F448451

General Info

Members Datasets Scaffolds Average Seq Length
459 217 459 463

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_135757_c1|nmdc:mga05p37_135757_c1_888_2330
Length 480
Sequence MTCRRTAADTCRGVMVRMRIVLADIKGGDGFISKDTVVGGYGSRLKPFSKVTRLVAHVKGGFHELPSVHLAYAAALARQAGHETVSSSGALAEGDVAIMLSSLVDHRRETAWARAMRDRGVRVGFIGLAAQNLPHLFDTSADFIVVGEPESALQRLFRGDTLSGMASSPQISDLDSLPFPVWEPFLPSRRRVRVPFAGRPYGGSLPLLASRSCPEFCTYCPHRIQSTYRFRSVTNILDELSYLEDTRGRLHVVFRDPLFSQERDRVLELCDGIRARRLSHTFECETRLDRLDGDLLRVMHAAGLRAMSFGVESVAPTTLKKVGRRPIPEPHQRQVLRRCRELGIVTAAFYVIGFAEDTWESIGATIEYSIDLGSTVAQFKILTPYPGTPLFKRMQTTITETDWERFDGFTPTFTHPSLXXAELTFLLGNAYTQYYVRPSFLTNYLRIESPRVRALVKSLDAPVRRRHTREVALKERTLSC

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 1.09
Rhizosphere 96.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000823 3300001977 Bacteria 4794
2 Ga0065712_10073436 3300005290 Bacteria 4387
3 Ga0070676_10002154 3300005328 Bacteria 10029
4 Ga0070690_100006893 3300005330 Bacteria 6466
5 Ga0070690_100051930 3300005330 Bacteria 2619
6 Ga0070690_100073108 3300005330 Unclassified 2230
7 Ga0070670_100078599 3300005331 Unclassified 2834
8 Ga0070677_10004154 3300005333 Bacteria 4708
9 Ga0070677_10010371 3300005333 Bacteria 3186
10 Ga0068869_100005534 3300005334 Bacteria 7952
11 Ga0068869_100021319 3300005334 Bacteria 4456
12 Ga0070666_10007681 3300005335 Bacteria 6657
13 Ga0068868_100009344 3300005338 Bacteria 7049
14 Ga0068868_100063644 3300005338 Bacteria 2926
15 Ga0068868_100067530 3300005338 Bacteria 2846
16 Ga0070689_100182408 3300005340 Bacteria 1705
17 Ga0070691_10002578 3300005341 Bacteria 8084
18 Ga0070687_100007102 3300005343 Bacteria 4639
19 Ga0070661_100082861 3300005344 Unclassified 2369
20 Ga0070669_100011904 3300005353 Bacteria 6173
21 Ga0070669_100012576 3300005353 Bacteria 6003
22 Ga0070669_100022378 3300005353 Bacteria 4518
23 Ga0070675_100003945 3300005354 Bacteria 11245
24 Ga0070675_100009113 3300005354 Bacteria 7707
25 Ga0070671_100011733 3300005355 Bacteria 7047
26 Ga0070671_100025997 3300005355 Bacteria 4808
27 Ga0070674_100005617 3300005356 Bacteria 7264
28 Ga0070673_100000718 3300005364 Bacteria 18298
29 Ga0070673_100001224 3300005364 Bacteria 14844
30 Ga0070673_100015137 3300005364 Bacteria 5404
31 Ga0070673_100058572 3300005364 Unclassified 3046
32 Ga0070688_100007957 3300005365 Bacteria 5733
33 Ga0070688_100008290 3300005365 Bacteria 5636
34 Ga0070714_100020743 3300005435 Bacteria 5371
35 Ga0070713_100167840 3300005436 Unclassified 1964
36 Ga0070711_100097301 3300005439 Unclassified 2134
37 Ga0070705_100014457 3300005440 Bacteria 4061
38 Ga0070700_100001992 3300005441 Bacteria 10368
39 Ga0070700_100009373 3300005441 Bacteria 5369
40 Ga0070700_100067888 3300005441 Unclassified 2266
41 Ga0070708_100005784 3300005445 Bacteria 9814
42 Ga0070708_100011788 3300005445 Bacteria 7113
43 Ga0070708_100013595 3300005445 Bacteria 6672
44 Ga0070663_100064930 3300005455 Bacteria 2640
45 Ga0070663_100161531 3300005455 Bacteria 1725
46 Ga0070678_100022064 3300005456 Bacteria 4208
47 Ga0070678_100026337 3300005456 Bacteria 3930
48 Ga0070678_100122099 3300005456 Bacteria 2056
49 Ga0070662_100047468 3300005457 Bacteria 3089
50 Ga0070681_10098333 3300005458 Bacteria 2873
51 Ga0068867_100010235 3300005459 Bacteria 6615
52 Ga0068867_100019633 3300005459 Bacteria 4813
53 Ga0070706_100055764 3300005467 Bacteria 3648
54 Ga0070706_100232027 3300005467 Bacteria 1723
55 Ga0070706_100241702 3300005467 Bacteria 1686
56 Ga0070707_100001823 3300005468 Bacteria 20504
57 Ga0070707_100057151 3300005468 Unclassified 3743
58 Ga0070698_100116381 3300005471 Bacteria 2637
59 Ga0070699_100000480 3300005518 Bacteria 38016
60 Ga0070699_100005774 3300005518 Bacteria 10829
61 Ga0070699_100031623 3300005518 Bacteria 4569
62 Ga0070699_100069157 3300005518 Unclassified 3068
63 Ga0070699_100155370 3300005518 Bacteria 2024
64 Ga0070679_100035148 3300005530 Bacteria 4971
65 Ga0070684_100047449 3300005535 Bacteria 3722
66 Ga0070684_100103418 3300005535 Unclassified 2548
67 Ga0070672_100009960 3300005543 Bacteria 6575
68 Ga0070672_100066110 3300005543 Unclassified 2862
69 Ga0070686_100004659 3300005544 Bacteria 7564
70 Ga0070686_100021484 3300005544 Bacteria 3838
71 Ga0070695_100018206 3300005545 Bacteria 4264
72 Ga0070696_100003832 3300005546 Bacteria 10043
73 Ga0070696_100004285 3300005546 Bacteria 9506
74 Ga0070696_100006008 3300005546 Bacteria 8102
75 Ga0070665_100006326 3300005548 Bacteria 12084
76 Ga0070665_100018473 3300005548 Bacteria 6988
77 Ga0070665_100173863 3300005548 Bacteria 2154
78 Ga0070704_100082752 3300005549 Unclassified 2368
79 Ga0070704_100158316 3300005549 Bacteria 1789
80 Ga0068855_100144268 3300005563 Bacteria 2712
81 Ga0070664_100014956 3300005564 Bacteria 6333
82 Ga0070664_100023852 3300005564 Bacteria 5053
83 Ga0068857_100151248 3300005577 Bacteria 2103
84 Ga0068854_100004171 3300005578 Bacteria 9091
85 Ga0068854_100005532 3300005578 Bacteria 7981
86 Ga0068856_100259497 3300005614 Unclassified 1753
87 Ga0070702_100013685 3300005615 Bacteria 4101
88 Ga0070702_100021880 3300005615 Bacteria 3372
89 Ga0068859_100005448 3300005617 Bacteria 12941
90 Ga0068859_100016111 3300005617 Bacteria 7508
91 Ga0068859_100111145 3300005617 Bacteria 2802
92 Ga0068864_100026196 3300005618 Bacteria 4916
93 Ga0068864_100038631 3300005618 Unclassified 4078
94 Ga0068864_100207447 3300005618 Unclassified 1803
95 Ga0068866_10007097 3300005718 Bacteria 4684
96 Ga0068861_100003132 3300005719 Bacteria 10928
97 Ga0068861_100013671 3300005719 Bacteria 5685
98 Ga0068861_100025775 3300005719 Bacteria 4268
99 Ga0068861_100058946 3300005719 Unclassified 2938
100 Ga0068870_10003118 3300005840 Bacteria 6996
101 Ga0068863_100062504 3300005841 Bacteria 3521
102 Ga0068863_100145639 3300005841 Unclassified 2265
103 Ga0068858_100017623 3300005842 Bacteria 6694
104 Ga0068858_100061072 3300005842 Unclassified 3484
105 Ga0068858_100071968 3300005842 Bacteria 3207
106 Ga0068858_100092610 3300005842 Bacteria 2813
107 Ga0068860_100018106 3300005843 Bacteria 6858
108 Ga0068860_100019208 3300005843 Bacteria 6634
109 Ga0068860_100083910 3300005843 Unclassified 3030
110 Ga0068860_100156707 3300005843 Unclassified 2195
111 Ga0068862_100012618 3300005844 Bacteria 6995
112 Ga0068862_100222004 3300005844 Unclassified 1711
113 Ga0081455_10016095 3300005937 Bacteria 7234
114 Ga0081539_10005303 3300005985 Bacteria 13260
115 Ga0075365_10016653 3300006038 Bacteria 4476
116 Ga0075368_10039429 3300006042 Unclassified 1852
117 Ga0075364_10057376 3300006051 Bacteria 2550
118 Ga0075362_10001000 3300006177 Bacteria 8663
119 Ga0075362_10010270 3300006177 Bacteria 3650
120 Ga0068871_100000983 3300006358 Bacteria 19098
121 Ga0075431_100011609 3300006847 Bacteria 8882
122 Ga0075433_10016364 3300006852 Bacteria 6110
123 Ga0075433_10025684 3300006852 Bacteria 4981
124 Ga0075433_10030908 3300006852 Bacteria 4573
125 Ga0075433_10060641 3300006852 Bacteria 3313
126 Ga0075433_10127309 3300006852 Bacteria 2262
127 Ga0075434_100002694 3300006871 Bacteria 15692
128 Ga0075434_100002939 3300006871 Bacteria 15151
129 Ga0075434_100003323 3300006871 Bacteria 14382
130 Ga0075434_100012701 3300006871 Bacteria 7988
131 Ga0075434_100020696 3300006871 Bacteria 6387
132 Ga0075434_100148525 3300006871 Archaea 2364
133 Ga0075434_100223126 3300006871 Bacteria 1904
134 Ga0075434_100310853 3300006871 Bacteria 1596
135 Ga0075429_100026436 3300006880 Bacteria 5039
136 Ga0068865_100001604 3300006881 Bacteria 13249
137 Ga0068865_100007245 3300006881 Bacteria 6814
138 Ga0075436_100000305 3300006914 Bacteria 31481
139 Ga0097620_100005448 3300006931 Bacteria 12941
140 Ga0097620_100016111 3300006931 Bacteria 7508
141 Ga0097620_100111144 3300006931 Bacteria 2802
142 Ga0075435_100000012 3300007076 Bacteria 108852
143 Ga0075435_100007358 3300007076 Bacteria 7842
144 Ga0075435_100042563 3300007076 Bacteria 3633
145 Ga0075435_100050282 3300007076 Bacteria 3354
146 Ga0075435_100067359 3300007076 Bacteria 2915
147 Ga0105240_10031654 3300009093 Bacteria 6855
148 Ga0105240_10083102 3300009093 Bacteria 3931
149 Ga0111539_10001681 3300009094 Bacteria 29485
150 Ga0111539_10001822 3300009094 Bacteria 28383
151 Ga0111539_10003099 3300009094 Bacteria 22033
152 Ga0111539_10044245 3300009094 Bacteria 5334
153 Ga0111539_10063153 3300009094 Bacteria 4383
154 Ga0111539_10357233 3300009094 Bacteria 1700
155 Ga0105245_10188397 3300009098 Bacteria 1975
156 Ga0105247_10001308 3300009101 Bacteria 18279
157 Ga0105247_10040234 3300009101 Bacteria 2857
158 Ga0114129_10000153 3300009147 Bacteria 73434
159 Ga0114129_10004368 3300009147 Bacteria 19946
160 Ga0114129_10015794 3300009147 Bacteria 10735
161 Ga0114129_10015833 3300009147 Bacteria 10723
162 Ga0114129_10015886 3300009147 Bacteria 10706
163 Ga0114129_10020625 3300009147 Bacteria 9370
164 Ga0114129_10027372 3300009147 Bacteria 8072
165 Ga0114129_10078510 3300009147 Bacteria 4592
166 Ga0114129_10094228 3300009147 Unclassified 4147
167 Ga0114129_10170132 3300009147 Bacteria 2971
168 Ga0114129_10355801 3300009147 Unclassified 1939
169 Ga0114129_10357169 3300009147 Bacteria 1934
170 Ga0105243_10004496 3300009148 Bacteria 11020
171 Ga0105243_10026162 3300009148 Bacteria 4465
172 Ga0105242_10015625 3300009176 Bacteria 5897
173 Ga0105242_10029826 3300009176 Unclassified 4353
174 Ga0105242_10093831 3300009176 Unclassified 2531
175 Ga0105242_10148635 3300009176 Unclassified 2041
176 Ga0105242_10247047 3300009176 Bacteria 1606
177 Ga0105248_10004152 3300009177 Bacteria 16021
178 Ga0105248_10020608 3300009177 Bacteria 7307
179 Ga0105248_10028166 3300009177 Bacteria 6256
180 Ga0105248_10035993 3300009177 Bacteria 5537
181 Ga0105248_10055467 3300009177 Bacteria 4445
182 Ga0105248_10116668 3300009177 Unclassified 3011
183 Ga0105238_10010227 3300009551 Bacteria 9408
184 Ga0105249_10009530 3300009553 Bacteria 8508
185 Ga0105249_10148245 3300009553 Bacteria 2256
186 Ga0105246_10077231 3300011119 Bacteria 2362
187 Ga0105246_10135493 3300011119 Bacteria 1845
188 Ga0163162_10015046 3300013306 Bacteria 7557
189 Ga0157375_10256897 3300013308 Unclassified 1909
190 Ga0163163_10009290 3300014325 Bacteria 8771
191 Ga0163163_10065882 3300014325 Bacteria 3597
192 Ga0157380_10019511 3300014326 Bacteria 5053
193 Ga0157380_10019677 3300014326 Bacteria 5035
194 Ga0157380_10021741 3300014326 Bacteria 4817
195 Ga0157380_10041398 3300014326 Bacteria 3595
196 Ga0157380_10074855 3300014326 Bacteria 2750
197 Ga0157380_10224041 3300014326 Bacteria 1684
198 Ga0157377_10015151 3300014745 Bacteria 3936
199 Ga0157377_10054341 3300014745 Bacteria 2267
200 Ga0157379_10013635 3300014968 Bacteria 7122
201 Ga0157379_10058203 3300014968 Bacteria 3455
202 Ga0157379_10068979 3300014968 Unclassified 3161
203 Ga0157376_10013440 3300014969 Bacteria 6108
204 Ga0157376_10039983 3300014969 Unclassified 3830
205 Ga0157376_10046424 3300014969 Bacteria 3582
206 Ga0157376_10056086 3300014969 Unclassified 3290
207 Ga0163161_10006838 3300017792 Bacteria 7891
208 Ga0207697_10002571 3300025315 Bacteria 9337
209 Ga0207682_10002778 3300025893 Bacteria 7748
210 Ga0207682_10008735 3300025893 Bacteria 4008
211 Ga0207688_10011624 3300025901 Bacteria 4787
212 Ga0207645_10009335 3300025907 Bacteria 6790
213 Ga0207645_10010470 3300025907 Bacteria 6367
214 Ga0207645_10010472 3300025907 Bacteria 6366
215 Ga0207643_10004226 3300025908 Bacteria 7736
216 Ga0207643_10073516 3300025908 Bacteria 1971
217 Ga0207684_10025242 3300025910 Bacteria 5065
218 Ga0207695_10201532 3300025913 Unclassified 1904
219 Ga0207662_10005323 3300025918 Bacteria 6844
220 Ga0207662_10019468 3300025918 Bacteria 3864
221 Ga0207662_10027644 3300025918 Bacteria 3274
222 Ga0207662_10133577 3300025918 Bacteria 1567
223 Ga0207649_10100213 3300025920 Bacteria 1915
224 Ga0207652_10072038 3300025921 Bacteria 3004
225 Ga0207646_10084164 3300025922 Bacteria 2846
226 Ga0207646_10135785 3300025922 Bacteria 2215
227 Ga0207646_10136974 3300025922 Bacteria 2204
228 Ga0207646_10215204 3300025922 Unclassified 1735
229 Ga0207681_10013300 3300025923 Bacteria 5090
230 Ga0207681_10026199 3300025923 Bacteria 3758
231 Ga0207681_10061785 3300025923 Bacteria 2577
232 Ga0207694_10005515 3300025924 Bacteria 9710
233 Ga0207650_10015686 3300025925 Bacteria 5282
234 Ga0207650_10191688 3300025925 Bacteria 1633
235 Ga0207659_10002413 3300025926 Bacteria 11126
236 Ga0207659_10006238 3300025926 Bacteria 7293
237 Ga0207659_10009242 3300025926 Bacteria 6155
238 Ga0207659_10015855 3300025926 Bacteria 4895
239 Ga0207659_10109111 3300025926 Bacteria 2100
240 Ga0207687_10028799 3300025927 Bacteria 3732
241 Ga0207687_10066639 3300025927 Unclassified 2560
242 Ga0207700_10131698 3300025928 Unclassified 2042
243 Ga0207664_10036925 3300025929 Bacteria 3778
244 Ga0207644_10004503 3300025931 Bacteria 9054
245 Ga0207690_10027640 3300025932 Bacteria 3587
246 Ga0207706_10006430 3300025933 Bacteria 10912
247 Ga0207706_10025632 3300025933 Bacteria 5282
248 Ga0207706_10043902 3300025933 Bacteria 3961
249 Ga0207706_10208017 3300025933 Bacteria 1715
250 Ga0207686_10043704 3300025934 Unclassified 2747
251 Ga0207686_10157174 3300025934 Bacteria 1590
252 Ga0207709_10012657 3300025935 Bacteria 4650
253 Ga0207669_10005780 3300025937 Bacteria 5587
254 Ga0207704_10008092 3300025938 Bacteria 5007
255 Ga0207691_10013506 3300025940 Bacteria 7811
256 Ga0207691_10015117 3300025940 Bacteria 7345
257 Ga0207691_10018112 3300025940 Bacteria 6670
258 Ga0207691_10041882 3300025940 Bacteria 4224
259 Ga0207691_10077907 3300025940 Unclassified 2985
260 Ga0207711_10002803 3300025941 Bacteria 15320
261 Ga0207711_10002992 3300025941 Bacteria 14770
262 Ga0207711_10071743 3300025941 Bacteria 3006
263 Ga0207689_10003160 3300025942 Bacteria 15105
264 Ga0207689_10003182 3300025942 Bacteria 15059
265 Ga0207689_10004016 3300025942 Bacteria 13377
266 Ga0207661_10012184 3300025944 Bacteria 6244
267 Ga0207679_10006664 3300025945 Bacteria 7312
268 Ga0207679_10029864 3300025945 Bacteria 3799
269 Ga0207679_10148515 3300025945 Unclassified 1904
270 Ga0207651_10040858 3300025960 Unclassified 3073
271 Ga0207651_10078480 3300025960 Bacteria 2368
272 Ga0207712_10012583 3300025961 Bacteria 5408
273 Ga0207668_10045421 3300025972 Bacteria 2996
274 Ga0207668_10085800 3300025972 Unclassified 2298
275 Ga0207640_10145735 3300025981 Bacteria 1732
276 Ga0207658_10010962 3300025986 Bacteria 6172
277 Ga0207658_10169844 3300025986 Bacteria 1796
278 Ga0207677_10010755 3300026023 Bacteria 5188
279 Ga0207677_10052258 3300026023 Bacteria 2775
280 Ga0207703_10013310 3300026035 Bacteria 6409
281 Ga0207703_10014989 3300026035 Bacteria 6050
282 Ga0207703_10045833 3300026035 Bacteria 3518
283 Ga0207703_10131693 3300026035 Unclassified 2160
284 Ga0207703_10173851 3300026035 Bacteria 1896
285 Ga0207678_10063230 3300026067 Bacteria 3180
286 Ga0207678_10087169 3300026067 Bacteria 2668
287 Ga0207678_10138741 3300026067 Unclassified 2075
288 Ga0207708_10000706 3300026075 Bacteria 25251
289 Ga0207708_10009103 3300026075 Bacteria 7348
290 Ga0207708_10050745 3300026075 Bacteria 3158
291 Ga0207641_10010481 3300026088 Bacteria 7610
292 Ga0207648_10006451 3300026089 Bacteria 11658
293 Ga0207648_10007078 3300026089 Bacteria 11070
294 Ga0207648_10016579 3300026089 Bacteria 6725
295 Ga0207648_10042434 3300026089 Bacteria 3993
296 Ga0207648_10059700 3300026089 Bacteria 3326
297 Ga0207676_10027671 3300026095 Unclassified 4225
298 Ga0207676_10030367 3300026095 Bacteria 4056
299 Ga0207676_10037844 3300026095 Bacteria 3680
300 Ga0207674_10193862 3300026116 Bacteria 1982
301 Ga0207675_100001595 3300026118 Bacteria 22714
302 Ga0207675_100011388 3300026118 Bacteria 8324
303 Ga0207675_100013653 3300026118 Bacteria 7580
304 Ga0207675_100025146 3300026118 Bacteria 5540
305 Ga0207675_100039047 3300026118 Bacteria 4430
306 Ga0207675_100067905 3300026118 Unclassified 3332
307 Ga0207675_100100304 3300026118 Unclassified 2727
308 Ga0207683_10012512 3300026121 Bacteria 7239
309 Ga0207683_10019234 3300026121 Bacteria 5831
310 Ga0207683_10093289 3300026121 Unclassified 2683
311 Ga0207428_10000041 3300027907 Bacteria 203097
312 Ga0207428_10004093 3300027907 Bacteria 13970
313 Ga0207428_10012928 3300027907 Bacteria 7317
314 Ga0207428_10036425 3300027907 Bacteria 4013
315 Ga0268266_10009780 3300028379 Bacteria 8435
316 Ga0268266_10042170 3300028379 Bacteria 3896
317 Ga0268265_10055038 3300028380 Bacteria 3021
318 Ga0268265_10078194 3300028380 Bacteria 2601
319 Ga0268265_10193567 3300028380 Bacteria 1758
320 Ga0268264_10150879 3300028381 Bacteria 2083
321 Ga0268264_10209053 3300028381 Bacteria 1790
322 Ga0373930_0001321 3300034816 Bacteria 3646
323 Ga0373938_0001546 3300034957 Bacteria 3695
324 Ga0373929_0000574 3300035085 Bacteria 7085
325 Ga0373934_0030216 3300035086 Bacteria 2119
326 Ga0373940_0000066 3300035088 Bacteria 11878
327 Ga0373949_0000676 3300035090 Bacteria 11092
328 Ga0373932_0000173 3300035112 Bacteria 18853
329 Ga0373939_0000561 3300035114 Bacteria 9292
330 Ga0373941_0003930 3300035115 Bacteria 3407
331 Ga0373960_0022515 3300035121 Bacteria 1688
332 Ga0373946_0006791 3300035171 Unclassified 4161
333 Ga0373942_0000218 3300035207 Bacteria 15047
334 Ga0373961_0000622 3300035241 Bacteria 12857
335 Ga0373962_0000441 3300035242 Bacteria 9071
336 Ga0373924_0016906 3300035410 Unclassified 2790
337 Ga0373931_0006859 3300035691 Bacteria 5354
338 Ga0373947_0072539 3300035725 Unclassified 2114
339 Ga0373937_0227421 3300036401 Bacteria 1756
340 Ga0453683_0047118 3300044673 Bacteria 2702
341 Ga0451576_0025728 3300045051 Bacteria 6339
342 Ga0451576_0389907 3300045051 Unclassified 1460
343 Ga0495629_0123067 3300046459 Bacteria 1807
344 Ga0495651_0099232 3300046462 Bacteria 2172
345 Ga0495651_0188999 3300046462 Bacteria 1451
346 Ga0495653_0038376 3300046463 Bacteria 3760
347 Ga0495608_0005022 3300046511 Bacteria 9466
348 Ga0495652_0041130 3300046529 Bacteria 3992
349 Ga0495645_0002883 3300046543 Bacteria 11674
350 Ga0495656_0023095 3300046615 Bacteria 2444
351 Ga0495647_0006923 3300046681 Bacteria 3776
352 Ga0495658_0014098 3300046683 Bacteria 4076
353 Ga0495669_0013230 3300046684 Unclassified 3514
354 Ga0495613_0002297 3300046689 Bacteria 14479
355 Ga0495674_0008046 3300047319 Bacteria 10065
356 Ga0495684_0000747 3300047471 Bacteria 26203
357 Ga0495684_0057105 3300047471 Bacteria 2975
358 Ga0496104_0030378 3300048907 Bacteria 5021
359 Ga0496106_0094325 3300048909 Unclassified 2314
360 Ga0496107_0058825 3300048910 Viruses 2780
361 Ga0496113_0030081 3300048916 Bacteria 3928
362 Ga0496113_0098977 3300048916 Bacteria 2258
363 Ga0501031_0007356 3300049568 Bacteria 7177
364 Ga0501032_0003211 3300049569 Bacteria 12566
365 Ga0501032_0041472 3300049569 Bacteria 3125
366 Ga0501033_0000840 3300049570 Bacteria 28057
367 Ga0501033_0001633 3300049570 Bacteria 19683
368 Ga0501034_0023851 3300049571 Bacteria 6230
369 Ga0501034_0115041 3300049571 Bacteria 2678
370 Ga0501034_0153403 3300049571 Bacteria 2278
371 Ga0501036_0003227 3300049572 Bacteria 13005
372 Ga0501036_0008827 3300049572 Bacteria 8276
373 Ga0501037_0001117 3300049573 Bacteria 19932
374 Ga0501037_0042919 3300049573 Unclassified 3323
375 Ga0501038_0001068 3300049574 Bacteria 24735
376 Ga0501042_0180387 3300049578 Bacteria 1523
377 Ga0501043_0048876 3300049579 Bacteria 3324
378 Ga0501046_0002503 3300049580 Bacteria 17207
379 Ga0501047_0004378 3300049581 Bacteria 13290
380 Ga0501047_0005191 3300049581 Bacteria 12226
381 Ga0501047_0008268 3300049581 Bacteria 9821
382 Ga0501048_0010355 3300049582 Bacteria 6965
383 Ga0501048_0060347 3300049582 Bacteria 2687
384 Ga0501067_0005668 3300049583 Bacteria 6932
385 Ga0501068_0019638 3300049584 Bacteria 3927
386 Ga0501070_0007239 3300049586 Bacteria 9422
387 Ga0501070_0010639 3300049586 Bacteria 7776
388 Ga0501073_0007229 3300049589 Bacteria 8266
389 Ga0501073_0012179 3300049589 Bacteria 6279
390 Ga0501073_0037576 3300049589 Bacteria 3436
391 Ga0501074_0004313 3300049590 Bacteria 10156
392 Ga0501076_0047978 3300049592 Bacteria 3376
393 Ga0501076_0099080 3300049592 Bacteria 2348
394 Ga0501079_0005515 3300049741 Bacteria 9432
395 Ga0501079_0015532 3300049741 Bacteria 5812
396 Ga0501080_0017331 3300049742 Bacteria 6658
397 Ga0501080_0038776 3300049742 Bacteria 4446
398 Ga0501083_0006968 3300049744 Bacteria 8018
399 Ga0501083_0058812 3300049744 Bacteria 2571
400 Ga0501083_0111790 3300049744 Bacteria 1795
401 Ga0501035_0001367 3300049822 Bacteria 25092
402 Ga0501044_0004959 3300049823 Bacteria 14884
403 Ga0501044_0007308 3300049823 Bacteria 12137
404 nmdc:mga03683_20801_c1 3300050489 Bacteria 2523
405 nmdc:mga0yw44_6290_c1 3300050492 Bacteria 5723
406 nmdc:mga0k408_388_c2 3300050493 Bacteria 14713
407 nmdc:mga06z11_369_c1 3300050494 Bacteria 17005
408 nmdc:mga07m45_8854_c1 3300050496 Bacteria 5193
409 nmdc:mga05p37_135757_c1 3300050507 Bacteria 3017
410 nmdc:mga05p37_142447_c1 3300050507 Bacteria 1668
411 nmdc:mga05p37_148482_c1 3300050507 Bacteria 2869
412 nmdc:mga05p37_17015_c1 3300050507 Bacteria 8769
413 nmdc:mga05p37_17741_c1 3300050507 Bacteria 8590
414 nmdc:mga05p37_19524_c1 3300050507 Bacteria 8199
415 nmdc:mga05p37_20223_c1 3300050507 Bacteria 8058
416 nmdc:mga05p37_21043_c1 3300050507 Bacteria 7894
417 nmdc:mga05p37_3402_c1 3300050507 Bacteria 18563
418 nmdc:mga05p37_39098_c1 3300050507 Bacteria 5821
419 nmdc:mga05p37_42748_c1 3300050507 Bacteria 5570
420 nmdc:mga05p37_44036_c1 3300050507 Bacteria 5491
421 nmdc:mga05p37_48334_c1 3300050507 Bacteria 5233
422 nmdc:mga05p37_52930_c1 3300050507 Bacteria 4993
423 nmdc:mga05p37_76861_c1 3300050507 Unclassified 4110
424 nmdc:mga09592_113114_c1 3300050508 Unclassified 2329
425 nmdc:mga09592_14113_c1 3300050508 Bacteria 6520
426 nmdc:mga06r32_175621_c1 3300050510 Bacteria 2126
427 nmdc:mga08y16_121626_c1 3300050511 Unclassified 2717
428 nmdc:mga08y16_1593_c1 3300050511 Bacteria 22918
429 nmdc:mga08y16_22307_c1 3300050511 Bacteria 6681
430 nmdc:mga08y16_78200_c1 3300050511 Bacteria 3449
431 nmdc:mga08y16_925_c1 3300050511 Bacteria 28503
432 nmdc:mga0n895_100358_c1 3300050512 Bacteria 2903
433 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
434 nmdc:mga0n895_33336_c1 3300050512 Bacteria 4949
435 nmdc:mga0n895_4403_c1 3300050512 Bacteria 11565
436 nmdc:mga0n895_53343_c1 3300050512 Bacteria 3973
437 nmdc:mga0n895_94282_c1 3300050512 Bacteria 2997
438 nmdc:mga0rr50_115973_c1 3300050513 Bacteria 2126
439 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
440 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
441 nmdc:mga0rr50_97643_c1 3300050513 Bacteria 2301
442 nmdc:mga08x19_13308_c1 3300050514 Bacteria 4971
443 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
444 nmdc:mga0a205_19785_c1 3300050515 Bacteria 6352
445 nmdc:mga0a205_2346_c1 3300050515 Bacteria 16706
446 nmdc:mga0a205_29871_c1 3300050515 Bacteria 4518
447 nmdc:mga0a205_7003_c1 3300050515 Bacteria 10186
448 nmdc:mga0a205_88182_c1 3300050515 Bacteria 2998
449 Ga0495601_0006397 3300053077 Bacteria 6887
450 Ga0495601_0009632 3300053077 Bacteria 5720
451 Ga0495601_0057904 3300053077 Bacteria 2455
452 Ga0495601_0078215 3300053077 Bacteria 2119
453 Ga0495619_0001802 3300053085 Bacteria 14250
454 Ga0495619_0027711 3300053085 Bacteria 3652
455 Ga0495619_0135796 3300053085 Unclassified 1692
456 Ga0501084_0007657 3300054114 Bacteria 8900
457 Ga0501082_0015688 3300060353 Bacteria 6517
458 Ga0501082_0043859 3300060353 Bacteria 3857
459 Ga0501082_0079373 3300060353 Bacteria 2831

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_48334_c1 nmdc:mga05p37_48334_c1_24_1157 370
2 3300006871 Ga0075434_100310853 Ga0075434_1003108532 389
3 3300009147 Ga0114129_10027372 Ga0114129_100273724 408
4 3300050507 nmdc:mga05p37_44036_c1 nmdc:mga05p37_44036_c1_95_1420 408
5 3300035086 Ga0373934_0030216 Ga0373934_0030216_35_1276 411
6 3300046462 Ga0495651_0188999 Ga0495651_0188999_176_1417 411
7 3300053077 Ga0495601_0078215 Ga0495601_0078215_860_2098 411
8 3300050513 nmdc:mga0rr50_97643_c1 nmdc:mga0rr50_97643_c1_995_2275 421
9 3300050510 nmdc:mga06r32_175621_c1 nmdc:mga06r32_175621_c1_31_1320 422
10 3300053085 Ga0495619_0135796 Ga0495619_0135796_381_1664 426
11 3300005518 Ga0070699_100069157 Ga0070699_1000691572 439
12 3300049578 Ga0501042_0180387 Ga0501042_0180387_23_1354 443
13 3300005458 Ga0070681_10098333 Ga0070681_100983332 445
14 3300005614 Ga0068856_100259497 Ga0068856_1002594972 445
15 3300025926 Ga0207659_10006238 Ga0207659_100062383 446
16 3300025933 Ga0207706_10043902 Ga0207706_100439023 446
17 3300025972 Ga0207668_10085800 Ga0207668_100858002 446
18 3300028380 Ga0268265_10078194 Ga0268265_100781943 446
19 3300036401 Ga0373937_0227421 Ga0373937_0227421_380_1732 449
20 3300046683 Ga0495658_0014098 Ga0495658_0014098_85_1479 450
21 3300006177 Ga0075362_10001000 Ga0075362_100010006 452
22 3300025908 Ga0207643_10073516 Ga0207643_100735161 454
23 3300005467 Ga0070706_100232027 Ga0070706_1002320271 455
24 3300005518 Ga0070699_100005774 Ga0070699_1000057749 455
25 3300005546 Ga0070696_100003832 Ga0070696_1000038327 455
26 3300005549 Ga0070704_100158316 Ga0070704_1001583162 455
27 3300007076 Ga0075435_100050282 Ga0075435_1000502823 455
28 3300009147 Ga0114129_10015833 Ga0114129_100158337 455
29 3300025922 Ga0207646_10136974 Ga0207646_101369742 455
30 3300050507 nmdc:mga05p37_52930_c1 nmdc:mga05p37_52930_c1_311_1756 455
31 3300006852 Ga0075433_10016364 Ga0075433_100163647 456
32 3300007076 Ga0075435_100067359 Ga0075435_1000673592 456
33 3300009147 Ga0114129_10000153 Ga0114129_1000015321 456
34 3300046681 Ga0495647_0006923 Ga0495647_0006923_89_1462 456
35 3300050512 nmdc:mga0n895_33336_c1 nmdc:mga0n895_33336_c1_2915_4306 456
36 3300050515 nmdc:mga0a205_2346_c1 nmdc:mga0a205_2346_c1_7099_8490 456
37 3300035691 Ga0373931_0006859 Ga0373931_0006859_3491_4888 458
38 3300044673 Ga0453683_0047118 Ga0453683_0047118_191_1585 458
39 3300009094 Ga0111539_10063153 Ga0111539_100631534 459
40 3300009147 Ga0114129_10078510 Ga0114129_100785103 459
41 3300011119 Ga0105246_10077231 Ga0105246_100772312 459
42 3300027907 Ga0207428_10036425 Ga0207428_100364253 459
43 3300050507 nmdc:mga05p37_17741_c1 nmdc:mga05p37_17741_c1_6576_7976 459
44 3300050507 nmdc:mga05p37_19524_c1 nmdc:mga05p37_19524_c1_2146_3546 459
45 3300050511 nmdc:mga08y16_22307_c1 nmdc:mga08y16_22307_c1_5217_6599 459
46 3300005328 Ga0070676_10002154 Ga0070676_100021543 460
47 3300005330 Ga0070690_100073108 Ga0070690_1000731082 460
48 3300005334 Ga0068869_100005534 Ga0068869_1000055342 460
49 3300005338 Ga0068868_100067530 Ga0068868_1000675302 460
50 3300005341 Ga0070691_10002578 Ga0070691_100025786 460
51 3300005353 Ga0070669_100022378 Ga0070669_1000223782 460
52 3300005356 Ga0070674_100005617 Ga0070674_1000056172 460
53 3300005365 Ga0070688_100007957 Ga0070688_1000079572 460
54 3300005440 Ga0070705_100014457 Ga0070705_1000144574 460
55 3300005441 Ga0070700_100001992 Ga0070700_1000019923 460
56 3300005445 Ga0070708_100005784 Ga0070708_1000057846 460
57 3300005455 Ga0070663_100064930 Ga0070663_1000649302 460
58 3300005459 Ga0068867_100010235 Ga0068867_1000102354 460
59 3300005467 Ga0070706_100055764 Ga0070706_1000557642 460
60 3300005468 Ga0070707_100057151 Ga0070707_1000571513 460
61 3300005471 Ga0070698_100116381 Ga0070698_1001163812 460
62 3300005518 Ga0070699_100031623 Ga0070699_1000316234 460
63 3300005545 Ga0070695_100018206 Ga0070695_1000182061 460
64 3300005546 Ga0070696_100004285 Ga0070696_1000042856 460
65 3300005549 Ga0070704_100082752 Ga0070704_1000827522 460
66 3300005577 Ga0068857_100151248 Ga0068857_1001512481 460
67 3300005578 Ga0068854_100005532 Ga0068854_1000055324 460
68 3300005615 Ga0070702_100013685 Ga0070702_1000136853 460
69 3300005615 Ga0070702_100021880 Ga0070702_1000218802 460
70 3300005719 Ga0068861_100003132 Ga0068861_1000031325 460
71 3300005719 Ga0068861_100025775 Ga0068861_1000257753 460
72 3300005841 Ga0068863_100062504 Ga0068863_1000625042 460
73 3300005842 Ga0068858_100092610 Ga0068858_1000926102 460
74 3300005844 Ga0068862_100222004 Ga0068862_1002220041 460
75 3300006038 Ga0075365_10016653 Ga0075365_100166533 460
76 3300006042 Ga0075368_10039429 Ga0075368_100394292 460
77 3300006051 Ga0075364_10057376 Ga0075364_100573762 460
78 3300006177 Ga0075362_10010270 Ga0075362_100102703 460
79 3300006847 Ga0075431_100011609 Ga0075431_1000116096 460
80 3300006852 Ga0075433_10030908 Ga0075433_100309082 460
81 3300006871 Ga0075434_100012701 Ga0075434_1000127015 460
82 3300006880 Ga0075429_100026436 Ga0075429_1000264364 460
83 3300009094 Ga0111539_10001822 Ga0111539_100018225 460
84 3300009094 Ga0111539_10003099 Ga0111539_100030997 460
85 3300009147 Ga0114129_10015886 Ga0114129_100158869 460
86 3300009148 Ga0105243_10004496 Ga0105243_100044962 460
87 3300009148 Ga0105243_10026162 Ga0105243_100261622 460
88 3300009176 Ga0105242_10093831 Ga0105242_100938313 460
89 3300009176 Ga0105242_10247047 Ga0105242_102470471 460
90 3300013308 Ga0157375_10256897 Ga0157375_102568972 460
91 3300014326 Ga0157380_10041398 Ga0157380_100413981 460
92 3300014968 Ga0157379_10058203 Ga0157379_100582032 460
93 3300025907 Ga0207645_10009335 Ga0207645_100093353 460
94 3300025910 Ga0207684_10025242 Ga0207684_100252423 460
95 3300025918 Ga0207662_10005323 Ga0207662_100053234 460
96 3300025918 Ga0207662_10133577 Ga0207662_101335772 460
97 3300025927 Ga0207687_10028799 Ga0207687_100287993 460
98 3300025933 Ga0207706_10025632 Ga0207706_100256322 460
99 3300025934 Ga0207686_10043704 Ga0207686_100437043 460
100 3300025934 Ga0207686_10157174 Ga0207686_101571742 460
101 3300025935 Ga0207709_10012657 Ga0207709_100126574 460
102 3300025937 Ga0207669_10005780 Ga0207669_100057804 460
103 3300025940 Ga0207691_10041882 Ga0207691_100418822 460
104 3300025942 Ga0207689_10004016 Ga0207689_100040165 460
105 3300026023 Ga0207677_10052258 Ga0207677_100522583 460
106 3300026035 Ga0207703_10014989 Ga0207703_100149895 460
107 3300026067 Ga0207678_10063230 Ga0207678_100632303 460
108 3300026075 Ga0207708_10009103 Ga0207708_100091035 460
109 3300026075 Ga0207708_10050745 Ga0207708_100507452 460
110 3300026089 Ga0207648_10007078 Ga0207648_100070789 460
111 3300026089 Ga0207648_10016579 Ga0207648_100165794 460
112 3300026118 Ga0207675_100001595 Ga0207675_1000015955 460
113 3300026118 Ga0207675_100039047 Ga0207675_1000390472 460
114 3300026121 Ga0207683_10012512 Ga0207683_100125126 460
115 3300027907 Ga0207428_10000041 Ga0207428_1000004112 460
116 3300027907 Ga0207428_10004093 Ga0207428_100040934 460
117 3300028380 Ga0268265_10193567 Ga0268265_101935672 460
118 3300050489 nmdc:mga03683_20801_c1 nmdc:mga03683_20801_c1_101_1492 460
119 3300050492 nmdc:mga0yw44_6290_c1 nmdc:mga0yw44_6290_c1_2395_3786 460
120 3300050493 nmdc:mga0k408_388_c2 nmdc:mga0k408_388_c2_12502_13893 460
121 3300050494 nmdc:mga06z11_369_c1 nmdc:mga06z11_369_c1_14695_16086 460
122 3300050496 nmdc:mga07m45_8854_c1 nmdc:mga07m45_8854_c1_3572_4963 460
123 3300050507 nmdc:mga05p37_148482_c1 nmdc:mga05p37_148482_c1_260_1654 460
124 3300050507 nmdc:mga05p37_21043_c1 nmdc:mga05p37_21043_c1_3312_4712 460
125 3300050508 nmdc:mga09592_14113_c1 nmdc:mga09592_14113_c1_833_2224 460
126 3300050511 nmdc:mga08y16_925_c1 nmdc:mga08y16_925_c1_5946_7337 460
127 3300050512 nmdc:mga0n895_94282_c1 nmdc:mga0n895_94282_c1_570_1970 460
128 3300050515 nmdc:mga0a205_19785_c1 nmdc:mga0a205_19785_c1_66_1466 460
129 3300005445 Ga0070708_100013595 Ga0070708_1000135956 461
130 3300005518 Ga0070699_100000480 Ga0070699_10000048025 461
131 3300005842 Ga0068858_100061072 Ga0068858_1000610723 461
132 3300006852 Ga0075433_10127309 Ga0075433_101273091 461
133 3300006871 Ga0075434_100003323 Ga0075434_1000033233 461
134 3300007076 Ga0075435_100042563 Ga0075435_1000425633 461
135 3300009147 Ga0114129_10170132 Ga0114129_101701321 461
136 3300025972 Ga0207668_10045421 Ga0207668_100454211 461
137 3300026035 Ga0207703_10131693 Ga0207703_101316932 461
138 3300050507 nmdc:mga05p37_142447_c1 nmdc:mga05p37_142447_c1_140_1540 461
139 3300050512 nmdc:mga0n895_53343_c1 nmdc:mga0n895_53343_c1_1582_2982 461
140 3300050515 nmdc:mga0a205_88182_c1 nmdc:mga0a205_88182_c1_108_1508 461
141 3300005331 Ga0070670_100078599 Ga0070670_1000785991 462
142 3300005530 Ga0070679_100035148 Ga0070679_1000351483 462
143 3300005535 Ga0070684_100047449 Ga0070684_1000474493 462
144 3300005719 Ga0068861_100058946 Ga0068861_1000589461 462
145 3300006852 Ga0075433_10025684 Ga0075433_100256843 462
146 3300006871 Ga0075434_100020696 Ga0075434_1000206965 462
147 3300009098 Ga0105245_10188397 Ga0105245_101883972 462
148 3300009147 Ga0114129_10004368 Ga0114129_100043689 462
149 3300009147 Ga0114129_10357169 Ga0114129_103571691 462
150 3300025913 Ga0207695_10201532 Ga0207695_102015322 462
151 3300025921 Ga0207652_10072038 Ga0207652_100720382 462
152 3300025932 Ga0207690_10027640 Ga0207690_100276402 462
153 3300025944 Ga0207661_10012184 Ga0207661_100121845 462
154 3300026121 Ga0207683_10093289 Ga0207683_100932893 462
155 3300046463 Ga0495653_0038376 Ga0495653_0038376_1209_2621 462
156 3300046615 Ga0495656_0023095 Ga0495656_0023095_547_1935 462
157 3300049568 Ga0501031_0007356 Ga0501031_0007356_5417_6805 462
158 3300049569 Ga0501032_0003211 Ga0501032_0003211_3902_5290 462
159 3300049569 Ga0501032_0041472 Ga0501032_0041472_1459_2847 462
160 3300049570 Ga0501033_0000840 Ga0501033_0000840_7862_9250 462
161 3300049570 Ga0501033_0001633 Ga0501033_0001633_8877_10265 462
162 3300049571 Ga0501034_0115041 Ga0501034_0115041_873_2261 462
163 3300049571 Ga0501034_0153403 Ga0501034_0153403_461_1849 462
164 3300049572 Ga0501036_0003227 Ga0501036_0003227_8748_10136 462
165 3300049572 Ga0501036_0008827 Ga0501036_0008827_35_1423 462
166 3300049573 Ga0501037_0001117 Ga0501037_0001117_14425_15813 462
167 3300049573 Ga0501037_0042919 Ga0501037_0042919_1537_2925 462
168 3300049574 Ga0501038_0001068 Ga0501038_0001068_4588_5976 462
169 3300049579 Ga0501043_0048876 Ga0501043_0048876_1538_2926 462
170 3300049580 Ga0501046_0002503 Ga0501046_0002503_9471_10859 462
171 3300049581 Ga0501047_0008268 Ga0501047_0008268_4346_5734 462
172 3300049582 Ga0501048_0010355 Ga0501048_0010355_641_2029 462
173 3300049582 Ga0501048_0060347 Ga0501048_0060347_611_1999 462
174 3300049584 Ga0501068_0019638 Ga0501068_0019638_436_1824 462
175 3300049586 Ga0501070_0007239 Ga0501070_0007239_4321_5709 462
176 3300049586 Ga0501070_0010639 Ga0501070_0010639_1903_3291 462
177 3300049589 Ga0501073_0012179 Ga0501073_0012179_490_1878 462
178 3300049589 Ga0501073_0037576 Ga0501073_0037576_1588_2976 462
179 3300049590 Ga0501074_0004313 Ga0501074_0004313_4681_6069 462
180 3300049592 Ga0501076_0047978 Ga0501076_0047978_797_2185 462
181 3300049592 Ga0501076_0099080 Ga0501076_0099080_34_1422 462
182 3300049741 Ga0501079_0005515 Ga0501079_0005515_6757_8145 462
183 3300049741 Ga0501079_0015532 Ga0501079_0015532_3952_5340 462
184 3300049742 Ga0501080_0017331 Ga0501080_0017331_4088_5476 462
185 3300049742 Ga0501080_0038776 Ga0501080_0038776_1835_3223 462
186 3300049744 Ga0501083_0006968 Ga0501083_0006968_4594_5982 462
187 3300049744 Ga0501083_0111790 Ga0501083_0111790_34_1422 462
188 3300049822 Ga0501035_0001367 Ga0501035_0001367_18808_20196 462
189 3300049823 Ga0501044_0004959 Ga0501044_0004959_5783_7171 462
190 3300050507 nmdc:mga05p37_3402_c1 nmdc:mga05p37_3402_c1_12602_14008 462
191 3300050507 nmdc:mga05p37_42748_c1 nmdc:mga05p37_42748_c1_2017_3438 462
192 3300050515 nmdc:mga0a205_29871_c1 nmdc:mga0a205_29871_c1_906_2312 462
193 3300054114 Ga0501084_0007657 Ga0501084_0007657_2866_4254 462
194 3300060353 Ga0501082_0015688 Ga0501082_0015688_3373_4761 462
195 3300060353 Ga0501082_0043859 Ga0501082_0043859_621_2009 462
196 3300001977 JGI24746J21847_1000823 JGI24746J21847_10008234 463
197 3300005290 Ga0065712_10073436 Ga0065712_100734362 463
198 3300005330 Ga0070690_100006893 Ga0070690_1000068931 463
199 3300005330 Ga0070690_100051930 Ga0070690_1000519302 463
200 3300005333 Ga0070677_10004154 Ga0070677_100041544 463
201 3300005333 Ga0070677_10010371 Ga0070677_100103713 463
202 3300005334 Ga0068869_100021319 Ga0068869_1000213193 463
203 3300005335 Ga0070666_10007681 Ga0070666_100076813 463
204 3300005338 Ga0068868_100009344 Ga0068868_1000093444 463
205 3300005338 Ga0068868_100063644 Ga0068868_1000636442 463
206 3300005340 Ga0070689_100182408 Ga0070689_1001824081 463
207 3300005343 Ga0070687_100007102 Ga0070687_1000071023 463
208 3300005344 Ga0070661_100082861 Ga0070661_1000828612 463
209 3300005353 Ga0070669_100011904 Ga0070669_1000119046 463
210 3300005353 Ga0070669_100012576 Ga0070669_1000125762 463
211 3300005354 Ga0070675_100003945 Ga0070675_1000039452 463
212 3300005354 Ga0070675_100009113 Ga0070675_1000091136 463
213 3300005355 Ga0070671_100011733 Ga0070671_1000117332 463
214 3300005355 Ga0070671_100025997 Ga0070671_1000259974 463
215 3300005364 Ga0070673_100000718 Ga0070673_10000071811 463
216 3300005364 Ga0070673_100001224 Ga0070673_1000012247 463
217 3300005364 Ga0070673_100015137 Ga0070673_1000151374 463
218 3300005364 Ga0070673_100058572 Ga0070673_1000585723 463
219 3300005365 Ga0070688_100008290 Ga0070688_1000082904 463
220 3300005435 Ga0070714_100020743 Ga0070714_1000207432 463
221 3300005436 Ga0070713_100167840 Ga0070713_1001678402 463
222 3300005439 Ga0070711_100097301 Ga0070711_1000973012 463
223 3300005441 Ga0070700_100009373 Ga0070700_1000093735 463
224 3300005441 Ga0070700_100067888 Ga0070700_1000678882 463
225 3300005445 Ga0070708_100011788 Ga0070708_1000117883 463
226 3300005455 Ga0070663_100161531 Ga0070663_1001615312 463
227 3300005456 Ga0070678_100022064 Ga0070678_1000220642 463
228 3300005456 Ga0070678_100026337 Ga0070678_1000263373 463
229 3300005456 Ga0070678_100122099 Ga0070678_1001220991 463
230 3300005457 Ga0070662_100047468 Ga0070662_1000474681 463
231 3300005459 Ga0068867_100019633 Ga0068867_1000196333 463
232 3300005467 Ga0070706_100241702 Ga0070706_1002417021 463
233 3300005468 Ga0070707_100001823 Ga0070707_1000018237 463
234 3300005518 Ga0070699_100155370 Ga0070699_1001553702 463
235 3300005535 Ga0070684_100103418 Ga0070684_1001034182 463
236 3300005543 Ga0070672_100009960 Ga0070672_1000099602 463
237 3300005543 Ga0070672_100066110 Ga0070672_1000661104 463
238 3300005544 Ga0070686_100004659 Ga0070686_1000046593 463
239 3300005544 Ga0070686_100021484 Ga0070686_1000214841 463
240 3300005546 Ga0070696_100006008 Ga0070696_1000060083 463
241 3300005548 Ga0070665_100006326 Ga0070665_1000063265 463
242 3300005548 Ga0070665_100018473 Ga0070665_1000184732 463
243 3300005548 Ga0070665_100173863 Ga0070665_1001738632 463
244 3300005563 Ga0068855_100144268 Ga0068855_1001442683 463
245 3300005564 Ga0070664_100014956 Ga0070664_1000149564 463
246 3300005564 Ga0070664_100023852 Ga0070664_1000238523 463
247 3300005578 Ga0068854_100004171 Ga0068854_1000041715 463
248 3300005617 Ga0068859_100005448 Ga0068859_1000054486 463
249 3300005617 Ga0068859_100016111 Ga0068859_1000161116 463
250 3300005617 Ga0068859_100111145 Ga0068859_1001111452 463
251 3300005618 Ga0068864_100026196 Ga0068864_1000261961 463
252 3300005618 Ga0068864_100038631 Ga0068864_1000386314 463
253 3300005618 Ga0068864_100207447 Ga0068864_1002074472 463
254 3300005718 Ga0068866_10007097 Ga0068866_100070975 463
255 3300005719 Ga0068861_100013671 Ga0068861_1000136712 463
256 3300005840 Ga0068870_10003118 Ga0068870_100031186 463
257 3300005841 Ga0068863_100145639 Ga0068863_1001456392 463
258 3300005842 Ga0068858_100017623 Ga0068858_1000176232 463
259 3300005842 Ga0068858_100071968 Ga0068858_1000719683 463
260 3300005843 Ga0068860_100018106 Ga0068860_1000181064 463
261 3300005843 Ga0068860_100019208 Ga0068860_1000192082 463
262 3300005843 Ga0068860_100083910 Ga0068860_1000839102 463
263 3300005843 Ga0068860_100156707 Ga0068860_1001567071 463
264 3300005844 Ga0068862_100012618 Ga0068862_1000126185 463
265 3300005937 Ga0081455_10016095 Ga0081455_100160952 463
266 3300005985 Ga0081539_10005303 Ga0081539_1000530310 463
267 3300006358 Ga0068871_100000983 Ga0068871_10000098310 463
268 3300006852 Ga0075433_10060641 Ga0075433_100606411 463
269 3300006871 Ga0075434_100002694 Ga0075434_1000026947 463
270 3300006871 Ga0075434_100002939 Ga0075434_1000029394 463
271 3300006871 Ga0075434_100148525 Ga0075434_1001485252 463
272 3300006871 Ga0075434_100223126 Ga0075434_1002231261 463
273 3300006881 Ga0068865_100001604 Ga0068865_1000016046 463
274 3300006881 Ga0068865_100007245 Ga0068865_1000072451 463
275 3300006914 Ga0075436_100000305 Ga0075436_1000003053 463
276 3300006931 Ga0097620_100005448 Ga0097620_1000054486 463
277 3300006931 Ga0097620_100016111 Ga0097620_1000161116 463
278 3300006931 Ga0097620_100111144 Ga0097620_1001111442 463
279 3300007076 Ga0075435_100000012 Ga0075435_10000001275 463
280 3300007076 Ga0075435_100007358 Ga0075435_1000073583 463
281 3300009093 Ga0105240_10031654 Ga0105240_100316543 463
282 3300009093 Ga0105240_10083102 Ga0105240_100831023 463
283 3300009094 Ga0111539_10001681 Ga0111539_1000168114 463
284 3300009094 Ga0111539_10044245 Ga0111539_100442455 463
285 3300009094 Ga0111539_10357233 Ga0111539_103572331 463
286 3300009101 Ga0105247_10001308 Ga0105247_1000130813 463
287 3300009101 Ga0105247_10040234 Ga0105247_100402342 463
288 3300009147 Ga0114129_10015794 Ga0114129_100157947 463
289 3300009147 Ga0114129_10020625 Ga0114129_100206255 463
290 3300009147 Ga0114129_10094228 Ga0114129_100942283 463
291 3300009147 Ga0114129_10355801 Ga0114129_103558012 463
292 3300009176 Ga0105242_10015625 Ga0105242_100156253 463
293 3300009176 Ga0105242_10029826 Ga0105242_100298263 463
294 3300009176 Ga0105242_10148635 Ga0105242_101486352 463
295 3300009177 Ga0105248_10004152 Ga0105248_100041529 463
296 3300009177 Ga0105248_10020608 Ga0105248_100206083 463
297 3300009177 Ga0105248_10028166 Ga0105248_100281663 463
298 3300009177 Ga0105248_10035993 Ga0105248_100359932 463
299 3300009177 Ga0105248_10055467 Ga0105248_100554674 463
300 3300009177 Ga0105248_10116668 Ga0105248_101166682 463
301 3300009551 Ga0105238_10010227 Ga0105238_100102275 463
302 3300009553 Ga0105249_10009530 Ga0105249_100095302 463
303 3300009553 Ga0105249_10148245 Ga0105249_101482452 463
304 3300011119 Ga0105246_10135493 Ga0105246_101354931 463
305 3300013306 Ga0163162_10015046 Ga0163162_100150464 463
306 3300014325 Ga0163163_10009290 Ga0163163_100092902 463
307 3300014325 Ga0163163_10065882 Ga0163163_100658823 463
308 3300014326 Ga0157380_10019511 Ga0157380_100195114 463
309 3300014326 Ga0157380_10019677 Ga0157380_100196775 463
310 3300014326 Ga0157380_10021741 Ga0157380_100217412 463
311 3300014326 Ga0157380_10074855 Ga0157380_100748552 463
312 3300014326 Ga0157380_10224041 Ga0157380_102240411 463
313 3300014745 Ga0157377_10015151 Ga0157377_100151512 463
314 3300014745 Ga0157377_10054341 Ga0157377_100543412 463
315 3300014968 Ga0157379_10013635 Ga0157379_100136355 463
316 3300014968 Ga0157379_10068979 Ga0157379_100689792 463
317 3300014969 Ga0157376_10013440 Ga0157376_100134405 463
318 3300014969 Ga0157376_10039983 Ga0157376_100399834 463
319 3300014969 Ga0157376_10046424 Ga0157376_100464243 463
320 3300014969 Ga0157376_10056086 Ga0157376_100560863 463
321 3300017792 Ga0163161_10006838 Ga0163161_100068385 463
322 3300025315 Ga0207697_10002571 Ga0207697_100025715 463
323 3300025893 Ga0207682_10002778 Ga0207682_100027782 463
324 3300025893 Ga0207682_10008735 Ga0207682_100087353 463
325 3300025901 Ga0207688_10011624 Ga0207688_100116244 463
326 3300025907 Ga0207645_10010470 Ga0207645_100104702 463
327 3300025907 Ga0207645_10010472 Ga0207645_100104722 463
328 3300025908 Ga0207643_10004226 Ga0207643_100042263 463
329 3300025918 Ga0207662_10019468 Ga0207662_100194682 463
330 3300025918 Ga0207662_10027644 Ga0207662_100276443 463
331 3300025920 Ga0207649_10100213 Ga0207649_101002132 463
332 3300025922 Ga0207646_10084164 Ga0207646_100841643 463
333 3300025922 Ga0207646_10135785 Ga0207646_101357852 463
334 3300025922 Ga0207646_10215204 Ga0207646_102152042 463
335 3300025923 Ga0207681_10013300 Ga0207681_100133002 463
336 3300025923 Ga0207681_10026199 Ga0207681_100261991 463
337 3300025923 Ga0207681_10061785 Ga0207681_100617853 463
338 3300025924 Ga0207694_10005515 Ga0207694_100055157 463
339 3300025925 Ga0207650_10015686 Ga0207650_100156864 463
340 3300025925 Ga0207650_10191688 Ga0207650_101916882 463
341 3300025926 Ga0207659_10002413 Ga0207659_100024133 463
342 3300025926 Ga0207659_10009242 Ga0207659_100092425 463
343 3300025926 Ga0207659_10015855 Ga0207659_100158555 463
344 3300025926 Ga0207659_10109111 Ga0207659_101091112 463
345 3300025927 Ga0207687_10066639 Ga0207687_100666392 463
346 3300025928 Ga0207700_10131698 Ga0207700_101316982 463
347 3300025929 Ga0207664_10036925 Ga0207664_100369253 463
348 3300025931 Ga0207644_10004503 Ga0207644_100045037 463
349 3300025933 Ga0207706_10006430 Ga0207706_100064305 463
350 3300025933 Ga0207706_10208017 Ga0207706_102080171 463
351 3300025938 Ga0207704_10008092 Ga0207704_100080921 463
352 3300025940 Ga0207691_10013506 Ga0207691_100135062 463
353 3300025940 Ga0207691_10015117 Ga0207691_100151175 463
354 3300025940 Ga0207691_10018112 Ga0207691_100181129 463
355 3300025940 Ga0207691_10077907 Ga0207691_100779072 463
356 3300025941 Ga0207711_10002803 Ga0207711_100028039 463
357 3300025941 Ga0207711_10002992 Ga0207711_100029925 463
358 3300025941 Ga0207711_10071743 Ga0207711_100717433 463
359 3300025942 Ga0207689_10003160 Ga0207689_100031605 463
360 3300025942 Ga0207689_10003182 Ga0207689_100031823 463
361 3300025945 Ga0207679_10006664 Ga0207679_100066644 463
362 3300025945 Ga0207679_10029864 Ga0207679_100298641 463
363 3300025945 Ga0207679_10148515 Ga0207679_101485151 463
364 3300025960 Ga0207651_10040858 Ga0207651_100408582 463
365 3300025960 Ga0207651_10078480 Ga0207651_100784801 463
366 3300025961 Ga0207712_10012583 Ga0207712_100125832 463
367 3300025981 Ga0207640_10145735 Ga0207640_101457352 463
368 3300025986 Ga0207658_10010962 Ga0207658_100109625 463
369 3300025986 Ga0207658_10169844 Ga0207658_101698442 463
370 3300026023 Ga0207677_10010755 Ga0207677_100107554 463
371 3300026035 Ga0207703_10013310 Ga0207703_100133105 463
372 3300026035 Ga0207703_10045833 Ga0207703_100458332 463
373 3300026035 Ga0207703_10173851 Ga0207703_101738512 463
374 3300026067 Ga0207678_10087169 Ga0207678_100871693 463
375 3300026067 Ga0207678_10138741 Ga0207678_101387412 463
376 3300026075 Ga0207708_10000706 Ga0207708_100007063 463
377 3300026088 Ga0207641_10010481 Ga0207641_100104815 463
378 3300026089 Ga0207648_10006451 Ga0207648_100064514 463
379 3300026089 Ga0207648_10042434 Ga0207648_100424343 463
380 3300026089 Ga0207648_10059700 Ga0207648_100597003 463
381 3300026095 Ga0207676_10027671 Ga0207676_100276714 463
382 3300026095 Ga0207676_10030367 Ga0207676_100303673 463
383 3300026095 Ga0207676_10037844 Ga0207676_100378443 463
384 3300026116 Ga0207674_10193862 Ga0207674_101938621 463
385 3300026118 Ga0207675_100011388 Ga0207675_1000113885 463
386 3300026118 Ga0207675_100013653 Ga0207675_1000136533 463
387 3300026118 Ga0207675_100025146 Ga0207675_1000251463 463
388 3300026118 Ga0207675_100067905 Ga0207675_1000679053 463
389 3300026118 Ga0207675_100100304 Ga0207675_1001003043 463
390 3300026121 Ga0207683_10019234 Ga0207683_100192344 463
391 3300027907 Ga0207428_10012928 Ga0207428_100129286 463
392 3300028379 Ga0268266_10009780 Ga0268266_100097803 463
393 3300028379 Ga0268266_10042170 Ga0268266_100421702 463
394 3300028380 Ga0268265_10055038 Ga0268265_100550383 463
395 3300028381 Ga0268264_10150879 Ga0268264_101508791 463
396 3300028381 Ga0268264_10209053 Ga0268264_102090531 463
397 3300034816 Ga0373930_0001321 Ga0373930_0001321_655_2052 463
398 3300034957 Ga0373938_0001546 Ga0373938_0001546_1107_2504 463
399 3300035085 Ga0373929_0000574 Ga0373929_0000574_3792_5189 463
400 3300035088 Ga0373940_0000066 Ga0373940_0000066_8991_10388 463
401 3300035090 Ga0373949_0000676 Ga0373949_0000676_5155_6552 463
402 3300035112 Ga0373932_0000173 Ga0373932_0000173_4443_5840 463
403 3300035114 Ga0373939_0000561 Ga0373939_0000561_6288_7685 463
404 3300035115 Ga0373941_0003930 Ga0373941_0003930_1735_3132 463
405 3300035121 Ga0373960_0022515 Ga0373960_0022515_77_1468 463
406 3300035171 Ga0373946_0006791 Ga0373946_0006791_2047_3444 463
407 3300035207 Ga0373942_0000218 Ga0373942_0000218_7260_8657 463
408 3300035241 Ga0373961_0000622 Ga0373961_0000622_1595_2992 463
409 3300035242 Ga0373962_0000441 Ga0373962_0000441_4896_6293 463
410 3300035410 Ga0373924_0016906 Ga0373924_0016906_520_1917 463
411 3300035725 Ga0373947_0072539 Ga0373947_0072539_542_1939 463
412 3300045051 Ga0451576_0025728 Ga0451576_0025728_2039_3430 463
413 3300045051 Ga0451576_0389907 Ga0451576_0389907_24_1415 463
414 3300046459 Ga0495629_0123067 Ga0495629_0123067_64_1458 463
415 3300046462 Ga0495651_0099232 Ga0495651_0099232_313_1710 463
416 3300046511 Ga0495608_0005022 Ga0495608_0005022_4746_6143 463
417 3300046529 Ga0495652_0041130 Ga0495652_0041130_2044_3441 463
418 3300046543 Ga0495645_0002883 Ga0495645_0002883_7276_8673 463
419 3300046684 Ga0495669_0013230 Ga0495669_0013230_2034_3431 463
420 3300046689 Ga0495613_0002297 Ga0495613_0002297_9015_10412 463
421 3300047319 Ga0495674_0008046 Ga0495674_0008046_4283_5680 463
422 3300047471 Ga0495684_0000747 Ga0495684_0000747_17679_19076 463
423 3300047471 Ga0495684_0057105 Ga0495684_0057105_505_1902 463
424 3300048907 Ga0496104_0030378 Ga0496104_0030378_3066_4460 463
425 3300048909 Ga0496106_0094325 Ga0496106_0094325_273_1670 463
426 3300048910 Ga0496107_0058825 Ga0496107_0058825_303_1700 463
427 3300048916 Ga0496113_0030081 Ga0496113_0030081_538_1935 463
428 3300048916 Ga0496113_0098977 Ga0496113_0098977_165_1565 463
429 3300049571 Ga0501034_0023851 Ga0501034_0023851_2470_3861 463
430 3300049581 Ga0501047_0004378 Ga0501047_0004378_1374_2768 463
431 3300049581 Ga0501047_0005191 Ga0501047_0005191_10468_11859 463
432 3300049583 Ga0501067_0005668 Ga0501067_0005668_3325_4719 463
433 3300049589 Ga0501073_0007229 Ga0501073_0007229_6706_8100 463
434 3300049744 Ga0501083_0058812 Ga0501083_0058812_60_1454 463
435 3300049823 Ga0501044_0007308 Ga0501044_0007308_5452_6843 463
436 3300050507 nmdc:mga05p37_135757_c1 nmdc:mga05p37_135757_c1_888_2330 463
437 3300050507 nmdc:mga05p37_17015_c1 nmdc:mga05p37_17015_c1_2381_3775 463
438 3300050507 nmdc:mga05p37_20223_c1 nmdc:mga05p37_20223_c1_5447_6841 463
439 3300050507 nmdc:mga05p37_39098_c1 nmdc:mga05p37_39098_c1_1295_2692 463
440 3300050507 nmdc:mga05p37_76861_c1 nmdc:mga05p37_76861_c1_379_1773 463
441 3300050508 nmdc:mga09592_113114_c1 nmdc:mga09592_113114_c1_663_2057 463
442 3300050511 nmdc:mga08y16_121626_c1 nmdc:mga08y16_121626_c1_1315_2706 463
443 3300050511 nmdc:mga08y16_1593_c1 nmdc:mga08y16_1593_c1_17400_18800 463
444 3300050511 nmdc:mga08y16_78200_c1 nmdc:mga08y16_78200_c1_635_2029 463
445 3300050512 nmdc:mga0n895_100358_c1 nmdc:mga0n895_100358_c1_320_1732 463
446 3300050512 nmdc:mga0n895_12_c1 nmdc:mga0n895_12_c1_45910_47307 463
447 3300050512 nmdc:mga0n895_4403_c1 nmdc:mga0n895_4403_c1_13_1404 463
448 3300050513 nmdc:mga0rr50_115973_c1 nmdc:mga0rr50_115973_c1_102_1493 463
449 3300050513 nmdc:mga0rr50_191_c1 nmdc:mga0rr50_191_c1_30257_31654 463
450 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_241204_242601 463
451 3300050514 nmdc:mga08x19_13308_c1 nmdc:mga08x19_13308_c1_2010_3407 463
452 3300050514 nmdc:mga08x19_87_c1 nmdc:mga08x19_87_c1_48189_49586 463
453 3300050515 nmdc:mga0a205_7003_c1 nmdc:mga0a205_7003_c1_330_1721 463
454 3300053077 Ga0495601_0006397 Ga0495601_0006397_506_1903 463
455 3300053077 Ga0495601_0009632 Ga0495601_0009632_1744_3141 463
456 3300053077 Ga0495601_0057904 Ga0495601_0057904_36_1433 463
457 3300053085 Ga0495619_0001802 Ga0495619_0001802_7790_9187 463
458 3300053085 Ga0495619_0027711 Ga0495619_0027711_808_2205 463
459 3300060353 Ga0501082_0079373 Ga0501082_0079373_298_1692 463

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

207

368

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.8007 2 445
6fd2-assembly1.cif.gz_B radical sam 1,2-diol dehydratase aprd4 in complex with its substrate paromamine 0.7841 2 445
4q37-assembly2.cif.gz_B crystal structure of the hypothetical protein tm0182 thermotoga maritima, n-terminal domain. 0.7748 79 148
4jc0-assembly2.cif.gz_B crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 0.7453 54 415
6b4c-assembly10.cif.gz_J structure of viperin from trichoderma virens 0.7262 211 389
ID Description Score Start End Superfamily
af_Q58882_171_402_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8397 190 375 3.80.30.20
af_P96395_164_380_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.81 189 379 3.80.30.20
af_Q58275_166_383_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8067 188 387 3.80.30.20
af_Q7K4W1_211_437_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8029 187 418 3.80.30.20
af_Q58376_168_384_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.7886 187 372 3.80.30.20
ID Description Score Start End GO Terms
AF-X0RJT7-F1-model_v4 Radical SAM core domain-containing protein 0.9748 294 428 GO:0005829
GO:0051536
AF-A0A7X8UE23-F1-model_v4 Radical SAM protein 0.9429 1 432 GO:0003824
GO:0005829
GO:0051539
AF-X0RJT7-F1-model_v4 Radical SAM core domain-containing protein 0.9213 294 428 GO:0005829
GO:0051536
AF-A0A7X8UE23-F1-model_v4 Radical SAM protein 0.908 1 432 GO:0003824
GO:0005829
GO:0051539
AF-X1UKC1-F1-model_v4 Radical SAM core domain-containing protein 0.9029 187 426 GO:0003824
GO:0051539

Feature Viewer

pLDDT pTM Quality
90.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map