F448453

General Info

Members Datasets Scaffolds Average Seq Length
459 275 432 218

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_703332_c1|nmdc:mga0n895_703332_c1_39_812
Length 257
Sequence LISCRQTTSARCAAIQGNSPLLTAERMPFKFSVIIRNGACGLDFRQEFIEYALAQHVLRFGEFITKAGRSSPYFFNAGLFHDGAALHRLGQFYAKAITASGIEFDQLFGPAYKGIPLVTAAAMGLAENGRNVPISFNRKEIKDHGEGGQLIGAPLTGRTLIVDDVISAGTSVRESIDIIARAGGTPCGVVIALDRMERGTGTLSAVQEVRETFGLPVASIATLDDLVEFLRGRDGMARELQRVGLYRSQYGVQEHAS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
5 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
6 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
7 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
8 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
9 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
10 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
11 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
12 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
13 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
14 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
15 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
16 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
17 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
18 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
19 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
20 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
21 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
22 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
23 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
24 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
173 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
194 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
195 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
196 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
269 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
274 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
275 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.9
Metatranscriptomes 0.22
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 2.18
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10097950 3300005290 Bacteria 2134
2 Ga0070658_10025343 3300005327 Bacteria 4756
3 Ga0070676_10201579 3300005328 Bacteria 1304
4 Ga0070683_100003177 3300005329 Bacteria 13256
5 Ga0070670_100023010 3300005331 Bacteria 5361
6 Ga0070677_10013323 3300005333 Bacteria 2874
7 Ga0070677_10206312 3300005333 Bacteria 951
8 Ga0068869_100044684 3300005334 Bacteria 3186
9 Ga0068869_100148343 3300005334 Bacteria 1817
10 Ga0068869_100378661 3300005334 Bacteria 1159
11 Ga0070666_10013759 3300005335 Bacteria 5138
12 Ga0068868_100003334 3300005338 Bacteria 11172
13 Ga0068868_100032341 3300005338 Bacteria 4024
14 Ga0068868_100166419 3300005338 Bacteria 1824
15 Ga0068868_100787351 3300005338 Bacteria 857
16 Ga0070689_100035273 3300005340 Bacteria 3821
17 Ga0070689_100061893 3300005340 Bacteria 2911
18 Ga0070689_100100868 3300005340 Bacteria 2284
19 Ga0070689_100687036 3300005340 Bacteria 893
20 Ga0070661_100001429 3300005344 Bacteria 16602
21 Ga0070661_100262685 3300005344 Bacteria 1335
22 Ga0070661_100312983 3300005344 Bacteria 1225
23 Ga0070692_10027806 3300005345 Bacteria 2807
24 Ga0070668_100048990 3300005347 Bacteria 3250
25 Ga0070675_100025860 3300005354 Bacteria 4707
26 Ga0070675_100117917 3300005354 Bacteria 2253
27 Ga0070675_100305903 3300005354 Bacteria 1402
28 Ga0070675_100336004 3300005354 Bacteria 1337
29 Ga0070675_100614362 3300005354 Bacteria 986
30 Ga0070671_100001144 3300005355 Bacteria 19755
31 Ga0070671_100230290 3300005355 Bacteria 1572
32 Ga0070674_100053403 3300005356 Bacteria 2790
33 Ga0070674_100088802 3300005356 Bacteria 2225
34 Ga0070673_100022353 3300005364 Bacteria 4601
35 Ga0070673_100080904 3300005364 Bacteria 2633
36 Ga0070673_100218548 3300005364 Bacteria 1648
37 Ga0070688_100064078 3300005365 Bacteria 2331
38 Ga0070688_100092235 3300005365 Bacteria 1981
39 Ga0070688_100231016 3300005365 Bacteria 1308
40 Ga0070659_100118693 3300005366 Bacteria 2140
41 Ga0070659_100442717 3300005366 Bacteria 1101
42 Ga0070667_100027069 3300005367 Bacteria 4770
43 Ga0070667_100251027 3300005367 Bacteria 1581
44 Ga0070703_10115503 3300005406 Bacteria 966
45 Ga0070701_10191876 3300005438 Bacteria 1202
46 Ga0070700_100027327 3300005441 Bacteria 3382
47 Ga0070700_100181779 3300005441 Bacteria 1464
48 Ga0070694_100065541 3300005444 Bacteria 2489
49 Ga0070694_100170994 3300005444 Bacteria 1601
50 Ga0070678_100160581 3300005456 Bacteria 1820
51 Ga0070662_100072339 3300005457 Bacteria 2545
52 Ga0070662_100102281 3300005457 Bacteria 2170
53 Ga0070662_100747970 3300005457 Bacteria 829
54 Ga0068867_100042712 3300005459 Bacteria 3318
55 Ga0070685_10136733 3300005466 Bacteria 1538
56 Ga0070685_10158925 3300005466 Bacteria 1439
57 Ga0070699_100563758 3300005518 Bacteria 1037
58 Ga0070684_100053863 3300005535 Bacteria 3504
59 Ga0070684_100074610 3300005535 Bacteria 2990
60 Ga0068853_100130734 3300005539 Bacteria 2247
61 Ga0068853_100133788 3300005539 Bacteria 2221
62 Ga0070672_100001750 3300005543 Bacteria 13591
63 Ga0070686_100157879 3300005544 Bacteria 1594
64 Ga0070686_100158165 3300005544 Bacteria 1593
65 Ga0070696_100587907 3300005546 Bacteria 896
66 Ga0070693_100038548 3300005547 Bacteria 2671
67 Ga0070693_100326764 3300005547 Bacteria 1042
68 Ga0070665_100058907 3300005548 Bacteria 3850
69 Ga0070665_100307379 3300005548 Bacteria 1589
70 Ga0070665_100438360 3300005548 Bacteria 1316
71 Ga0070704_100009095 3300005549 Bacteria 5993
72 Ga0068855_100014417 3300005563 Bacteria 9515
73 Ga0068855_100021177 3300005563 Bacteria 7793
74 Ga0070664_100000701 3300005564 Bacteria 25591
75 Ga0070664_100084049 3300005564 Bacteria 2747
76 Ga0070664_100737965 3300005564 Bacteria 919
77 Ga0068857_100149204 3300005577 Bacteria 2117
78 Ga0068854_100008673 3300005578 Bacteria 6545
79 Ga0068854_100984324 3300005578 Bacteria 746
80 Ga0068856_100036980 3300005614 Bacteria 4788
81 Ga0068856_100046756 3300005614 Bacteria 4263
82 Ga0068856_100646795 3300005614 Bacteria 1078
83 Ga0070702_100248821 3300005615 Bacteria 1204
84 Ga0070702_100448448 3300005615 Bacteria 935
85 Ga0068852_100026121 3300005616 Bacteria 4742
86 Ga0068852_100236759 3300005616 Bacteria 1743
87 Ga0068859_100117342 3300005617 Bacteria 2726
88 Ga0068859_100232332 3300005617 Bacteria 1932
89 Ga0068859_100297045 3300005617 Bacteria 1708
90 Ga0068864_100040299 3300005618 Bacteria 3995
91 Ga0068864_100050149 3300005618 Bacteria 3592
92 Ga0068864_100406175 3300005618 Bacteria 1295
93 Ga0068864_100684376 3300005618 Bacteria 1001
94 Ga0068866_10052544 3300005718 Bacteria 2080
95 Ga0068861_100245382 3300005719 Bacteria 1525
96 Ga0068870_10131657 3300005840 Bacteria 1453
97 Ga0068863_100102999 3300005841 Bacteria 2714
98 Ga0068858_100004362 3300005842 Bacteria 13881
99 Ga0068860_100200324 3300005843 Bacteria 1934
100 Ga0068860_100265538 3300005843 Bacteria 1674
101 Ga0068862_100216666 3300005844 Bacteria 1732
102 Ga0081455_10001170 3300005937 Bacteria 32840
103 Ga0075364_10015740 3300006051 Bacteria 4695
104 Ga0070715_10180266 3300006163 Bacteria 1059
105 Ga0097621_100008059 3300006237 Bacteria 7563
106 Ga0097621_100012861 3300006237 Bacteria 6217
107 Ga0097621_100028204 3300006237 Bacteria 4424
108 Ga0097621_100052232 3300006237 Bacteria 3329
109 Ga0068871_100002805 3300006358 Bacteria 11918
110 Ga0068871_100028741 3300006358 Bacteria 4362
111 Ga0068871_100315425 3300006358 Bacteria 1375
112 Ga0075434_100566995 3300006871 Bacteria 1155
113 Ga0068865_100052673 3300006881 Bacteria 2822
114 Ga0068865_100151183 3300006881 Bacteria 1761
115 Ga0068865_100436813 3300006881 Bacteria 1079
116 Ga0097620_100117354 3300006931 Bacteria 2726
117 Ga0097620_100232341 3300006931 Bacteria 1932
118 Ga0097620_100297073 3300006931 Bacteria 1708
119 Ga0075435_100386250 3300007076 Bacteria 1203
120 Ga0105251_10004031 3300009011 Bacteria 10349
121 Ga0105251_10053863 3300009011 Bacteria 1912
122 Ga0105244_10040656 3300009036 Bacteria 2413
123 Ga0105240_10005084 3300009093 Bacteria 19712
124 Ga0105240_10507866 3300009093 Bacteria 1339
125 Ga0111539_10288062 3300009094 Bacteria 1911
126 Ga0105245_10034084 3300009098 Bacteria 4513
127 Ga0105245_10069370 3300009098 Bacteria 3196
128 Ga0105245_10095030 3300009098 Bacteria 2749
129 Ga0105245_10121102 3300009098 Bacteria 2445
130 Ga0105245_10132242 3300009098 Bacteria 2341
131 Ga0105247_10240437 3300009101 Bacteria 1233
132 Ga0105247_10305923 3300009101 Unclassified 1104
133 Ga0114129_10353166 3300009147 Bacteria 1947
134 Ga0105243_10098929 3300009148 Bacteria 2417
135 Ga0105243_10117965 3300009148 Bacteria 2232
136 Ga0105241_10049524 3300009174 Bacteria 3200
137 Ga0105241_10389868 3300009174 Bacteria 1219
138 Ga0105242_10179412 3300009176 Bacteria 1867
139 Ga0105242_10379606 3300009176 Bacteria 1313
140 Ga0105242_10569104 3300009176 Bacteria 1089
141 Ga0105248_10037647 3300009177 Bacteria 5412
142 Ga0105248_10667688 3300009177 Bacteria 1173
143 Ga0105237_10688589 3300009545 Bacteria 1029
144 Ga0105238_10041767 3300009551 Bacteria 4645
145 Ga0105249_10153207 3300009553 Bacteria 2221
146 Ga0105249_10301144 3300009553 Bacteria 1608
147 Ga0105239_10356951 3300010375 Bacteria 1650
148 Ga0105239_10424671 3300010375 Bacteria 1506
149 Ga0105239_11357174 3300010375 Bacteria 820
150 Ga0105246_10102779 3300011119 Bacteria 2084
151 Ga0105246_10376565 3300011119 Bacteria 1171
152 Ga0157373_10354670 3300013100 Bacteria 1046
153 Ga0157371_10038151 3300013102 Bacteria 3438
154 Ga0157370_10004332 3300013104 Bacteria 16314
155 Ga0157370_10240887 3300013104 Bacteria 1673
156 Ga0157369_10007804 3300013105 Bacteria 12317
157 Ga0157369_10145233 3300013105 Bacteria 2509
158 Ga0157374_10001961 3300013296 Bacteria 17262
159 Ga0157374_10159514 3300013296 Bacteria 2197
160 Ga0157374_10172781 3300013296 Bacteria 2108
161 Ga0157378_10026879 3300013297 Bacteria 5075
162 Ga0157378_10061440 3300013297 Bacteria 3353
163 Ga0157378_10170114 3300013297 Bacteria 2043
164 Ga0157378_10308294 3300013297 Bacteria 1534
165 Ga0163162_10035385 3300013306 Bacteria 4975
166 Ga0163162_10096431 3300013306 Bacteria 3046
167 Ga0163162_10120785 3300013306 Bacteria 2724
168 Ga0157372_10081701 3300013307 Bacteria 3658
169 Ga0157375_10003680 3300013308 Bacteria 13309
170 Ga0157375_10121335 3300013308 Bacteria 2723
171 Ga0157375_10155870 3300013308 Bacteria 2422
172 Ga0157377_10047216 3300014745 Bacteria 2412
173 Ga0157377_10048208 3300014745 Bacteria 2389
174 Ga0157379_10057965 3300014968 Bacteria 3461
175 Ga0157379_10184358 3300014968 Bacteria 1886
176 Ga0157376_10007665 3300014969 Bacteria 7730
177 Ga0157376_10030341 3300014969 Bacteria 4317
178 Ga0157376_10512113 3300014969 Unclassified 1181
179 Ga0157376_10609658 3300014969 Bacteria 1087
180 Ga0163161_10228976 3300017792 Bacteria 1442
181 Ga0206356_10645588 3300020070 Bacteria 1096
182 Ga0207666_1006069 3300025271 Bacteria 1559
183 Ga0207697_10023247 3300025315 Bacteria 2538
184 Ga0207655_1059831 3300025728 Bacteria 1480
185 Ga0207713_1004765 3300025735 Bacteria 8718
186 Ga0207653_10112182 3300025885 Bacteria 974
187 Ga0207682_10001584 3300025893 Bacteria 10465
188 Ga0207642_10068167 3300025899 Bacteria 1682
189 Ga0207642_10253961 3300025899 Bacteria 999
190 Ga0207688_10002343 3300025901 Bacteria 10177
191 Ga0207680_10040306 3300025903 Bacteria 2717
192 Ga0207647_10241472 3300025904 Bacteria 1037
193 Ga0207685_10180930 3300025905 Bacteria 977
194 Ga0207645_10026236 3300025907 Bacteria 3766
195 Ga0207643_10011107 3300025908 Bacteria 4860
196 Ga0207705_10037976 3300025909 Bacteria 3447
197 Ga0207705_10116052 3300025909 Bacteria 1982
198 Ga0207654_10050254 3300025911 Bacteria 2395
199 Ga0207654_10438400 3300025911 Bacteria 914
200 Ga0207695_10006155 3300025913 Bacteria 15644
201 Ga0207660_10226012 3300025917 Bacteria 1470
202 Ga0207662_10017453 3300025918 Bacteria 4060
203 Ga0207649_10038772 3300025920 Bacteria 2886
204 Ga0207649_10142744 3300025920 Bacteria 1641
205 Ga0207649_10252842 3300025920 Bacteria 1270
206 Ga0207650_10004814 3300025925 Bacteria 9221
207 Ga0207659_10007788 3300025926 Bacteria 6617
208 Ga0207659_10072092 3300025926 Bacteria 2524
209 Ga0207659_10083150 3300025926 Bacteria 2372
210 Ga0207659_10131858 3300025926 Bacteria 1930
211 Ga0207687_10048878 3300025927 Bacteria 2939
212 Ga0207687_10096153 3300025927 Bacteria 2170
213 Ga0207644_10010320 3300025931 Bacteria 6155
214 Ga0207706_10007731 3300025933 Bacteria 9922
215 Ga0207706_10011863 3300025933 Bacteria 7934
216 Ga0207706_10234306 3300025933 Unclassified 1605
217 Ga0207706_10287526 3300025933 Bacteria 1433
218 Ga0207686_10143145 3300025934 Bacteria 1655
219 Ga0207709_10089551 3300025935 Bacteria 2007
220 Ga0207709_10240662 3300025935 Bacteria 1316
221 Ga0207670_10012370 3300025936 Bacteria 4993
222 Ga0207670_10038693 3300025936 Bacteria 3117
223 Ga0207670_10064301 3300025936 Bacteria 2514
224 Ga0207670_10193311 3300025936 Bacteria 1541
225 Ga0207669_10015011 3300025937 Bacteria 3896
226 Ga0207704_10107068 3300025938 Bacteria 1880
227 Ga0207691_10004456 3300025940 Bacteria 13575
228 Ga0207691_10142730 3300025940 Bacteria 2109
229 Ga0207711_10476530 3300025941 Bacteria 1163
230 Ga0207689_10014402 3300025942 Bacteria 6727
231 Ga0207689_10319412 3300025942 Bacteria 1288
232 Ga0207661_10015309 3300025944 Bacteria 5641
233 Ga0207661_10156055 3300025944 Bacteria 1977
234 Ga0207679_10026031 3300025945 Bacteria 4030
235 Ga0207679_10107745 3300025945 Bacteria 2193
236 Ga0207679_10556518 3300025945 Bacteria 1030
237 Ga0207667_10002749 3300025949 Bacteria 21743
238 Ga0207667_10031384 3300025949 Bacteria 5736
239 Ga0207667_10065744 3300025949 Bacteria 3781
240 Ga0207651_10007776 3300025960 Bacteria 5732
241 Ga0207651_10104329 3300025960 Bacteria 2112
242 Ga0207668_10036473 3300025972 Bacteria 3281
243 Ga0207640_10030714 3300025981 Bacteria 3312
244 Ga0207658_10424720 3300025986 Bacteria 1173
245 Ga0207677_10022298 3300026023 Bacteria 3890
246 Ga0207677_10164536 3300026023 Bacteria 1727
247 Ga0207703_10298610 3300026035 Bacteria 1468
248 Ga0207708_10098512 3300026075 Bacteria 2260
249 Ga0207708_10460169 3300026075 Bacteria 1061
250 Ga0207702_10555939 3300026078 Bacteria 1123
251 Ga0207648_10030972 3300026089 Bacteria 4732
252 Ga0207648_10079551 3300026089 Bacteria 2860
253 Ga0207676_10033534 3300026095 Bacteria 3880
254 Ga0207676_10090372 3300026095 Bacteria 2513
255 Ga0207674_10039716 3300026116 Bacteria 4877
256 Ga0207674_10074117 3300026116 Bacteria 3417
257 Ga0207675_100015862 3300026118 Bacteria 7026
258 Ga0207683_10000544 3300026121 Bacteria 34864
259 Ga0207683_10029595 3300026121 Bacteria 4742
260 Ga0207698_10000379 3300026142 Bacteria 25834
261 Ga0207698_10070389 3300026142 Bacteria 2771
262 Ga0207698_10224260 3300026142 Bacteria 1701
263 Ga0207698_10270298 3300026142 Bacteria 1567
264 Ga0209371_1012989 3300027312 Bacteria 2373
265 Ga0209966_1021780 3300027695 Bacteria 1249
266 Ga0207428_10092290 3300027907 Bacteria 2350
267 Ga0268266_10437907 3300028379 Bacteria 1241
268 Ga0268265_10057759 3300028380 Bacteria 2959
269 Ga0268265_10060733 3300028380 Bacteria 2898
270 Ga0268264_10543366 3300028381 Bacteria 1139
271 Ga0265324_10000018 3300029957 Bacteria 184238
272 Ga0265324_10000612 3300029957 Bacteria 24383
273 Ga0268256_1014256 3300030500 Bacteria 2370
274 Ga0265325_10000035 3300031241 Bacteria 99051
275 Ga0265325_10001853 3300031241 Bacteria 14598
276 Ga0265331_10017178 3300031250 Bacteria 3780
277 Ga0265331_10103858 3300031250 Bacteria 1306
278 Ga0265327_10006092 3300031251 Bacteria 9776
279 Ga0265316_10068783 3300031344 Bacteria 2734
280 Ga0265316_10139916 3300031344 Bacteria 1819
281 Ga0307509_10000145 3300031507 Bacteria 107492
282 Ga0307408_100000019 3300031548 Bacteria 344502
283 Ga0316579_10000679 3300031691 Bacteria 11541
284 Ga0316579_10000955 3300031691 Bacteria 10108
285 Ga0265314_10001810 3300031711 Bacteria 23057
286 Ga0265314_10062888 3300031711 Bacteria 2520
287 Ga0316578_10048714 3300031728 Bacteria 2475
288 Ga0316577_10143722 3300031733 Bacteria 1344
289 Ga0316583_10046805 3300032133 Bacteria 1526
290 Ga0373924_0094118 3300035410 Bacteria 1284
291 Ga0373937_0104927 3300036401 Bacteria 2626
292 Ga0373937_0115881 3300036401 Bacteria 2495
293 Ga0316582_0039967 3300036647 Bacteria 2924
294 Ga0316582_0048594 3300036647 Unclassified 2683
295 Ga0316584_0038679 3300036712 Bacteria 3550
296 Ga0316584_0181222 3300036712 Bacteria 1559
297 Ga0316581_0000807 3300037588 Bacteria 6506
298 Ga0436361_0523086 3300039447 Bacteria 5071
299 Ga0436363_0996184 3300039450 Bacteria 1042
300 Ga0451853_2097694 3300041512 Bacteria 921
301 Ga0439431_0053476 3300041997 Bacteria 1051
302 Ga0439437_003641 3300042000 Bacteria 1663
303 Ga0439456_000220 3300042013 Bacteria 15563
304 Ga0439456_001653 3300042013 Bacteria 4503
305 Ga0450911_000011 3300042115 Bacteria 130739
306 Ga0439464_0000312 3300042439 Bacteria 9273
307 Ga0439464_0065999 3300042439 Bacteria 1065
308 Ga0450893_0008751 3300042532 Bacteria 1650
309 Ga0451577_0000002 3300042876 Bacteria 1731375
310 Ga0451577_0007738 3300042876 Bacteria 10532
311 Ga0451577_0016080 3300042876 Bacteria 6939
312 Ga0451577_0129228 3300042876 Bacteria 2265
313 Ga0451577_0362006 3300042876 Bacteria 1316
314 Ga0453683_0000013 3300044673 Bacteria 371932
315 Ga0453683_0215180 3300044673 Bacteria 1221
316 Ga0453684_0000002 3300044712 Bacteria 1731375
317 Ga0453684_0016594 3300044712 Bacteria 11494
318 Ga0451576_0000037 3300045051 Bacteria 372173
319 Ga0451576_0000320 3300045051 Bacteria 116612
320 Ga0451576_0003253 3300045051 Bacteria 22534
321 Ga0451576_0073619 3300045051 Bacteria 3555
322 Ga0451576_0281564 3300045051 Bacteria 1739
323 Ga0451576_1171896 3300045051 Bacteria 803
324 Ga0451576_1228452 3300045051 Bacteria 782
325 Ga0495592_0005543 3300046454 Bacteria 9334
326 Ga0495651_0120351 3300046462 Bacteria 1929
327 Ga0495653_0053443 3300046463 Bacteria 3090
328 Ga0495664_0131208 3300046477 Bacteria 1517
329 Ga0495585_0015171 3300046492 Bacteria 4478
330 Ga0495607_0004339 3300046501 Bacteria 10463
331 Ga0495606_0013714 3300046507 Bacteria 6380
332 Ga0495608_0102668 3300046511 Bacteria 1843
333 Ga0495616_0113423 3300046513 Bacteria 1257
334 Ga0495631_0273620 3300046518 Bacteria 719
335 Ga0495637_0030344 3300046520 Bacteria 2399
336 Ga0495637_0083705 3300046520 Bacteria 1268
337 Ga0495652_0181589 3300046529 Bacteria 1614
338 Ga0495654_0133944 3300046530 Bacteria 1110
339 Ga0495598_0008804 3300046537 Bacteria 2363
340 Ga0495621_0073599 3300046539 Bacteria 1263
341 Ga0495635_0231717 3300046663 Bacteria 1247
342 Ga0495661_0000050 3300046665 Bacteria 143435
343 Ga0495657_0124307 3300046675 Bacteria 1622
344 Ga0495599_0037179 3300046678 Bacteria 3058
345 Ga0495604_0060002 3300047317 Bacteria 2914
346 Ga0495680_0084439 3300047322 Bacteria 2393
347 Ga0495683_0000055 3300047323 Bacteria 119199
348 Ga0495684_0104193 3300047471 Bacteria 2144
349 Ga0496105_0590090 3300048908 Bacteria 863
350 Ga0496108_0010236 3300048911 Bacteria 7615
351 Ga0496108_0325568 3300048911 Bacteria 1340
352 Ga0496109_0005148 3300048912 Bacteria 10913
353 Ga0496110_0022876 3300048913 Bacteria 5311
354 Ga0496114_0040038 3300048917 Bacteria 3879
355 Ga0496123_0027774 3300048926 Bacteria 4207
356 Ga0496123_0349350 3300048926 Bacteria 688
357 Ga0495678_022196 3300049459 Bacteria 2779
358 Ga0495682_0000573 3300049460 Bacteria 24941
359 Ga0501031_0272349 3300049568 Bacteria 1099
360 Ga0501031_0461375 3300049568 Bacteria 820
361 Ga0501032_0001373 3300049569 Bacteria 19318
362 Ga0501032_0020712 3300049569 Bacteria 4578
363 Ga0501032_0063460 3300049569 Bacteria 2473
364 Ga0501032_0132413 3300049569 Bacteria 1644
365 Ga0501033_0001864 3300049570 Bacteria 18331
366 Ga0501033_0091461 3300049570 Bacteria 2225
367 Ga0501034_0011029 3300049571 Bacteria 9381
368 Ga0501034_0056305 3300049571 Bacteria 3956
369 Ga0501034_0173751 3300049571 Bacteria 2121
370 Ga0501036_0001661 3300049572 Bacteria 17238
371 Ga0501036_0013638 3300049572 Bacteria 6757
372 Ga0501036_0065391 3300049572 Bacteria 3078
373 Ga0501037_0000474 3300049573 Bacteria 32555
374 Ga0501038_0006477 3300049574 Bacteria 10835
375 Ga0501038_0011073 3300049574 Bacteria 8237
376 Ga0501038_0029427 3300049574 Bacteria 4867
377 Ga0501038_0042237 3300049574 Bacteria 3971
378 Ga0501039_0037972 3300049575 Bacteria 3719
379 Ga0501039_0054337 3300049575 Bacteria 3100
380 Ga0501039_0074856 3300049575 Bacteria 2632
381 Ga0501039_0103243 3300049575 Bacteria 2225
382 Ga0501040_0000260 3300049576 Bacteria 30935
383 Ga0501040_0012330 3300049576 Bacteria 5600
384 Ga0501041_0002647 3300049577 Bacteria 10212
385 Ga0501041_0368317 3300049577 Bacteria 909
386 Ga0501042_0005609 3300049578 Bacteria 8092
387 Ga0501042_0010996 3300049578 Bacteria 6092
388 Ga0501043_0005740 3300049579 Bacteria 10000
389 Ga0501043_0062399 3300049579 Bacteria 2926
390 Ga0501043_0141690 3300049579 Bacteria 1882
391 Ga0501043_0194914 3300049579 Bacteria 1574
392 Ga0501046_0002898 3300049580 Bacteria 15906
393 Ga0501046_0165334 3300049580 Bacteria 1662
394 Ga0501046_0211425 3300049580 Bacteria 1440
395 Ga0501047_0004440 3300049581 Bacteria 13210
396 Ga0501047_0095380 3300049581 Bacteria 2853
397 Ga0501048_0002369 3300049582 Bacteria 14395
398 Ga0501048_0015895 3300049582 Bacteria 5552
399 Ga0501067_0017247 3300049583 Bacteria 3991
400 Ga0501068_0001753 3300049584 Bacteria 11532
401 Ga0501068_0170058 3300049584 Bacteria 1375
402 Ga0501069_0001227 3300049585 Bacteria 12517
403 Ga0501070_0001841 3300049586 Bacteria 18702
404 Ga0501070_0051509 3300049586 Bacteria 3417
405 Ga0501073_0000127 3300049589 Bacteria 49817
406 Ga0501074_0087485 3300049590 Bacteria 2231
407 Ga0501075_0018092 3300049591 Bacteria 5096
408 Ga0501076_0000858 3300049592 Bacteria 19723
409 Ga0501079_0008772 3300049741 Bacteria 7662
410 Ga0501079_0054850 3300049741 Bacteria 3074
411 Ga0501080_0007745 3300049742 Bacteria 9710
412 Ga0501081_0031370 3300049743 Bacteria 3601
413 Ga0501083_0003616 3300049744 Bacteria 10842
414 Ga0501035_0001968 3300049822 Bacteria 20568
415 Ga0501035_0086085 3300049822 Bacteria 2769
416 Ga0501035_0117850 3300049822 Bacteria 2323
417 Ga0501035_0144625 3300049822 Bacteria 2065
418 Ga0501044_0014044 3300049823 Bacteria 8647
419 Ga0501044_0452648 3300049823 Bacteria 1190
420 Ga0501045_0003520 3300049824 Bacteria 10729
421 Ga0501045_0006849 3300049824 Bacteria 7895
422 nmdc:mga00v17_643_c2 3300050491 Bacteria 4697
423 nmdc:mga08y16_371590_c1 3300050511 Bacteria 1467
424 nmdc:mga0n895_703332_c1 3300050512 Bacteria 1006
425 Ga0500641_0001591 3300053096 Bacteria 8083
426 Ga0500650_0276134 3300053098 Bacteria 748
427 Ga0500618_009688 3300053125 Bacteria 2620
428 Ga0501084_0011299 3300054114 Bacteria 7392
429 Ga0501084_0115185 3300054114 Bacteria 2259
430 Ga0501082_0004486 3300060353 Bacteria 12196
431 Ga0501082_0075305 3300060353 Bacteria 2908
432 Ga0530510_0015757 3300061734 Bacteria 5344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_10569104 Ga0105242_105691042 174
2 3300046518 Ga0495631_0273620 Ga0495631_0273620_45_572 174
3 3300036647 Ga0316582_0048594 Ga0316582_0048594_1723_2364 193
4 3300009011 Ga0105251_10053863 Ga0105251_100538633 195
5 3300031507 Ga0307509_10000145 Ga0307509_1000014588 203
6 3300036401 Ga0373937_0104927 Ga0373937_0104927_375_1007 207
7 3300049577 Ga0501041_0368317 Ga0501041_0368317_203_892 207
8 3300005518 Ga0070699_100563758 Ga0070699_1005637581 208
9 iso_pu_bacteria 2510065053 2510282626 208
10 iso_pu_bacteria 2510065055 2510295280 208
11 iso_pu_bacteria 2510065058 2510311094 208
12 iso_pu_bacteria 2600254954 2600442640 208
13 iso_pu_bacteria 2600255389 2602011015 208
14 iso_pu_bacteria 2606217733 2608385089 208
15 iso_pu_bacteria 2773857672 2774129132 208
16 iso_pu_bacteria 2808606373 2808906141 208
17 iso_pu_bacteria 2811994881 2812369611 208
18 iso_pu_bacteria 2823421272 2823421512 208
19 iso_pu_bacteria 2912963787 2912969004 208
20 iso_pu_bacteria 2917832318 2917833239 208
21 iso_pu_bacteria 2919125081 2919126220 208
22 iso_pu_bacteria 2919501602 2919505926 208
23 iso_pu_bacteria 2923519811 2923523698 208
24 iso_pu_bacteria 2926063275 2926067797 208
25 iso_pu_bacteria 2939651529 2939654264 208
26 iso_pu_bacteria 2974298342 2974302256 208
27 iso_pu_bacteria 2984499530 2984500172 208
28 iso_pu_bacteria 2984504281 2984506619 208
29 iso_pu_bacteria 8016728285 8016731356 208
30 iso_pu_bacteria 8034962539 8034964389 208
31 iso_pu_bacteria 8055878733 8055881773 208
32 iso_pu_bacteria 2643221681 2644454838 209
33 iso_pu_bacteria 2643221961 2645722060 209
34 iso_pu_bacteria 2643221962 2645724902 209
35 iso_pu_bacteria 2643221697 2644536235 210
36 3300005937 Ga0081455_10001170 Ga0081455_1000117021 211
37 3300025986 Ga0207658_10424720 Ga0207658_104247202 211
38 3300005328 Ga0070676_10201579 Ga0070676_102015791 212
39 3300005334 Ga0068869_100044684 Ga0068869_1000446844 212
40 3300005334 Ga0068869_100148343 Ga0068869_1001483433 212
41 3300005338 Ga0068868_100787351 Ga0068868_1007873511 212
42 3300005354 Ga0070675_100305903 Ga0070675_1003059032 212
43 3300005354 Ga0070675_100336004 Ga0070675_1003360042 212
44 3300005444 Ga0070694_100065541 Ga0070694_1000655412 212
45 3300005457 Ga0070662_100747970 Ga0070662_1007479701 212
46 3300005466 Ga0070685_10136733 Ga0070685_101367333 212
47 3300005548 Ga0070665_100307379 Ga0070665_1003073793 212
48 3300005564 Ga0070664_100084049 Ga0070664_1000840493 212
49 3300005578 Ga0068854_100984324 Ga0068854_1009843241 212
50 3300005614 Ga0068856_100646795 Ga0068856_1006467952 212
51 3300005618 Ga0068864_100406175 Ga0068864_1004061751 212
52 3300005843 Ga0068860_100265538 Ga0068860_1002655381 212
53 3300005844 Ga0068862_100216666 Ga0068862_1002166663 212
54 3300006871 Ga0075434_100566995 Ga0075434_1005669952 212
55 3300009011 Ga0105251_10004031 Ga0105251_100040315 212
56 3300009036 Ga0105244_10040656 Ga0105244_100406562 212
57 3300009098 Ga0105245_10095030 Ga0105245_100950303 212
58 3300009098 Ga0105245_10132242 Ga0105245_101322423 212
59 3300009101 Ga0105247_10305923 Ga0105247_103059232 212
60 3300009174 Ga0105241_10389868 Ga0105241_103898682 212
61 3300009545 Ga0105237_10688589 Ga0105237_106885892 212
62 3300009553 Ga0105249_10301144 Ga0105249_103011443 212
63 3300010375 Ga0105239_11357174 Ga0105239_113571742 212
64 3300011119 Ga0105246_10376565 Ga0105246_103765651 212
65 3300013102 Ga0157371_10038151 Ga0157371_100381515 212
66 3300013105 Ga0157369_10007804 Ga0157369_100078046 212
67 3300013296 Ga0157374_10172781 Ga0157374_101727813 212
68 3300013308 Ga0157375_10121335 Ga0157375_101213353 212
69 3300014969 Ga0157376_10512113 Ga0157376_105121131 212
70 3300025728 Ga0207655_1059831 Ga0207655_10598312 212
71 3300025735 Ga0207713_1004765 Ga0207713_10047656 212
72 3300025911 Ga0207654_10438400 Ga0207654_104384001 212
73 3300025926 Ga0207659_10131858 Ga0207659_101318583 212
74 3300025933 Ga0207706_10234306 Ga0207706_102343062 212
75 3300025933 Ga0207706_10287526 Ga0207706_102875263 212
76 3300025942 Ga0207689_10014402 Ga0207689_100144022 212
77 3300025945 Ga0207679_10107745 Ga0207679_101077452 212
78 3300026078 Ga0207702_10555939 Ga0207702_105559392 212
79 3300027312 Ga0209371_1012989 Ga0209371_10129892 212
80 3300028380 Ga0268265_10060733 Ga0268265_100607332 212
81 3300028381 Ga0268264_10543366 Ga0268264_105433662 212
82 3300030500 Ga0268256_1014256 Ga0268256_10142562 212
83 3300031344 Ga0265316_10139916 Ga0265316_101399161 212
84 3300031548 Ga0307408_100000019 Ga0307408_100000019278 212
85 3300031691 Ga0316579_10000679 Ga0316579_100006792 212
86 3300031691 Ga0316579_10000955 Ga0316579_1000095510 212
87 3300031728 Ga0316578_10048714 Ga0316578_100487144 212
88 3300031733 Ga0316577_10143722 Ga0316577_101437222 212
89 3300032133 Ga0316583_10046805 Ga0316583_100468052 212
90 3300036647 Ga0316582_0039967 Ga0316582_0039967_1317_1958 212
91 3300036712 Ga0316584_0038679 Ga0316584_0038679_1238_1879 212
92 3300036712 Ga0316584_0181222 Ga0316584_0181222_177_818 212
93 3300037588 Ga0316581_0000807 Ga0316581_0000807_407_1048 212
94 3300039450 Ga0436363_0996184 Ga0436363_0996184_276_917 212
95 3300041997 Ga0439431_0053476 Ga0439431_0053476_273_914 212
96 3300042000 Ga0439437_003641 Ga0439437_003641_890_1531 212
97 3300042013 Ga0439456_000220 Ga0439456_000220_9027_9668 212
98 3300042013 Ga0439456_001653 Ga0439456_001653_823_1464 212
99 3300042115 Ga0450911_000011 Ga0450911_000011_51869_52510 212
100 3300042439 Ga0439464_0000312 Ga0439464_0000312_7362_8003 212
101 3300042439 Ga0439464_0065999 Ga0439464_0065999_78_719 212
102 3300042532 Ga0450893_0008751 Ga0450893_0008751_621_1262 212
103 3300042876 Ga0451577_0129228 Ga0451577_0129228_983_1624 212
104 3300046463 Ga0495653_0053443 Ga0495653_0053443_1522_2163 212
105 3300046492 Ga0495585_0015171 Ga0495585_0015171_1226_1867 212
106 3300046501 Ga0495607_0004339 Ga0495607_0004339_8699_9340 212
107 3300046507 Ga0495606_0013714 Ga0495606_0013714_4810_5451 212
108 3300046513 Ga0495616_0113423 Ga0495616_0113423_172_813 212
109 3300046520 Ga0495637_0030344 Ga0495637_0030344_1177_1818 212
110 3300046520 Ga0495637_0083705 Ga0495637_0083705_131_772 212
111 3300046665 Ga0495661_0000050 Ga0495661_0000050_115892_116533 212
112 3300047323 Ga0495683_0000055 Ga0495683_0000055_93389_94030 212
113 3300048926 Ga0496123_0349350 Ga0496123_0349350_31_672 212
114 3300049459 Ga0495678_022196 Ga0495678_022196_1284_1925 212
115 3300049460 Ga0495682_0000573 Ga0495682_0000573_19264_19905 212
116 3300053125 Ga0500618_009688 Ga0500618_009688_731_1372 212
117 3300005546 Ga0070696_100587907 Ga0070696_1005879072 213
118 3300006051 Ga0075364_10015740 Ga0075364_100157404 213
119 3300009093 Ga0105240_10507866 Ga0105240_105078662 213
120 3300013104 Ga0157370_10004332 Ga0157370_1000433214 213
121 3300029957 Ga0265324_10000612 Ga0265324_1000061219 213
122 3300031241 Ga0265325_10001853 Ga0265325_1000185312 213
123 3300031250 Ga0265331_10017178 Ga0265331_100171782 213
124 3300031251 Ga0265327_10006092 Ga0265327_1000609211 213
125 3300031344 Ga0265316_10068783 Ga0265316_100687831 213
126 3300031711 Ga0265314_10001810 Ga0265314_100018104 213
127 3300039447 Ga0436361_0523086 Ga0436361_0523086_1147_1794 213
128 3300041512 Ga0451853_2097694 Ga0451853_2097694_219_872 213
129 3300042876 Ga0451577_0362006 Ga0451577_0362006_245_898 213
130 3300045051 Ga0451576_1228452 Ga0451576_1228452_49_702 213
131 3300048911 Ga0496108_0325568 Ga0496108_0325568_95_736 213
132 3300048926 Ga0496123_0027774 Ga0496123_0027774_2338_2985 213
133 3300049568 Ga0501031_0272349 Ga0501031_0272349_116_766 213
134 3300049568 Ga0501031_0461375 Ga0501031_0461375_162_803 213
135 3300049569 Ga0501032_0020712 Ga0501032_0020712_778_1419 213
136 3300049571 Ga0501034_0056305 Ga0501034_0056305_1857_2498 213
137 3300049572 Ga0501036_0013638 Ga0501036_0013638_5470_6120 213
138 3300049574 Ga0501038_0011073 Ga0501038_0011073_901_1542 213
139 3300049574 Ga0501038_0042237 Ga0501038_0042237_940_1581 213
140 3300049575 Ga0501039_0037972 Ga0501039_0037972_2300_2941 213
141 3300049575 Ga0501039_0074856 Ga0501039_0074856_323_973 213
142 3300049576 Ga0501040_0012330 Ga0501040_0012330_4340_4990 213
143 3300049577 Ga0501041_0002647 Ga0501041_0002647_8643_9293 213
144 3300049578 Ga0501042_0010996 Ga0501042_0010996_1085_1735 213
145 3300049579 Ga0501043_0062399 Ga0501043_0062399_385_1035 213
146 3300049580 Ga0501046_0211425 Ga0501046_0211425_458_1099 213
147 3300049582 Ga0501048_0015895 Ga0501048_0015895_993_1643 213
148 3300049584 Ga0501068_0170058 Ga0501068_0170058_14_664 213
149 3300049591 Ga0501075_0018092 Ga0501075_0018092_4200_4850 213
150 3300049592 Ga0501076_0000858 Ga0501076_0000858_1988_2638 213
151 3300049741 Ga0501079_0054850 Ga0501079_0054850_562_1212 213
152 3300049743 Ga0501081_0031370 Ga0501081_0031370_757_1407 213
153 3300049822 Ga0501035_0117850 Ga0501035_0117850_640_1281 213
154 3300049824 Ga0501045_0006849 Ga0501045_0006849_2908_3558 213
155 3300050491 nmdc:mga00v17_643_c2 nmdc:mga00v17_643_c2_2960_3604 213
156 3300053096 Ga0500641_0001591 Ga0500641_0001591_2961_3605 213
157 3300053098 Ga0500650_0276134 Ga0500650_0276134_74_718 213
158 3300054114 Ga0501084_0011299 Ga0501084_0011299_15_665 213
159 3300060353 Ga0501082_0004486 Ga0501082_0004486_10981_11631 213
160 3300061734 Ga0530510_0015757 Ga0530510_0015757_4209_4859 213
161 3300005327 Ga0070658_10025343 Ga0070658_100253432 214
162 3300005329 Ga0070683_100003177 Ga0070683_10000317711 214
163 3300005331 Ga0070670_100023010 Ga0070670_1000230103 214
164 3300005333 Ga0070677_10013323 Ga0070677_100133232 214
165 3300005334 Ga0068869_100378661 Ga0068869_1003786612 214
166 3300005335 Ga0070666_10013759 Ga0070666_100137593 214
167 3300005338 Ga0068868_100003334 Ga0068868_10000333410 214
168 3300005338 Ga0068868_100032341 Ga0068868_1000323413 214
169 3300005340 Ga0070689_100100868 Ga0070689_1001008683 214
170 3300005344 Ga0070661_100001429 Ga0070661_10000142913 214
171 3300005344 Ga0070661_100262685 Ga0070661_1002626852 214
172 3300005345 Ga0070692_10027806 Ga0070692_100278063 214
173 3300005347 Ga0070668_100048990 Ga0070668_1000489903 214
174 3300005354 Ga0070675_100025860 Ga0070675_1000258604 214
175 3300005354 Ga0070675_100614362 Ga0070675_1006143622 214
176 3300005355 Ga0070671_100001144 Ga0070671_1000011443 214
177 3300005355 Ga0070671_100230290 Ga0070671_1002302902 214
178 3300005356 Ga0070674_100053403 Ga0070674_1000534033 214
179 3300005356 Ga0070674_100088802 Ga0070674_1000888022 214
180 3300005364 Ga0070673_100022353 Ga0070673_1000223534 214
181 3300005364 Ga0070673_100218548 Ga0070673_1002185482 214
182 3300005365 Ga0070688_100064078 Ga0070688_1000640783 214
183 3300005366 Ga0070659_100118693 Ga0070659_1001186932 214
184 3300005366 Ga0070659_100442717 Ga0070659_1004427172 214
185 3300005367 Ga0070667_100027069 Ga0070667_1000270694 214
186 3300005367 Ga0070667_100251027 Ga0070667_1002510272 214
187 3300005406 Ga0070703_10115503 Ga0070703_101155031 214
188 3300005438 Ga0070701_10191876 Ga0070701_101918761 214
189 3300005441 Ga0070700_100027327 Ga0070700_1000273273 214
190 3300005441 Ga0070700_100181779 Ga0070700_1001817792 214
191 3300005444 Ga0070694_100170994 Ga0070694_1001709942 214
192 3300005456 Ga0070678_100160581 Ga0070678_1001605812 214
193 3300005457 Ga0070662_100072339 Ga0070662_1000723393 214
194 3300005457 Ga0070662_100102281 Ga0070662_1001022812 214
195 3300005459 Ga0068867_100042712 Ga0068867_1000427123 214
196 3300005466 Ga0070685_10158925 Ga0070685_101589252 214
197 3300005535 Ga0070684_100074610 Ga0070684_1000746103 214
198 3300005539 Ga0068853_100130734 Ga0068853_1001307342 214
199 3300005543 Ga0070672_100001750 Ga0070672_10000175011 214
200 3300005544 Ga0070686_100157879 Ga0070686_1001578792 214
201 3300005544 Ga0070686_100158165 Ga0070686_1001581652 214
202 3300005547 Ga0070693_100326764 Ga0070693_1003267642 214
203 3300005548 Ga0070665_100058907 Ga0070665_1000589073 214
204 3300005548 Ga0070665_100438360 Ga0070665_1004383601 214
205 3300005549 Ga0070704_100009095 Ga0070704_1000090953 214
206 3300005564 Ga0070664_100000701 Ga0070664_10000070124 214
207 3300005577 Ga0068857_100149204 Ga0068857_1001492043 214
208 3300005578 Ga0068854_100008673 Ga0068854_1000086734 214
209 3300005615 Ga0070702_100248821 Ga0070702_1002488212 214
210 3300005615 Ga0070702_100448448 Ga0070702_1004484482 214
211 3300005616 Ga0068852_100026121 Ga0068852_1000261213 214
212 3300005616 Ga0068852_100236759 Ga0068852_1002367592 214
213 3300005617 Ga0068859_100297045 Ga0068859_1002970452 214
214 3300005618 Ga0068864_100040299 Ga0068864_1000402994 214
215 3300005618 Ga0068864_100050149 Ga0068864_1000501491 214
216 3300005718 Ga0068866_10052544 Ga0068866_100525443 214
217 3300005719 Ga0068861_100245382 Ga0068861_1002453822 214
218 3300005840 Ga0068870_10131657 Ga0068870_101316572 214
219 3300005841 Ga0068863_100102999 Ga0068863_1001029993 214
220 3300005843 Ga0068860_100200324 Ga0068860_1002003243 214
221 3300006237 Ga0097621_100008059 Ga0097621_1000080596 214
222 3300006237 Ga0097621_100052232 Ga0097621_1000522323 214
223 3300006358 Ga0068871_100002805 Ga0068871_1000028053 214
224 3300006358 Ga0068871_100028741 Ga0068871_1000287413 214
225 3300006881 Ga0068865_100151183 Ga0068865_1001511832 214
226 3300006881 Ga0068865_100436813 Ga0068865_1004368132 214
227 3300006931 Ga0097620_100297073 Ga0097620_1002970733 214
228 3300009094 Ga0111539_10288062 Ga0111539_102880622 214
229 3300009098 Ga0105245_10121102 Ga0105245_101211023 214
230 3300009101 Ga0105247_10240437 Ga0105247_102404372 214
231 3300009148 Ga0105243_10098929 Ga0105243_100989292 214
232 3300009176 Ga0105242_10379606 Ga0105242_103796062 214
233 3300009177 Ga0105248_10667688 Ga0105248_106676882 214
234 3300009553 Ga0105249_10153207 Ga0105249_101532073 214
235 3300010375 Ga0105239_10356951 Ga0105239_103569512 214
236 3300011119 Ga0105246_10102779 Ga0105246_101027792 214
237 3300013296 Ga0157374_10001961 Ga0157374_1000196115 214
238 3300013296 Ga0157374_10159514 Ga0157374_101595143 214
239 3300013297 Ga0157378_10026879 Ga0157378_100268794 214
240 3300013297 Ga0157378_10170114 Ga0157378_101701143 214
241 3300013306 Ga0163162_10035385 Ga0163162_100353853 214
242 3300013308 Ga0157375_10003680 Ga0157375_1000368012 214
243 3300014745 Ga0157377_10048208 Ga0157377_100482083 214
244 3300014968 Ga0157379_10184358 Ga0157379_101843583 214
245 3300014969 Ga0157376_10007665 Ga0157376_100076656 214
246 3300017792 Ga0163161_10228976 Ga0163161_102289762 214
247 3300025271 Ga0207666_1006069 Ga0207666_10060692 214
248 3300025315 Ga0207697_10023247 Ga0207697_100232473 214
249 3300025885 Ga0207653_10112182 Ga0207653_101121822 214
250 3300025893 Ga0207682_10001584 Ga0207682_100015849 214
251 3300025899 Ga0207642_10068167 Ga0207642_100681672 214
252 3300025899 Ga0207642_10253961 Ga0207642_102539612 214
253 3300025901 Ga0207688_10002343 Ga0207688_100023439 214
254 3300025903 Ga0207680_10040306 Ga0207680_100403063 214
255 3300025904 Ga0207647_10241472 Ga0207647_102414722 214
256 3300025907 Ga0207645_10026236 Ga0207645_100262364 214
257 3300025908 Ga0207643_10011107 Ga0207643_100111074 214
258 3300025909 Ga0207705_10037976 Ga0207705_100379762 214
259 3300025918 Ga0207662_10017453 Ga0207662_100174533 214
260 3300025920 Ga0207649_10038772 Ga0207649_100387722 214
261 3300025920 Ga0207649_10142744 Ga0207649_101427442 214
262 3300025925 Ga0207650_10004814 Ga0207650_100048149 214
263 3300025926 Ga0207659_10007788 Ga0207659_100077883 214
264 3300025926 Ga0207659_10072092 Ga0207659_100720922 214
265 3300025931 Ga0207644_10010320 Ga0207644_100103204 214
266 3300025933 Ga0207706_10007731 Ga0207706_1000773110 214
267 3300025933 Ga0207706_10011863 Ga0207706_100118638 214
268 3300025935 Ga0207709_10089551 Ga0207709_100895512 214
269 3300025936 Ga0207670_10038693 Ga0207670_100386933 214
270 3300025937 Ga0207669_10015011 Ga0207669_100150113 214
271 3300025938 Ga0207704_10107068 Ga0207704_101070683 214
272 3300025940 Ga0207691_10004456 Ga0207691_100044564 214
273 3300025940 Ga0207691_10142730 Ga0207691_101427302 214
274 3300025941 Ga0207711_10476530 Ga0207711_104765302 214
275 3300025942 Ga0207689_10319412 Ga0207689_103194122 214
276 3300025944 Ga0207661_10015309 Ga0207661_100153094 214
277 3300025945 Ga0207679_10026031 Ga0207679_100260313 214
278 3300025960 Ga0207651_10007776 Ga0207651_100077764 214
279 3300025972 Ga0207668_10036473 Ga0207668_100364733 214
280 3300025981 Ga0207640_10030714 Ga0207640_100307143 214
281 3300026023 Ga0207677_10022298 Ga0207677_100222984 214
282 3300026035 Ga0207703_10298610 Ga0207703_102986102 214
283 3300026075 Ga0207708_10098512 Ga0207708_100985122 214
284 3300026075 Ga0207708_10460169 Ga0207708_104601692 214
285 3300026089 Ga0207648_10030972 Ga0207648_100309723 214
286 3300026089 Ga0207648_10079551 Ga0207648_100795513 214
287 3300026095 Ga0207676_10033534 Ga0207676_100335343 214
288 3300026116 Ga0207674_10039716 Ga0207674_100397163 214
289 3300026118 Ga0207675_100015862 Ga0207675_1000158625 214
290 3300026121 Ga0207683_10000544 Ga0207683_1000054415 214
291 3300026121 Ga0207683_10029595 Ga0207683_100295954 214
292 3300026142 Ga0207698_10000379 Ga0207698_1000037925 214
293 3300026142 Ga0207698_10070389 Ga0207698_100703894 214
294 3300027907 Ga0207428_10092290 Ga0207428_100922903 214
295 3300028379 Ga0268266_10437907 Ga0268266_104379071 214
296 3300028380 Ga0268265_10057759 Ga0268265_100577593 214
297 3300031250 Ga0265331_10103858 Ga0265331_101038582 214
298 3300045051 Ga0451576_0281564 Ga0451576_0281564_600_1253 214
299 3300046530 Ga0495654_0133944 Ga0495654_0133944_99_752 214
300 3300046537 Ga0495598_0008804 Ga0495598_0008804_732_1385 214
301 3300046539 Ga0495621_0073599 Ga0495621_0073599_585_1238 214
302 3300048908 Ga0496105_0590090 Ga0496105_0590090_35_688 214
303 3300048911 Ga0496108_0010236 Ga0496108_0010236_6923_7576 214
304 3300048912 Ga0496109_0005148 Ga0496109_0005148_1474_2127 214
305 3300048913 Ga0496110_0022876 Ga0496110_0022876_1974_2627 214
306 3300048917 Ga0496114_0040038 Ga0496114_0040038_962_1615 214
307 3300050511 nmdc:mga08y16_371590_c1 nmdc:mga08y16_371590_c1_564_1217 214
308 3300005614 Ga0068856_100046756 Ga0068856_1000467566 215
309 3300049569 Ga0501032_0001373 Ga0501032_0001373_18035_18682 215
310 3300049569 Ga0501032_0063460 Ga0501032_0063460_354_1001 215
311 3300049569 Ga0501032_0132413 Ga0501032_0132413_184_831 215
312 3300049570 Ga0501033_0001864 Ga0501033_0001864_15267_15914 215
313 3300049570 Ga0501033_0091461 Ga0501033_0091461_1147_1794 215
314 3300049571 Ga0501034_0011029 Ga0501034_0011029_6171_6818 215
315 3300049572 Ga0501036_0001661 Ga0501036_0001661_14991_15638 215
316 3300049572 Ga0501036_0065391 Ga0501036_0065391_637_1284 215
317 3300049573 Ga0501037_0000474 Ga0501037_0000474_30762_31409 215
318 3300049574 Ga0501038_0006477 Ga0501038_0006477_1147_1794 215
319 3300049574 Ga0501038_0029427 Ga0501038_0029427_1783_2430 215
320 3300049575 Ga0501039_0054337 Ga0501039_0054337_2117_2764 215
321 3300049575 Ga0501039_0103243 Ga0501039_0103243_432_1079 215
322 3300049576 Ga0501040_0000260 Ga0501040_0000260_29398_30045 215
323 3300049578 Ga0501042_0005609 Ga0501042_0005609_6299_6946 215
324 3300049579 Ga0501043_0005740 Ga0501043_0005740_2339_2986 215
325 3300049579 Ga0501043_0141690 Ga0501043_0141690_764_1411 215
326 3300049579 Ga0501043_0194914 Ga0501043_0194914_760_1407 215
327 3300049580 Ga0501046_0002898 Ga0501046_0002898_1119_1766 215
328 3300049580 Ga0501046_0165334 Ga0501046_0165334_871_1518 215
329 3300049581 Ga0501047_0095380 Ga0501047_0095380_1147_1794 215
330 3300049582 Ga0501048_0002369 Ga0501048_0002369_5720_6367 215
331 3300049584 Ga0501068_0001753 Ga0501068_0001753_9031_9678 215
332 3300049586 Ga0501070_0051509 Ga0501070_0051509_255_902 215
333 3300049822 Ga0501035_0001968 Ga0501035_0001968_18449_19096 215
334 3300049822 Ga0501035_0086085 Ga0501035_0086085_1263_1910 215
335 3300049822 Ga0501035_0144625 Ga0501035_0144625_560_1207 215
336 3300049823 Ga0501044_0014044 Ga0501044_0014044_6854_7501 215
337 3300049823 Ga0501044_0452648 Ga0501044_0452648_416_1063 215
338 3300049824 Ga0501045_0003520 Ga0501045_0003520_7519_8166 215
339 3300020070 Ga0206356_10645588 Ga0206356_106455882 220
340 3300005563 Ga0068855_100014417 Ga0068855_1000144173 221
341 3300009093 Ga0105240_10005084 Ga0105240_100050844 221
342 3300025913 Ga0207695_10006155 Ga0207695_100061552 221
343 3300025949 Ga0207667_10002749 Ga0207667_100027492 221
344 3300027695 Ga0209966_1021780 Ga0209966_10217803 223
345 3300045051 Ga0451576_1171896 Ga0451576_1171896_60_737 224
346 3300005290 Ga0065712_10097950 Ga0065712_100979503 225
347 3300005333 Ga0070677_10206312 Ga0070677_102063121 225
348 3300005338 Ga0068868_100166419 Ga0068868_1001664192 225
349 3300005340 Ga0070689_100035273 Ga0070689_1000352733 225
350 3300005340 Ga0070689_100061893 Ga0070689_1000618932 225
351 3300005340 Ga0070689_100687036 Ga0070689_1006870361 225
352 3300005344 Ga0070661_100312983 Ga0070661_1003129832 225
353 3300005354 Ga0070675_100117917 Ga0070675_1001179172 225
354 3300005364 Ga0070673_100080904 Ga0070673_1000809043 225
355 3300005365 Ga0070688_100092235 Ga0070688_1000922353 225
356 3300005365 Ga0070688_100231016 Ga0070688_1002310162 225
357 3300005535 Ga0070684_100053863 Ga0070684_1000538633 225
358 3300005539 Ga0068853_100133788 Ga0068853_1001337881 225
359 3300005547 Ga0070693_100038548 Ga0070693_1000385483 225
360 3300005563 Ga0068855_100021177 Ga0068855_1000211772 225
361 3300005564 Ga0070664_100737965 Ga0070664_1007379651 225
362 3300005614 Ga0068856_100036980 Ga0068856_1000369803 225
363 3300005617 Ga0068859_100117342 Ga0068859_1001173422 225
364 3300005617 Ga0068859_100232332 Ga0068859_1002323322 225
365 3300005618 Ga0068864_100684376 Ga0068864_1006843761 225
366 3300005842 Ga0068858_100004362 Ga0068858_1000043625 225
367 3300006163 Ga0070715_10180266 Ga0070715_101802662 225
368 3300006237 Ga0097621_100012861 Ga0097621_1000128615 225
369 3300006237 Ga0097621_100028204 Ga0097621_1000282044 225
370 3300006358 Ga0068871_100315425 Ga0068871_1003154252 225
371 3300006881 Ga0068865_100052673 Ga0068865_1000526732 225
372 3300006931 Ga0097620_100117354 Ga0097620_1001173542 225
373 3300006931 Ga0097620_100232341 Ga0097620_1002323412 225
374 3300007076 Ga0075435_100386250 Ga0075435_1003862502 225
375 3300009098 Ga0105245_10034084 Ga0105245_100340842 225
376 3300009098 Ga0105245_10069370 Ga0105245_100693704 225
377 3300009147 Ga0114129_10353166 Ga0114129_103531662 225
378 3300009148 Ga0105243_10117965 Ga0105243_101179652 225
379 3300009174 Ga0105241_10049524 Ga0105241_100495243 225
380 3300009176 Ga0105242_10179412 Ga0105242_101794122 225
381 3300009177 Ga0105248_10037647 Ga0105248_100376472 225
382 3300009551 Ga0105238_10041767 Ga0105238_100417672 225
383 3300010375 Ga0105239_10424671 Ga0105239_104246712 225
384 3300013100 Ga0157373_10354670 Ga0157373_103546702 225
385 3300013104 Ga0157370_10240887 Ga0157370_102408873 225
386 3300013105 Ga0157369_10145233 Ga0157369_101452332 225
387 3300013297 Ga0157378_10061440 Ga0157378_100614404 225
388 3300013297 Ga0157378_10308294 Ga0157378_103082942 225
389 3300013306 Ga0163162_10096431 Ga0163162_100964312 225
390 3300013306 Ga0163162_10120785 Ga0163162_101207852 225
391 3300013307 Ga0157372_10081701 Ga0157372_100817013 225
392 3300013308 Ga0157375_10155870 Ga0157375_101558702 225
393 3300014745 Ga0157377_10047216 Ga0157377_100472162 225
394 3300014968 Ga0157379_10057965 Ga0157379_100579652 225
395 3300014969 Ga0157376_10030341 Ga0157376_100303413 225
396 3300014969 Ga0157376_10609658 Ga0157376_106096582 225
397 3300025905 Ga0207685_10180930 Ga0207685_101809302 225
398 3300025909 Ga0207705_10116052 Ga0207705_101160522 225
399 3300025911 Ga0207654_10050254 Ga0207654_100502543 225
400 3300025917 Ga0207660_10226012 Ga0207660_102260122 225
401 3300025920 Ga0207649_10252842 Ga0207649_102528422 225
402 3300025926 Ga0207659_10083150 Ga0207659_100831503 225
403 3300025927 Ga0207687_10048878 Ga0207687_100488782 225
404 3300025927 Ga0207687_10096153 Ga0207687_100961532 225
405 3300025934 Ga0207686_10143145 Ga0207686_101431452 225
406 3300025935 Ga0207709_10240662 Ga0207709_102406622 225
407 3300025936 Ga0207670_10012370 Ga0207670_100123703 225
408 3300025936 Ga0207670_10064301 Ga0207670_100643013 225
409 3300025936 Ga0207670_10193311 Ga0207670_101933113 225
410 3300025944 Ga0207661_10156055 Ga0207661_101560552 225
411 3300025945 Ga0207679_10556518 Ga0207679_105565182 225
412 3300025949 Ga0207667_10031384 Ga0207667_100313844 225
413 3300025949 Ga0207667_10065744 Ga0207667_100657442 225
414 3300025960 Ga0207651_10104329 Ga0207651_101043292 225
415 3300026023 Ga0207677_10164536 Ga0207677_101645362 225
416 3300026095 Ga0207676_10090372 Ga0207676_100903722 225
417 3300026116 Ga0207674_10074117 Ga0207674_100741173 225
418 3300026142 Ga0207698_10224260 Ga0207698_102242602 225
419 3300026142 Ga0207698_10270298 Ga0207698_102702982 225
420 3300029957 Ga0265324_10000018 Ga0265324_10000018105 225
421 3300031241 Ga0265325_10000035 Ga0265325_1000003554 225
422 3300031711 Ga0265314_10062888 Ga0265314_100628883 225
423 3300035410 Ga0373924_0094118 Ga0373924_0094118_290_967 225
424 3300036401 Ga0373937_0115881 Ga0373937_0115881_839_1516 225
425 3300042876 Ga0451577_0000002 Ga0451577_0000002_1621946_1622623 225
426 3300042876 Ga0451577_0007738 Ga0451577_0007738_5906_6589 225
427 3300042876 Ga0451577_0016080 Ga0451577_0016080_4316_4999 225
428 3300044673 Ga0453683_0000013 Ga0453683_0000013_262503_263180 225
429 3300044673 Ga0453683_0215180 Ga0453683_0215180_376_1059 225
430 3300044712 Ga0453684_0000002 Ga0453684_0000002_108753_109430 225
431 3300044712 Ga0453684_0016594 Ga0453684_0016594_3619_4302 225
432 3300045051 Ga0451576_0000037 Ga0451576_0000037_262744_263421 225
433 3300045051 Ga0451576_0000320 Ga0451576_0000320_51378_52061 225
434 3300045051 Ga0451576_0003253 Ga0451576_0003253_3742_4425 225
435 3300045051 Ga0451576_0073619 Ga0451576_0073619_1647_2330 225
436 3300046454 Ga0495592_0005543 Ga0495592_0005543_550_1227 225
437 3300046462 Ga0495651_0120351 Ga0495651_0120351_151_828 225
438 3300046477 Ga0495664_0131208 Ga0495664_0131208_272_949 225
439 3300046511 Ga0495608_0102668 Ga0495608_0102668_170_847 225
440 3300046529 Ga0495652_0181589 Ga0495652_0181589_272_949 225
441 3300046663 Ga0495635_0231717 Ga0495635_0231717_474_1151 225
442 3300046675 Ga0495657_0124307 Ga0495657_0124307_798_1475 225
443 3300046678 Ga0495599_0037179 Ga0495599_0037179_1430_2107 225
444 3300047317 Ga0495604_0060002 Ga0495604_0060002_1337_2014 225
445 3300047322 Ga0495680_0084439 Ga0495680_0084439_446_1123 225
446 3300047471 Ga0495684_0104193 Ga0495684_0104193_180_857 225
447 3300049571 Ga0501034_0173751 Ga0501034_0173751_643_1332 225
448 3300049581 Ga0501047_0004440 Ga0501047_0004440_2574_3263 225
449 3300049583 Ga0501067_0017247 Ga0501067_0017247_770_1459 225
450 3300049585 Ga0501069_0001227 Ga0501069_0001227_2827_3516 225
451 3300049586 Ga0501070_0001841 Ga0501070_0001841_3049_3738 225
452 3300049589 Ga0501073_0000127 Ga0501073_0000127_23828_24517 225
453 3300049590 Ga0501074_0087485 Ga0501074_0087485_1186_1875 225
454 3300049741 Ga0501079_0008772 Ga0501079_0008772_5571_6260 225
455 3300049742 Ga0501080_0007745 Ga0501080_0007745_6101_6790 225
456 3300049744 Ga0501083_0003616 Ga0501083_0003616_3822_4511 225
457 3300050512 nmdc:mga0n895_703332_c1 nmdc:mga0n895_703332_c1_39_812 225
458 3300054114 Ga0501084_0115185 Ga0501084_0115185_1129_1818 225
459 3300060353 Ga0501082_0075305 Ga0501082_0075305_1350_2039 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

78

212

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9804 16 224
6tak-assembly1.cif.gz_BBB crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9783 15 224
6tak-assembly1.cif.gz_AAA crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid and sulfate at 1.25 angstrom resolution 0.9728 15 224
6taj-assembly1.cif.gz_AAA-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9645 16 224
6taj-assembly2.cif.gz_BBB-2 crystal structure of escherichia coli orotate phosphoribosyltransferase in complex with orotic acid 1.60 angstrom resolution 0.9614 16 224
ID Description Score Start End Superfamily
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9468 15 203 3.40.50.2020
af_O94331_1_215_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9287 16 225 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9255 19 224 3.40.50.2020
3n2lH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9253 15 203 3.40.50.2020
3mjdC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9168 19 224 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3S4J5G6-F1-model_v4 Orotate phosphoribosyltransferase (OPRT) (OPRTase) (EC 2.4.2.10) 0.9847 15 206 GO:0000287
GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A4Z0P938-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9834 59 224 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A522DMB7-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.9832 15 189 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A258SMY8-F1-model_v4 orotate phosphoribosyltransferase (EC 2.4.2.10) 0.983 13 201 GO:0004588
GO:0005737
GO:0006207
GO:0044205
GO:0046132
AF-A0A1W9F1Q8-F1-model_v4 deleted 0.9827 63 224

Feature Viewer

pLDDT pTM Quality
89.12 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map