mga08y16_78200_c1 | nmdc:mga08y16_78200_c1_635_2029 | 463 |
| 445 | 3300050512 | nmdc:mga0n895_100358_c1 | nmdc:mga0n895_100358_c1_320_1732 | 463 |
| 446 | 3300050512 | nmdc:mga0n895_12_c1 | nmdc:mga0n895_12_c1_45910_47307 | 463 |
| 447 | 3300050512 | nmdc:mga0n895_4403_c1 | nmdc:mga0n895_4403_c1_13_1404 | 463 |
| 448 | 3300050513 | nmdc:mga0rr50_115973_c1 | nmdc:mga0rr50_115973_c1_102_1493 | 463 |
| 449 | 3300050513 | nmdc:mga0rr50_191_c1 | nmdc:mga0rr50_191_c1_30257_31654 | 463 |
| 450 | 3300050513 | nmdc:mga0rr50_1_c1 | nmdc:mga0rr50_1_c1_241204_242601 | 463 |
| 451 | 3300050514 | nmdc:mga08x19_13308_c1 | nmdc:mga08x19_13308_c1_2010_3407 | 463 |
| 452 | 3300050514 | nmdc:mga08x19_87_c1 | nmdc:mga08x19_87_c1_48189_49586 | 463 |
| 453 | 3300050515 | nmdc:mga0a205_7003_c1 | nmdc:mga0a205_7003_c1_330_1721 | 463 |
| 454 | 3300053077 | Ga0495601_0006397 | Ga0495601_0006397_506_1903 | 463 |
| 455 | 3300053077 | Ga0495601_0009632 | Ga0495601_0009632_1744_3141 | 463 |
| 456 | 3300053077 | Ga0495601_0057904 | Ga0495601_0057904_36_1433 | 463 |
| 457 | 3300053085 | Ga0495619_0001802 | Ga0495619_0001802_7790_9187 | 463 |
| 458 | 3300053085 | Ga0495619_0027711 | Ga0495619_0027711_808_2205 | 463 |
| 459 | 3300060353 | Ga0501082_0079373 | Ga0501082_0079373_298_1692 | 463 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fd2-assembly1.cif.gz_B | radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine | 0.8007 | 2 | 445 |
| 6fd2-assembly1.cif.gz_B | radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine | 0.7841 | 2 | 445 |
| 4q37-assembly2.cif.gz_B | crystal structure of the hypothetical protein tm0182 thermotoga maritima, n-terminal domain. | 0.7748 | 79 | 148 |
| 4jc0-assembly2.cif.gz_B | crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 | 0.7453 | 54 | 415 |
| 6b4c-assembly10.cif.gz_J | structure of viperin from trichoderma virens | 0.7262 | 211 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58882_171_402_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.8397 | 190 | 375 | 3.80.30.20 |
| af_P96395_164_380_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.81 | 189 | 379 | 3.80.30.20 |
| af_Q58275_166_383_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.8067 | 188 | 387 | 3.80.30.20 |
| af_Q7K4W1_211_437_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.8029 | 187 | 418 | 3.80.30.20 |
| af_Q58376_168_384_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.7886 | 187 | 372 | 3.80.30.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0RJT7-F1-model_v4 | Radical SAM core domain-containing protein | 0.9748 | 294 | 428 |
GO:0005829
GO:0051536 |
| AF-A0A7X8UE23-F1-model_v4 | Radical SAM protein | 0.9429 | 1 | 432 |
GO:0003824
GO:0005829 GO:0051539 |
| AF-X0RJT7-F1-model_v4 | Radical SAM core domain-containing protein | 0.9213 | 294 | 428 |
GO:0005829
GO:0051536 |
| AF-A0A7X8UE23-F1-model_v4 | Radical SAM protein | 0.908 | 1 | 432 |
GO:0003824
GO:0005829 GO:0051539 |
| AF-X1UKC1-F1-model_v4 | Radical SAM core domain-containing protein | 0.9029 | 187 | 426 |
GO:0003824
GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar