F448457

General Info

Members Datasets Scaffolds Average Seq Length
459 245 457 191

Family's Representative Sequence

Representative Sequence 3300053151|Ga0500604_0007649|Ga0500604_0007649_1428_2075
Length 215
Sequence LLSDFLSSGLPDFFPFFAAYFSNMSFHPGNKILIITAPSGAGKTSITRYLLHHIPHLAFSVSAATRPARSNEKDGADYYFMSVEDFQQKIRDQQFVEWEMVYEGKYYGTLKSELERIWGNNQVPVLDIDVKGAIHVQQQYPNSTLSVFIEPPSVDELKRRLESRGTETVESLQARVNKASYEISFKHHFHKIVVNAQLDNARQEAMGIVRDFLEI

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
153 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
203 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
220 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
237 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 2.83
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10007689 3300003320 Bacteria 4712
2 rootH1_10034436 3300003323 Bacteria 2796
3 rootH1_10038994 3300003323 Bacteria 6132
4 rootH1_10080440 3300003323 Bacteria 2439
5 rootH1_10268523 3300003323 Bacteria 1188
6 JGI25160J50197_1006321 3300003354 Bacteria 4811
7 Ga0070658_10003474 3300005327 Bacteria 12943
8 Ga0070658_10164026 3300005327 Unclassified 1865
9 Ga0070676_10001696 3300005328 Bacteria 11204
10 Ga0070683_100003276 3300005329 Bacteria 13091
11 Ga0070683_101345009 3300005329 Unclassified 686
12 Ga0070690_100101385 3300005330 Unclassified 1909
13 Ga0070670_100128635 3300005331 Bacteria 2186
14 Ga0068869_100061326 3300005334 Bacteria 2758
15 Ga0068869_100220672 3300005334 Bacteria 1502
16 Ga0070666_10000106 3300005335 Bacteria 57218
17 Ga0070666_10000512 3300005335 Bacteria 23407
18 Ga0070666_10029648 3300005335 Bacteria 3599
19 Ga0070666_10042943 3300005335 Bacteria 3026
20 Ga0070680_100003766 3300005336 Bacteria 11335
21 Ga0070682_100004598 3300005337 Bacteria 7675
22 Ga0068868_100025507 3300005338 Bacteria 4497
23 Ga0070660_100435085 3300005339 Bacteria 1087
24 Ga0070691_10003938 3300005341 Bacteria 6717
25 Ga0070661_100099803 3300005344 Bacteria 2158
26 Ga0070661_100153081 3300005344 Bacteria 1744
27 Ga0070661_100490963 3300005344 Bacteria 982
28 Ga0070668_100000736 3300005347 Bacteria 22377
29 Ga0070668_100051737 3300005347 Bacteria 3166
30 Ga0070669_100027597 3300005353 Bacteria 4086
31 Ga0070669_100744546 3300005353 Unclassified 830
32 Ga0070675_100036394 3300005354 Bacteria 4005
33 Ga0070675_100056981 3300005354 Bacteria 3221
34 Ga0070675_100434758 3300005354 Bacteria 1175
35 Ga0070671_100002092 3300005355 Bacteria 15374
36 Ga0070671_100111788 3300005355 Bacteria 2295
37 Ga0070671_100386872 3300005355 Unclassified 1196
38 Ga0070674_100157577 3300005356 Bacteria 1719
39 Ga0070673_101195159 3300005364 Bacteria 712
40 Ga0070667_100002471 3300005367 Bacteria 16141
41 Ga0070667_100005817 3300005367 Bacteria 10284
42 Ga0070667_100007281 3300005367 Bacteria 9199
43 Ga0070667_100010282 3300005367 Bacteria 7732
44 Ga0070667_100028015 3300005367 Bacteria 4688
45 Ga0070667_100928834 3300005367 Bacteria 810
46 Ga0070663_100046671 3300005455 Bacteria 3066
47 Ga0070678_100004465 3300005456 Bacteria 7937
48 Ga0070678_100026987 3300005456 Bacteria 3892
49 Ga0070678_100111122 3300005456 Bacteria 2144
50 Ga0070678_100190735 3300005456 Bacteria 1685
51 Ga0070662_100004296 3300005457 Bacteria 8997
52 Ga0070681_10018595 3300005458 Bacteria 6948
53 Ga0068867_100000714 3300005459 Bacteria 22153
54 Ga0068867_100026214 3300005459 Bacteria 4185
55 Ga0068867_100128693 3300005459 Bacteria 1965
56 Ga0070685_10108565 3300005466 Bacteria 1706
57 Ga0070685_10333788 3300005466 Bacteria 1032
58 Ga0070679_100009921 3300005530 Bacteria 9013
59 Ga0070684_100017174 3300005535 Bacteria 5932
60 Ga0068853_100005833 3300005539 Bacteria 9700
61 Ga0068853_100012394 3300005539 Bacteria 6936
62 Ga0068853_100024271 3300005539 Bacteria 5082
63 Ga0068853_100091011 3300005539 Bacteria 2682
64 Ga0068853_100307747 3300005539 Bacteria 1466
65 Ga0068853_100847533 3300005539 Bacteria 877
66 Ga0070672_100002623 3300005543 Bacteria 11495
67 Ga0070672_100058102 3300005543 Bacteria 3039
68 Ga0070672_100393319 3300005543 Bacteria 1187
69 Ga0070693_100097159 3300005547 Bacteria 1787
70 Ga0070665_100003228 3300005548 Bacteria 17524
71 Ga0070665_100335587 3300005548 Bacteria 1516
72 Ga0068855_100007850 3300005563 Bacteria 12895
73 Ga0068855_100019922 3300005563 Bacteria 8056
74 Ga0068855_100534131 3300005563 Bacteria 1271
75 Ga0070664_100003769 3300005564 Bacteria 12229
76 Ga0070664_100399060 3300005564 Unclassified 1257
77 Ga0070664_100636075 3300005564 Bacteria 991
78 Ga0068854_100018687 3300005578 Bacteria 4657
79 Ga0068856_100010180 3300005614 Bacteria 9141
80 Ga0068852_100019832 3300005616 Bacteria 5333
81 Ga0068852_100035961 3300005616 Bacteria 4139
82 Ga0068859_100000024 3300005617 Bacteria 217931
83 Ga0068859_100017290 3300005617 Bacteria 7242
84 Ga0068859_100065456 3300005617 Bacteria 3669
85 Ga0068864_100001230 3300005618 Bacteria 21292
86 Ga0068864_100001831 3300005618 Bacteria 17477
87 Ga0068866_10003519 3300005718 Bacteria 6412
88 Ga0068866_10203934 3300005718 Bacteria 1183
89 Ga0068861_100005410 3300005719 Bacteria 8641
90 Ga0068861_100077368 3300005719 Bacteria 2595
91 Ga0068861_100421237 3300005719 Bacteria 1190
92 Ga0068851_10002002 3300005834 Bacteria 8977
93 Ga0068851_10028768 3300005834 Bacteria 2746
94 Ga0068851_10031645 3300005834 Bacteria 2629
95 Ga0068851_10041068 3300005834 Unclassified 2326
96 Ga0068863_100008315 3300005841 Bacteria 10139
97 Ga0068863_100086419 3300005841 Bacteria 2972
98 Ga0068863_100170219 3300005841 Bacteria 2089
99 Ga0068863_100580775 3300005841 Bacteria 1108
100 Ga0068863_100901488 3300005841 Bacteria 884
101 Ga0068858_100004188 3300005842 Bacteria 14197
102 Ga0068858_100007223 3300005842 Bacteria 10769
103 Ga0068858_100253594 3300005842 Unclassified 1672
104 Ga0068858_100474619 3300005842 Bacteria 1207
105 Ga0068860_100008392 3300005843 Bacteria 10290
106 Ga0068860_100010197 3300005843 Bacteria 9298
107 Ga0068860_100023088 3300005843 Bacteria 6015
108 Ga0068860_100201927 3300005843 Bacteria 1927
109 Ga0068860_100300636 3300005843 Bacteria 1572
110 Ga0068862_100148158 3300005844 Bacteria 2087
111 Ga0068862_100273403 3300005844 Bacteria 1546
112 Ga0081539_10109666 3300005985 Bacteria 1392
113 Ga0070715_10510417 3300006163 Bacteria 690
114 Ga0075366_10078330 3300006195 Bacteria 1973
115 Ga0075366_10091829 3300006195 Bacteria 1819
116 Ga0097621_100000710 3300006237 Bacteria 23372
117 Ga0097621_100002889 3300006237 Bacteria 11798
118 Ga0097621_100234657 3300006237 Bacteria 1602
119 Ga0097621_100415525 3300006237 Bacteria 1206
120 Ga0097621_100932085 3300006237 Unclassified 810
121 Ga0068871_100000044 3300006358 Bacteria 67105
122 Ga0068871_100007603 3300006358 Bacteria 7749
123 Ga0068871_100048966 3300006358 Bacteria 3414
124 Ga0068871_100198191 3300006358 Bacteria 1732
125 Ga0075431_100003874 3300006847 Bacteria 14558
126 Ga0075429_100027989 3300006880 Bacteria 4892
127 Ga0068865_100001459 3300006881 Bacteria 13774
128 Ga0068865_100068544 3300006881 Bacteria 2508
129 Ga0097620_100000024 3300006931 Bacteria 217931
130 Ga0097620_100017290 3300006931 Bacteria 7242
131 Ga0097620_100065458 3300006931 Bacteria 3669
132 Ga0105245_10092839 3300009098 Bacteria 2780
133 Ga0105245_10155713 3300009098 Bacteria 2164
134 Ga0105245_10239636 3300009098 Bacteria 1757
135 Ga0105247_10007693 3300009101 Bacteria 6592
136 Ga0114129_10073460 3300009147 Bacteria 4765
137 Ga0105243_10081324 3300009148 Bacteria 2645
138 Ga0105241_10001644 3300009174 Bacteria 17039
139 Ga0105241_10002574 3300009174 Bacteria 13610
140 Ga0105241_10070682 3300009174 Bacteria 2709
141 Ga0105241_10270735 3300009174 Bacteria 1447
142 Ga0105241_10400273 3300009174 Bacteria 1204
143 Ga0105241_10526233 3300009174 Bacteria 1058
144 Ga0105242_10006891 3300009176 Bacteria 8765
145 Ga0105242_10030450 3300009176 Bacteria 4308
146 Ga0105242_10119571 3300009176 Bacteria 2258
147 Ga0105248_10012448 3300009177 Bacteria 9383
148 Ga0105248_10054510 3300009177 Bacteria 4484
149 Ga0105237_10001996 3300009545 Bacteria 25965
150 Ga0105237_10009448 3300009545 Bacteria 10446
151 Ga0105237_10044812 3300009545 Bacteria 4453
152 Ga0105237_10131727 3300009545 Bacteria 2495
153 Ga0105237_10709353 3300009545 Bacteria 1012
154 Ga0105238_10152398 3300009551 Bacteria 2287
155 Ga0105238_10583909 3300009551 Bacteria 1124
156 Ga0105249_10000933 3300009553 Bacteria 25831
157 Ga0105249_10003142 3300009553 Bacteria 14284
158 Ga0105249_10014650 3300009553 Bacteria 6931
159 Ga0105239_10000992 3300010375 Bacteria 39769
160 Ga0105239_10159946 3300010375 Unclassified 2516
161 Ga0105239_10482372 3300010375 Bacteria 1408
162 Ga0105246_10044951 3300011119 Bacteria 3005
163 Ga0105246_10057737 3300011119 Bacteria 2686
164 Ga0157371_10051433 3300013102 Bacteria 2927
165 Ga0157370_10016240 3300013104 Bacteria 7544
166 Ga0157370_10462126 3300013104 Unclassified 1166
167 Ga0157369_10316865 3300013105 Bacteria 1621
168 Ga0157369_10334217 3300013105 Unclassified 1574
169 Ga0157374_10008783 3300013296 Bacteria 8646
170 Ga0157374_10009525 3300013296 Bacteria 8340
171 Ga0157374_10010368 3300013296 Bacteria 8017
172 Ga0157374_10077817 3300013296 Bacteria 3140
173 Ga0157374_10115500 3300013296 Bacteria 2585
174 Ga0157374_10356803 3300013296 Bacteria 1453
175 Ga0157374_10778273 3300013296 Unclassified 972
176 Ga0157378_10006732 3300013297 Bacteria 10038
177 Ga0157378_10048875 3300013297 Bacteria 3762
178 Ga0157378_10402125 3300013297 Bacteria 1350
179 Ga0157378_10588159 3300013297 Unclassified 1123
180 Ga0163162_10000154 3300013306 Bacteria 63581
181 Ga0163162_10000189 3300013306 Bacteria 56954
182 Ga0163162_10001132 3300013306 Bacteria 24804
183 Ga0163162_10002095 3300013306 Bacteria 18722
184 Ga0163162_10004949 3300013306 Bacteria 12838
185 Ga0163162_10246775 3300013306 Bacteria 1917
186 Ga0163162_10358338 3300013306 Bacteria 1591
187 Ga0157372_10117976 3300013307 Bacteria 3044
188 Ga0157372_10247640 3300013307 Unclassified 2068
189 Ga0157372_10569581 3300013307 Unclassified 1320
190 Ga0157372_10785080 3300013307 Bacteria 1107
191 Ga0157372_10934722 3300013307 Bacteria 1005
192 Ga0157372_11021852 3300013307 Unclassified 957
193 Ga0157372_11192069 3300013307 Bacteria 880
194 Ga0157375_10000850 3300013308 Bacteria 26585
195 Ga0157375_10009197 3300013308 Bacteria 8663
196 Ga0157375_10080273 3300013308 Bacteria 3299
197 Ga0157375_10470362 3300013308 Unclassified 1422
198 Ga0157375_10585657 3300013308 Bacteria 1276
199 Ga0163163_10000526 3300014325 Bacteria 34147
200 Ga0163163_10000825 3300014325 Bacteria 26376
201 Ga0163163_10224719 3300014325 Bacteria 1926
202 Ga0163163_10636338 3300014325 Bacteria 1130
203 Ga0157377_10658657 3300014745 Bacteria 755
204 Ga0157379_10001164 3300014968 Bacteria 21405
205 Ga0157379_10021186 3300014968 Bacteria 5753
206 Ga0157379_10021636 3300014968 Bacteria 5695
207 Ga0157379_10024504 3300014968 Bacteria 5356
208 Ga0157376_10002615 3300014969 Bacteria 12238
209 Ga0157376_10005686 3300014969 Bacteria 8733
210 Ga0157376_10006269 3300014969 Bacteria 8391
211 Ga0157376_10037749 3300014969 Bacteria 3925
212 Ga0157376_10037759 3300014969 Bacteria 3925
213 Ga0157376_10382785 3300014969 Bacteria 1356
214 Ga0157376_10468506 3300014969 Unclassified 1232
215 Ga0157376_10600735 3300014969 Bacteria 1095
216 Ga0163161_10004121 3300017792 Bacteria 10167
217 Ga0163161_10024256 3300017792 Bacteria 4284
218 Ga0163161_10128621 3300017792 Bacteria 1909
219 Ga0207426_1000026 3300025302 Bacteria 515228
220 Ga0207697_10028687 3300025315 Bacteria 2277
221 Ga0207656_10000333 3300025321 Bacteria 16102
222 Ga0207656_10083830 3300025321 Unclassified 1437
223 Ga0207710_10069289 3300025900 Bacteria 1615
224 Ga0207680_10000024 3300025903 Bacteria 82106
225 Ga0207680_10000842 3300025903 Bacteria 14485
226 Ga0207680_10027392 3300025903 Bacteria 3173
227 Ga0207647_10049690 3300025904 Bacteria 2600
228 Ga0207685_10394224 3300025905 Unclassified 708
229 Ga0207645_10000529 3300025907 Bacteria 31798
230 Ga0207645_10001186 3300025907 Bacteria 21516
231 Ga0207705_10004061 3300025909 Bacteria 11108
232 Ga0207654_10001918 3300025911 Bacteria 10789
233 Ga0207654_10015340 3300025911 Bacteria 3974
234 Ga0207654_10214214 3300025911 Bacteria 1274
235 Ga0207654_10466844 3300025911 Bacteria 887
236 Ga0207707_10002007 3300025912 Bacteria 18473
237 Ga0207695_10159621 3300025913 Bacteria 2187
238 Ga0207671_10003098 3300025914 Bacteria 16923
239 Ga0207671_10074262 3300025914 Bacteria 2541
240 Ga0207660_10004373 3300025917 Bacteria 9214
241 Ga0207657_10473347 3300025919 Bacteria 982
242 Ga0207649_10063107 3300025920 Bacteria 2338
243 Ga0207652_10005638 3300025921 Bacteria 10157
244 Ga0207681_10037342 3300025923 Bacteria 3210
245 Ga0207650_10077961 3300025925 Bacteria 2506
246 Ga0207650_10202797 3300025925 Bacteria 1589
247 Ga0207659_10837358 3300025926 Unclassified 791
248 Ga0207687_10179900 3300025927 Bacteria 1637
249 Ga0207644_10001410 3300025931 Bacteria 15486
250 Ga0207644_10094683 3300025931 Bacteria 2232
251 Ga0207644_10570913 3300025931 Bacteria 937
252 Ga0207706_10005778 3300025933 Bacteria 11506
253 Ga0207706_10104562 3300025933 Bacteria 2491
254 Ga0207686_10150009 3300025934 Bacteria 1622
255 Ga0207669_10025948 3300025937 Bacteria 3178
256 Ga0207669_10264587 3300025937 Bacteria 1288
257 Ga0207704_10011871 3300025938 Bacteria 4306
258 Ga0207704_10098509 3300025938 Bacteria 1942
259 Ga0207691_10000753 3300025940 Bacteria 32051
260 Ga0207691_10044535 3300025940 Bacteria 4083
261 Ga0207711_10033774 3300025941 Bacteria 4331
262 Ga0207711_10152073 3300025941 Bacteria 2089
263 Ga0207689_10000610 3300025942 Bacteria 34220
264 Ga0207689_10005081 3300025942 Bacteria 11844
265 Ga0207689_10318527 3300025942 Bacteria 1290
266 Ga0207661_10049432 3300025944 Bacteria 3347
267 Ga0207679_10008503 3300025945 Bacteria 6540
268 Ga0207667_10000969 3300025949 Bacteria 36612
269 Ga0207667_10019262 3300025949 Bacteria 7626
270 Ga0207667_10474006 3300025949 Bacteria 1271
271 Ga0207651_10001159 3300025960 Bacteria 11779
272 Ga0207651_10024921 3300025960 Bacteria 3709
273 Ga0207712_10092963 3300025961 Bacteria 2224
274 Ga0207668_10000432 3300025972 Bacteria 26449
275 Ga0207668_10362154 3300025972 Bacteria 1215
276 Ga0207658_10005805 3300025986 Bacteria 8451
277 Ga0207658_10027634 3300025986 Bacteria 3989
278 Ga0207658_10064995 3300025986 Bacteria 2738
279 Ga0207658_10671114 3300025986 Bacteria 935
280 Ga0207677_10005458 3300026023 Bacteria 6903
281 Ga0207677_10012986 3300026023 Bacteria 4812
282 Ga0207677_10058222 3300026023 Unclassified 2659
283 Ga0207703_10007020 3300026035 Bacteria 8960
284 Ga0207703_10009215 3300026035 Bacteria 7765
285 Ga0207703_10364774 3300026035 Bacteria 1333
286 Ga0207703_10575451 3300026035 Bacteria 1064
287 Ga0207639_10015535 3300026041 Bacteria 5374
288 Ga0207639_10016010 3300026041 Bacteria 5296
289 Ga0207639_10018690 3300026041 Bacteria 4928
290 Ga0207639_10603221 3300026041 Bacteria 1013
291 Ga0207639_11138954 3300026041 Unclassified 732
292 Ga0207678_10186253 3300026067 Bacteria 1773
293 Ga0207702_10044031 3300026078 Bacteria 3750
294 Ga0207641_10000058 3300026088 Bacteria 166385
295 Ga0207641_10001804 3300026088 Bacteria 20592
296 Ga0207641_10065194 3300026088 Bacteria 3115
297 Ga0207641_10121212 3300026088 Bacteria 2334
298 Ga0207641_10224980 3300026088 Bacteria 1742
299 Ga0207648_10000768 3300026089 Bacteria 36105
300 Ga0207648_10010710 3300026089 Bacteria 8665
301 Ga0207648_10140605 3300026089 Bacteria 2127
302 Ga0207676_10003925 3300026095 Bacteria 10500
303 Ga0207676_10013525 3300026095 Bacteria 5859
304 Ga0207676_10130331 3300026095 Bacteria 2137
305 Ga0207676_10432676 3300026095 Bacteria 1237
306 Ga0207674_10335696 3300026116 Bacteria 1461
307 Ga0207675_100011765 3300026118 Bacteria 8180
308 Ga0207675_100013110 3300026118 Bacteria 7734
309 Ga0207675_100083159 3300026118 Bacteria 3002
310 Ga0207683_10006970 3300026121 Bacteria 9686
311 Ga0207683_10048330 3300026121 Bacteria 3726
312 Ga0207683_10159812 3300026121 Bacteria 2036
313 Ga0207698_10016413 3300026142 Bacteria 4990
314 Ga0207698_10203820 3300026142 Bacteria 1774
315 Ga0268266_10008598 3300028379 Bacteria 9068
316 Ga0268265_10135757 3300028380 Bacteria 2052
317 Ga0268265_10656624 3300028380 Bacteria 1009
318 Ga0268264_10001719 3300028381 Bacteria 20165
319 Ga0268264_10010498 3300028381 Bacteria 7654
320 Ga0268264_10064989 3300028381 Bacteria 3072
321 Ga0268264_10159874 3300028381 Bacteria 2028
322 Ga0268264_10968210 3300028381 Bacteria 856
323 Ga0265324_10019915 3300029957 Unclassified 2415
324 Ga0265327_10012985 3300031251 Bacteria 5569
325 Ga0265327_10147689 3300031251 Unclassified 1094
326 Ga0265316_10184551 3300031344 Unclassified 1552
327 Ga0307513_10341055 3300031456 Bacteria 1249
328 Ga0307509_10032036 3300031507 Bacteria 5796
329 Ga0307508_10006441 3300031616 Bacteria 11041
330 Ga0373939_0100039 3300035114 Bacteria 994
331 Ga0373935_0292865 3300035692 Bacteria 1149
332 Ga0373927_0399201 3300035695 Bacteria 907
333 Ga0373933_0264397 3300035724 Bacteria 1110
334 Ga0373937_0113259 3300036401 Bacteria 2524
335 Ga0373937_0333602 3300036401 Bacteria 1436
336 Ga0373925_0835810 3300037068 Bacteria 759
337 Ga0395900_0034798 3300037418 Bacteria 5189
338 Ga0395905_0024221 3300037471 Bacteria 5729
339 Ga0395905_0353062 3300037471 Bacteria 1363
340 Ga0451795_0815586 3300041456 Bacteria 804
341 Ga0451800_1215951 3300041459 Bacteria 873
342 Ga0451835_0207628 3300041492 Bacteria 942
343 Ga0451843_0938349 3300041509 Bacteria 642
344 Ga0451853_0142802 3300041512 Bacteria 937
345 Ga0451853_2676155 3300041512 Bacteria 812
346 Ga0451853_3913908 3300041512 Bacteria 1166
347 Ga0439457_001217 3300042014 Bacteria 7755
348 Ga0439457_017088 3300042014 Bacteria 1613
349 Ga0439462_0020479 3300042015 Bacteria 1725
350 Ga0466969_0000110 3300044656 Bacteria 43267
351 Ga0466972_0018056 3300044658 Bacteria 3528
352 Ga0466966_0000015 3300044684 Bacteria 127402
353 Ga0466961_0099886 3300044693 Bacteria 1829
354 Ga0466970_0268589 3300044765 Bacteria 958
355 Ga0466957_0002948 3300044842 Bacteria 9223
356 Ga0466957_0076974 3300044842 Bacteria 2072
357 Ga0466959_0000030 3300045049 Bacteria 111343
358 Ga0466959_0070395 3300045049 Bacteria 2534
359 Ga0495629_0400815 3300046459 Bacteria 932
360 Ga0495638_0093696 3300046460 Bacteria 1806
361 Ga0495638_0149971 3300046460 Bacteria 1353
362 Ga0495580_0031880 3300046472 Bacteria 3805
363 Ga0495582_0134190 3300046473 Bacteria 1400
364 Ga0495585_0030133 3300046492 Bacteria 3087
365 Ga0495630_0129527 3300046517 Bacteria 1916
366 Ga0495630_0623902 3300046517 Bacteria 826
367 Ga0495652_0058781 3300046529 Bacteria 3255
368 Ga0495586_0080928 3300046535 Bacteria 1785
369 Ga0495645_0488946 3300046543 Bacteria 771
370 Ga0495668_0000099 3300046616 Bacteria 137915
371 Ga0495668_0000780 3300046616 Bacteria 37096
372 Ga0495635_0087648 3300046663 Bacteria 2130
373 Ga0495647_0262502 3300046681 Bacteria 771
374 Ga0495658_0003256 3300046683 Bacteria 8075
375 Ga0495670_0101385 3300046691 Bacteria 1483
376 Ga0495604_0532829 3300047317 Unclassified 759
377 Ga0495672_0008967 3300047320 Bacteria 7303
378 Ga0495672_0084418 3300047320 Bacteria 1761
379 Ga0495684_0353866 3300047471 Bacteria 1042
380 Ga0496100_0011575 3300048903 Bacteria 5026
381 Ga0496101_0061705 3300048904 Bacteria 2723
382 Ga0496104_0299473 3300048907 Bacteria 1520
383 Ga0496105_0410811 3300048908 Unclassified 1073
384 Ga0496107_0136072 3300048910 Bacteria 1815
385 Ga0496108_0047780 3300048911 Bacteria 3578
386 Ga0496109_0027819 3300048912 Bacteria 5053
387 Ga0496110_0240396 3300048913 Bacteria 1648
388 Ga0496110_0343514 3300048913 Bacteria 1360
389 Ga0496113_0328645 3300048916 Bacteria 1226
390 Ga0496114_0205156 3300048917 Bacteria 1728
391 Ga0501034_0037741 3300049571 Bacteria 4893
392 Ga0501034_0128701 3300049571 Bacteria 2516
393 Ga0501034_0157155 3300049571 Bacteria 2247
394 Ga0501038_0018888 3300049574 Bacteria 6223
395 Ga0501039_0058411 3300049575 Bacteria 2988
396 Ga0501043_0006220 3300049579 Bacteria 9590
397 Ga0501043_0025387 3300049579 Bacteria 4649
398 Ga0501047_0016077 3300049581 Bacteria 7137
399 Ga0501047_0018155 3300049581 Bacteria 6741
400 Ga0501047_0898022 3300049581 Unclassified 699
401 Ga0501048_0350875 3300049582 Bacteria 1052
402 Ga0501067_0107938 3300049583 Bacteria 1547
403 Ga0501070_0094958 3300049586 Bacteria 2467
404 Ga0501073_0158861 3300049589 Bacteria 1566
405 Ga0501074_0099381 3300049590 Bacteria 2083
406 Ga0501198_002467 3300049649 Bacteria 2495
407 Ga0501201_000114 3300049651 Bacteria 6420
408 Ga0501202_000730 3300049652 Bacteria 4910
409 Ga0501206_009539 3300049653 Unclassified 1292
410 Ga0501217_004833 3300049661 Bacteria 2789
411 Ga0501222_000261 3300049662 Bacteria 8874
412 Ga0501223_000807 3300049663 Bacteria 7413
413 Ga0501235_000644 3300049669 Bacteria 7037
414 Ga0501240_004303 3300049673 Bacteria 1644
415 Ga0501243_003632 3300049675 Bacteria 2298
416 Ga0501249_055413 3300049679 Unclassified 914
417 Ga0501256_022533 3300049685 Unclassified 669
418 Ga0501257_010896 3300049686 Bacteria 2068
419 Ga0501259_000633 3300049688 Bacteria 5644
420 Ga0501261_003685 3300049690 Bacteria 1885
421 Ga0501221_000888 3300049704 Unclassified 4894
422 Ga0501221_092141 3300049704 Bacteria 742
423 Ga0501225_0001269 3300049705 Bacteria 7830
424 Ga0501234_002137 3300049707 Bacteria 3121
425 Ga0501245_017453 3300049708 Unclassified 1096
426 Ga0501080_0374983 3300049742 Bacteria 1282
427 Ga0501035_0024518 3300049822 Bacteria 5531
428 Ga0501035_0233042 3300049822 Bacteria 1569
429 Ga0501044_0008582 3300049823 Bacteria 11194
430 Ga0501044_0010033 3300049823 Bacteria 10291
431 Ga0501044_0036250 3300049823 Bacteria 5161
432 Ga0501212_003179 3300049851 Bacteria 2041
433 nmdc:mga0k408_202722_c1 3300050493 Bacteria 1184
434 nmdc:mga0k408_205608_c1 3300050493 Bacteria 1175
435 nmdc:mga05p37_1790_c1 3300050507 Bacteria 11844
436 nmdc:mga05p37_57831_c1 3300050507 Bacteria 4775
437 nmdc:mga09592_17724_c1 3300050508 Bacteria 5836
438 nmdc:mga06r32_8304_c1 3300050510 Bacteria 9348
439 Ga0495619_0185569 3300053085 Unclassified 1439
440 Ga0500644_0007112 3300053088 Bacteria 2900
441 Ga0500644_0049991 3300053088 Bacteria 1429
442 Ga0500646_0006663 3300053090 Bacteria 2938
443 Ga0500583_0000999 3300053092 Bacteria 8034
444 Ga0500641_0200881 3300053096 Unclassified 851
445 Ga0500650_0168316 3300053098 Bacteria 1008
446 Ga0500562_000013 3300053108 Bacteria 150003
447 Ga0500588_0075402 3300053146 Bacteria 1116
448 Ga0500589_004793 3300053147 Bacteria 5159
449 Ga0500604_0007649 3300053151 Bacteria 2864
450 Ga0500616_0049703 3300053153 Bacteria 2218
451 Ga0500622_0112036 3300053156 Bacteria 1332
452 Ga0500639_240685 3300053163 Bacteria 735
453 Ga0500645_014049 3300053730 Bacteria 2560
454 Ga0500645_028316 3300053730 Bacteria 1696
455 Ga0501084_0294059 3300054114 Bacteria 1371
456 Ga0500661_012725 3300055283 Bacteria 1518
457 Ga0501082_0152674 3300060353 Bacteria 2006

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0076974 Ga0466957_0076974_740_1309 175
2 3300005539 Ga0068853_100091011 Ga0068853_1000910112 181
3 3300013296 Ga0157374_10077817 Ga0157374_100778173 181
4 3300049571 Ga0501034_0037741 Ga0501034_0037741_2574_3149 181
5 3300049574 Ga0501038_0018888 Ga0501038_0018888_4792_5367 181
6 3300049575 Ga0501039_0058411 Ga0501039_0058411_942_1517 181
7 3300049579 Ga0501043_0025387 Ga0501043_0025387_2893_3468 181
8 3300049581 Ga0501047_0018155 Ga0501047_0018155_1471_2046 181
9 3300049822 Ga0501035_0024518 Ga0501035_0024518_1542_2117 181
10 3300049823 Ga0501044_0008582 Ga0501044_0008582_1746_2321 181
11 3300006195 Ga0075366_10078330 Ga0075366_100783302 183
12 3300050493 nmdc:mga0k408_202722_c1 nmdc:mga0k408_202722_c1_252_803 183
13 3300005331 Ga0070670_100128635 Ga0070670_1001286352 184
14 3300005354 Ga0070675_100434758 Ga0070675_1004347581 186
15 3300005985 Ga0081539_10109666 Ga0081539_101096662 186
16 3300025926 Ga0207659_10837358 Ga0207659_108373582 186
17 3300046616 Ga0495668_0000099 Ga0495668_0000099_45103_45666 186
18 3300049571 Ga0501034_0128701 Ga0501034_0128701_489_1055 186
19 3300049581 Ga0501047_0016077 Ga0501047_0016077_2662_3228 186
20 3300049823 Ga0501044_0010033 Ga0501044_0010033_2353_2919 186
21 iso_pu_bacteria 2738541278 2738725587 186
22 3300031507 Ga0307509_10032036 Ga0307509_100320362 187
23 3300041459 Ga0451800_1215951 Ga0451800_1215951_91_660 187
24 3300041492 Ga0451835_0207628 Ga0451835_0207628_230_799 187
25 3300041509 Ga0451843_0938349 Ga0451843_0938349_33_602 187
26 3300041512 Ga0451853_2676155 Ga0451853_2676155_80_649 187
27 3300044658 Ga0466972_0018056 Ga0466972_0018056_1370_1939 187
28 3300046460 Ga0495638_0149971 Ga0495638_0149971_508_1077 187
29 3300053092 Ga0500583_0000999 Ga0500583_0000999_2892_3461 187
30 3300053147 Ga0500589_004793 Ga0500589_004793_4285_4854 187
31 3300053156 Ga0500622_0112036 Ga0500622_0112036_292_861 187
32 3300005327 Ga0070658_10003474 Ga0070658_1000347410 188
33 3300005328 Ga0070676_10001696 Ga0070676_100016968 188
34 3300005330 Ga0070690_100101385 Ga0070690_1001013852 188
35 3300005334 Ga0068869_100061326 Ga0068869_1000613262 188
36 3300005335 Ga0070666_10000512 Ga0070666_100005126 188
37 3300005347 Ga0070668_100000736 Ga0070668_10000073615 188
38 3300005367 Ga0070667_100002471 Ga0070667_1000024719 188
39 3300005455 Ga0070663_100046671 Ga0070663_1000466712 188
40 3300005456 Ga0070678_100026987 Ga0070678_1000269874 188
41 3300005457 Ga0070662_100004296 Ga0070662_1000042968 188
42 3300005459 Ga0068867_100000714 Ga0068867_10000071411 188
43 3300005539 Ga0068853_100005833 Ga0068853_1000058339 188
44 3300005539 Ga0068853_100024271 Ga0068853_1000242717 188
45 3300005543 Ga0070672_100002623 Ga0070672_1000026238 188
46 3300005548 Ga0070665_100003228 Ga0070665_10000322814 188
47 3300005563 Ga0068855_100534131 Ga0068855_1005341312 188
48 3300005564 Ga0070664_100399060 Ga0070664_1003990602 188
49 3300005616 Ga0068852_100035961 Ga0068852_1000359612 188
50 3300005618 Ga0068864_100001831 Ga0068864_10000183115 188
51 3300005719 Ga0068861_100005410 Ga0068861_1000054105 188
52 3300005834 Ga0068851_10002002 Ga0068851_100020026 188
53 3300005834 Ga0068851_10028768 Ga0068851_100287682 188
54 3300005842 Ga0068858_100004188 Ga0068858_10000418811 188
55 3300005843 Ga0068860_100008392 Ga0068860_10000839210 188
56 3300006237 Ga0097621_100002889 Ga0097621_10000288911 188
57 3300006358 Ga0068871_100007603 Ga0068871_1000076039 188
58 3300006847 Ga0075431_100003874 Ga0075431_1000038749 188
59 3300006880 Ga0075429_100027989 Ga0075429_1000279897 188
60 3300006881 Ga0068865_100001459 Ga0068865_10000145910 188
61 3300009098 Ga0105245_10092839 Ga0105245_100928392 188
62 3300009147 Ga0114129_10073460 Ga0114129_100734602 188
63 3300009176 Ga0105242_10006891 Ga0105242_100068912 188
64 3300009177 Ga0105248_10054510 Ga0105248_100545105 188
65 3300009551 Ga0105238_10152398 Ga0105238_101523982 188
66 3300009553 Ga0105249_10014650 Ga0105249_100146502 188
67 3300010375 Ga0105239_10159946 Ga0105239_101599463 188
68 3300013296 Ga0157374_10009525 Ga0157374_100095255 188
69 3300013297 Ga0157378_10006732 Ga0157378_100067324 188
70 3300013297 Ga0157378_10588159 Ga0157378_105881592 188
71 3300013306 Ga0163162_10002095 Ga0163162_100020959 188
72 3300013307 Ga0157372_10247640 Ga0157372_102476402 188
73 3300013308 Ga0157375_10009197 Ga0157375_100091976 188
74 3300014325 Ga0163163_10000526 Ga0163163_1000052618 188
75 3300014968 Ga0157379_10001164 Ga0157379_1000116416 188
76 3300014969 Ga0157376_10006269 Ga0157376_100062697 188
77 3300017792 Ga0163161_10128621 Ga0163161_101286212 188
78 3300025315 Ga0207697_10028687 Ga0207697_100286873 188
79 3300025321 Ga0207656_10000333 Ga0207656_1000033314 188
80 3300025321 Ga0207656_10083830 Ga0207656_100838302 188
81 3300025903 Ga0207680_10000842 Ga0207680_1000084210 188
82 3300025904 Ga0207647_10049690 Ga0207647_100496902 188
83 3300025907 Ga0207645_10001186 Ga0207645_1000118620 188
84 3300025909 Ga0207705_10004061 Ga0207705_100040614 188
85 3300025927 Ga0207687_10179900 Ga0207687_101799001 188
86 3300025933 Ga0207706_10005778 Ga0207706_100057784 188
87 3300025934 Ga0207686_10150009 Ga0207686_101500092 188
88 3300025937 Ga0207669_10264587 Ga0207669_102645871 188
89 3300025938 Ga0207704_10011871 Ga0207704_100118712 188
90 3300025940 Ga0207691_10000753 Ga0207691_100007535 188
91 3300025941 Ga0207711_10033774 Ga0207711_100337742 188
92 3300025942 Ga0207689_10318527 Ga0207689_103185272 188
93 3300025949 Ga0207667_10474006 Ga0207667_104740061 188
94 3300025960 Ga0207651_10001159 Ga0207651_100011599 188
95 3300025961 Ga0207712_10092963 Ga0207712_100929632 188
96 3300025972 Ga0207668_10000432 Ga0207668_1000043214 188
97 3300025986 Ga0207658_10005805 Ga0207658_100058055 188
98 3300026035 Ga0207703_10007020 Ga0207703_100070206 188
99 3300026041 Ga0207639_10016010 Ga0207639_100160102 188
100 3300026041 Ga0207639_10018690 Ga0207639_100186906 188
101 3300026067 Ga0207678_10186253 Ga0207678_101862532 188
102 3300026088 Ga0207641_10001804 Ga0207641_1000180410 188
103 3300026089 Ga0207648_10000768 Ga0207648_1000076824 188
104 3300026095 Ga0207676_10003925 Ga0207676_100039258 188
105 3300026118 Ga0207675_100013110 Ga0207675_1000131104 188
106 3300026121 Ga0207683_10048330 Ga0207683_100483303 188
107 3300026142 Ga0207698_10016413 Ga0207698_100164133 188
108 3300028379 Ga0268266_10008598 Ga0268266_100085989 188
109 3300028380 Ga0268265_10656624 Ga0268265_106566242 188
110 3300028381 Ga0268264_10001719 Ga0268264_1000171914 188
111 3300037471 Ga0395905_0353062 Ga0395905_0353062_142_714 188
112 3300046460 Ga0495638_0093696 Ga0495638_0093696_255_821 188
113 3300047320 Ga0495672_0084418 Ga0495672_0084418_893_1465 188
114 3300048908 Ga0496105_0410811 Ga0496105_0410811_86_652 188
115 3300048910 Ga0496107_0136072 Ga0496107_0136072_492_1058 188
116 3300048911 Ga0496108_0047780 Ga0496108_0047780_2470_3036 188
117 3300048912 Ga0496109_0027819 Ga0496109_0027819_3690_4256 188
118 3300048913 Ga0496110_0240396 Ga0496110_0240396_476_1042 188
119 3300048916 Ga0496113_0328645 Ga0496113_0328645_587_1153 188
120 3300049679 Ga0501249_055413 Ga0501249_055413_175_747 188
121 3300049704 Ga0501221_092141 Ga0501221_092141_75_647 188
122 3300050507 nmdc:mga05p37_57831_c1 nmdc:mga05p37_57831_c1_1163_1735 188
123 3300050508 nmdc:mga09592_17724_c1 nmdc:mga09592_17724_c1_4315_4887 188
124 3300050510 nmdc:mga06r32_8304_c1 nmdc:mga06r32_8304_c1_7529_8101 188
125 3300053090 Ga0500646_0006663 Ga0500646_0006663_2092_2661 188
126 3300053096 Ga0500641_0200881 Ga0500641_0200881_166_738 188
127 3300003323 rootH1_10038994 rootH1_100389947 189
128 3300005329 Ga0070683_100003276 Ga0070683_1000032767 189
129 3300005329 Ga0070683_101345009 Ga0070683_1013450091 189
130 3300005344 Ga0070661_100099803 Ga0070661_1000998032 189
131 3300005344 Ga0070661_100153081 Ga0070661_1001530812 189
132 3300005353 Ga0070669_100744546 Ga0070669_1007445461 189
133 3300005354 Ga0070675_100056981 Ga0070675_1000569812 189
134 3300005355 Ga0070671_100386872 Ga0070671_1003868721 189
135 3300005535 Ga0070684_100017174 Ga0070684_1000171742 189
136 3300005548 Ga0070665_100335587 Ga0070665_1003355872 189
137 3300005564 Ga0070664_100003769 Ga0070664_1000037698 189
138 3300005564 Ga0070664_100636075 Ga0070664_1006360752 189
139 3300005834 Ga0068851_10041068 Ga0068851_100410683 189
140 3300005841 Ga0068863_100901488 Ga0068863_1009014882 189
141 3300013296 Ga0157374_10356803 Ga0157374_103568031 189
142 3300013307 Ga0157372_10569581 Ga0157372_105695812 189
143 3300013308 Ga0157375_10470362 Ga0157375_104703622 189
144 3300014969 Ga0157376_10468506 Ga0157376_104685062 189
145 3300025920 Ga0207649_10063107 Ga0207649_100631072 189
146 3300025925 Ga0207650_10077961 Ga0207650_100779612 189
147 3300025931 Ga0207644_10570913 Ga0207644_105709132 189
148 3300025944 Ga0207661_10049432 Ga0207661_100494322 189
149 3300025945 Ga0207679_10008503 Ga0207679_100085033 189
150 3300026023 Ga0207677_10058222 Ga0207677_100582222 189
151 3300029957 Ga0265324_10019915 Ga0265324_100199152 189
152 3300031251 Ga0265327_10147689 Ga0265327_101476892 189
153 3300031344 Ga0265316_10184551 Ga0265316_101845512 189
154 3300031456 Ga0307513_10341055 Ga0307513_103410551 189
155 3300035692 Ga0373935_0292865 Ga0373935_0292865_49_624 189
156 3300035695 Ga0373927_0399201 Ga0373927_0399201_152_727 189
157 3300041456 Ga0451795_0815586 Ga0451795_0815586_66_641 189
158 3300041512 Ga0451853_0142802 Ga0451853_0142802_86_661 189
159 3300042014 Ga0439457_001217 Ga0439457_001217_1893_2468 189
160 3300042015 Ga0439462_0020479 Ga0439462_0020479_1130_1705 189
161 3300045049 Ga0466959_0070395 Ga0466959_0070395_210_785 189
162 3300049579 Ga0501043_0006220 Ga0501043_0006220_1334_1942 189
163 3300050507 nmdc:mga05p37_1790_c1 nmdc:mga05p37_1790_c1_7782_8357 189
164 3300053088 Ga0500644_0007112 Ga0500644_0007112_1479_2054 189
165 3300053088 Ga0500644_0049991 Ga0500644_0049991_650_1225 189
166 3300053098 Ga0500650_0168316 Ga0500650_0168316_237_812 189
167 3300053108 Ga0500562_000013 Ga0500562_000013_37038_37613 189
168 3300053146 Ga0500588_0075402 Ga0500588_0075402_145_720 189
169 3300053153 Ga0500616_0049703 Ga0500616_0049703_215_790 189
170 3300053163 Ga0500639_240685 Ga0500639_240685_145_720 189
171 3300055283 Ga0500661_012725 Ga0500661_012725_98_673 189
172 3300003323 rootH1_10080440 rootH1_100804402 190
173 3300003323 rootH1_10268523 rootH1_102685231 190
174 3300005327 Ga0070658_10164026 Ga0070658_101640262 190
175 3300005336 Ga0070680_100003766 Ga0070680_1000037669 190
176 3300005337 Ga0070682_100004598 Ga0070682_1000045982 190
177 3300005339 Ga0070660_100435085 Ga0070660_1004350852 190
178 3300005341 Ga0070691_10003938 Ga0070691_100039386 190
179 3300005458 Ga0070681_10018595 Ga0070681_100185952 190
180 3300005530 Ga0070679_100009921 Ga0070679_1000099214 190
181 3300005539 Ga0068853_100012394 Ga0068853_1000123947 190
182 3300005539 Ga0068853_100307747 Ga0068853_1003077472 190
183 3300005543 Ga0070672_100393319 Ga0070672_1003933192 190
184 3300005547 Ga0070693_100097159 Ga0070693_1000971592 190
185 3300005563 Ga0068855_100007850 Ga0068855_1000078502 190
186 3300005563 Ga0068855_100019922 Ga0068855_1000199222 190
187 3300005614 Ga0068856_100010180 Ga0068856_10001018010 190
188 3300005718 Ga0068866_10203934 Ga0068866_102039342 190
189 3300005719 Ga0068861_100077368 Ga0068861_1000773682 190
190 3300005841 Ga0068863_100170219 Ga0068863_1001702192 190
191 3300005843 Ga0068860_100300636 Ga0068860_1003006362 190
192 3300005844 Ga0068862_100148158 Ga0068862_1001481581 190
193 3300005844 Ga0068862_100273403 Ga0068862_1002734032 190
194 3300006195 Ga0075366_10091829 Ga0075366_100918292 190
195 3300006237 Ga0097621_100234657 Ga0097621_1002346572 190
196 3300006358 Ga0068871_100048966 Ga0068871_1000489663 190
197 3300009174 Ga0105241_10001644 Ga0105241_1000164410 190
198 3300009174 Ga0105241_10070682 Ga0105241_100706822 190
199 3300009174 Ga0105241_10270735 Ga0105241_102707352 190
200 3300009176 Ga0105242_10119571 Ga0105242_101195713 190
201 3300009545 Ga0105237_10009448 Ga0105237_100094483 190
202 3300009545 Ga0105237_10044812 Ga0105237_100448123 190
203 3300009545 Ga0105237_10131727 Ga0105237_101317273 190
204 3300009545 Ga0105237_10709353 Ga0105237_107093532 190
205 3300010375 Ga0105239_10000992 Ga0105239_1000099213 190
206 3300010375 Ga0105239_10482372 Ga0105239_104823721 190
207 3300013102 Ga0157371_10051433 Ga0157371_100514333 190
208 3300013104 Ga0157370_10016240 Ga0157370_100162407 190
209 3300013104 Ga0157370_10462126 Ga0157370_104621261 190
210 3300013105 Ga0157369_10316865 Ga0157369_103168652 190
211 3300013105 Ga0157369_10334217 Ga0157369_103342172 190
212 3300013306 Ga0163162_10001132 Ga0163162_1000113222 190
213 3300013307 Ga0157372_10117976 Ga0157372_101179762 190
214 3300013307 Ga0157372_10785080 Ga0157372_107850801 190
215 3300013307 Ga0157372_10934722 Ga0157372_109347221 190
216 3300013307 Ga0157372_11021852 Ga0157372_110218521 190
217 3300013307 Ga0157372_11192069 Ga0157372_111920691 190
218 3300014969 Ga0157376_10005686 Ga0157376_100056865 190
219 3300014969 Ga0157376_10037749 Ga0157376_100377492 190
220 3300014969 Ga0157376_10037759 Ga0157376_100377592 190
221 3300014969 Ga0157376_10382785 Ga0157376_103827851 190
222 3300025911 Ga0207654_10015340 Ga0207654_100153402 190
223 3300025911 Ga0207654_10214214 Ga0207654_102142142 190
224 3300025912 Ga0207707_10002007 Ga0207707_1000200713 190
225 3300025913 Ga0207695_10159621 Ga0207695_101596212 190
226 3300025914 Ga0207671_10074262 Ga0207671_100742622 190
227 3300025917 Ga0207660_10004373 Ga0207660_100043732 190
228 3300025919 Ga0207657_10473347 Ga0207657_104733472 190
229 3300025921 Ga0207652_10005638 Ga0207652_100056384 190
230 3300025949 Ga0207667_10000969 Ga0207667_100009692 190
231 3300025949 Ga0207667_10019262 Ga0207667_100192626 190
232 3300026041 Ga0207639_10015535 Ga0207639_100155355 190
233 3300026041 Ga0207639_10603221 Ga0207639_106032212 190
234 3300026078 Ga0207702_10044031 Ga0207702_100440312 190
235 3300026088 Ga0207641_10224980 Ga0207641_102249802 190
236 3300026116 Ga0207674_10335696 Ga0207674_103356961 190
237 3300026118 Ga0207675_100011765 Ga0207675_1000117653 190
238 3300028380 Ga0268265_10135757 Ga0268265_101357572 190
239 3300028381 Ga0268264_10064989 Ga0268264_100649892 190
240 3300031616 Ga0307508_10006441 Ga0307508_1000644110 190
241 3300035114 Ga0373939_0100039 Ga0373939_0100039_46_624 190
242 3300035724 Ga0373933_0264397 Ga0373933_0264397_504_1076 190
243 3300036401 Ga0373937_0113259 Ga0373937_0113259_731_1312 190
244 3300036401 Ga0373937_0333602 Ga0373937_0333602_173_745 190
245 3300037068 Ga0373925_0835810 Ga0373925_0835810_94_675 190
246 3300041512 Ga0451853_3913908 Ga0451853_3913908_120_698 190
247 3300042014 Ga0439457_017088 Ga0439457_017088_267_845 190
248 3300044656 Ga0466969_0000110 Ga0466969_0000110_39229_39807 190
249 3300044684 Ga0466966_0000015 Ga0466966_0000015_69893_70471 190
250 3300044693 Ga0466961_0099886 Ga0466961_0099886_170_748 190
251 3300044765 Ga0466970_0268589 Ga0466970_0268589_296_874 190
252 3300044842 Ga0466957_0002948 Ga0466957_0002948_3269_3847 190
253 3300045049 Ga0466959_0000030 Ga0466959_0000030_68228_68806 190
254 3300046459 Ga0495629_0400815 Ga0495629_0400815_43_624 190
255 3300046472 Ga0495580_0031880 Ga0495580_0031880_1252_1833 190
256 3300046473 Ga0495582_0134190 Ga0495582_0134190_186_767 190
257 3300046492 Ga0495585_0030133 Ga0495585_0030133_1045_1617 190
258 3300046517 Ga0495630_0623902 Ga0495630_0623902_235_816 190
259 3300046529 Ga0495652_0058781 Ga0495652_0058781_1203_1784 190
260 3300046535 Ga0495586_0080928 Ga0495586_0080928_1095_1676 190
261 3300046543 Ga0495645_0488946 Ga0495645_0488946_185_757 190
262 3300046616 Ga0495668_0000780 Ga0495668_0000780_24103_24681 190
263 3300046663 Ga0495635_0087648 Ga0495635_0087648_450_1031 190
264 3300046681 Ga0495647_0262502 Ga0495647_0262502_98_679 190
265 3300046683 Ga0495658_0003256 Ga0495658_0003256_6745_7326 190
266 3300046691 Ga0495670_0101385 Ga0495670_0101385_755_1327 190
267 3300047471 Ga0495684_0353866 Ga0495684_0353866_115_696 190
268 3300048907 Ga0496104_0299473 Ga0496104_0299473_919_1500 190
269 3300048917 Ga0496114_0205156 Ga0496114_0205156_394_966 190
270 3300049571 Ga0501034_0157155 Ga0501034_0157155_400_972 190
271 3300049581 Ga0501047_0898022 Ga0501047_0898022_48_620 190
272 3300049582 Ga0501048_0350875 Ga0501048_0350875_288_860 190
273 3300049583 Ga0501067_0107938 Ga0501067_0107938_50_622 190
274 3300049586 Ga0501070_0094958 Ga0501070_0094958_434_1006 190
275 3300049589 Ga0501073_0158861 Ga0501073_0158861_561_1133 190
276 3300049590 Ga0501074_0099381 Ga0501074_0099381_332_904 190
277 3300049649 Ga0501198_002467 Ga0501198_002467_73_651 190
278 3300049651 Ga0501201_000114 Ga0501201_000114_3405_3983 190
279 3300049652 Ga0501202_000730 Ga0501202_000730_3368_3946 190
280 3300049653 Ga0501206_009539 Ga0501206_009539_164_742 190
281 3300049661 Ga0501217_004833 Ga0501217_004833_445_1023 190
282 3300049662 Ga0501222_000261 Ga0501222_000261_4565_5143 190
283 3300049663 Ga0501223_000807 Ga0501223_000807_3201_3779 190
284 3300049669 Ga0501235_000644 Ga0501235_000644_3378_3956 190
285 3300049673 Ga0501240_004303 Ga0501240_004303_51_629 190
286 3300049675 Ga0501243_003632 Ga0501243_003632_1236_1814 190
287 3300049685 Ga0501256_022533 Ga0501256_022533_29_607 190
288 3300049686 Ga0501257_010896 Ga0501257_010896_499_1077 190
289 3300049688 Ga0501259_000633 Ga0501259_000633_1640_2218 190
290 3300049690 Ga0501261_003685 Ga0501261_003685_757_1335 190
291 3300049704 Ga0501221_000888 Ga0501221_000888_1438_2016 190
292 3300049705 Ga0501225_0001269 Ga0501225_0001269_3779_4357 190
293 3300049707 Ga0501234_002137 Ga0501234_002137_1574_2152 190
294 3300049708 Ga0501245_017453 Ga0501245_017453_143_721 190
295 3300049742 Ga0501080_0374983 Ga0501080_0374983_318_890 190
296 3300049822 Ga0501035_0233042 Ga0501035_0233042_436_1008 190
297 3300049823 Ga0501044_0036250 Ga0501044_0036250_759_1331 190
298 3300049851 Ga0501212_003179 Ga0501212_003179_80_658 190
299 3300050493 nmdc:mga0k408_205608_c1 nmdc:mga0k408_205608_c1_439_1017 190
300 3300053085 Ga0495619_0185569 Ga0495619_0185569_599_1180 190
301 3300053151 Ga0500604_0007649 Ga0500604_0007649_1428_2075 190
302 3300053730 Ga0500645_014049 Ga0500645_014049_1234_1812 190
303 3300054114 Ga0501084_0294059 Ga0501084_0294059_158_730 190
304 3300060353 Ga0501082_0152674 Ga0501082_0152674_1001_1573 190
305 iso_pu_bacteria 2929154850 2929159581 190
306 3300005334 Ga0068869_100220672 Ga0068869_1002206722 191
307 3300005335 Ga0070666_10029648 Ga0070666_100296482 191
308 3300005335 Ga0070666_10042943 Ga0070666_100429433 191
309 3300005338 Ga0068868_100025507 Ga0068868_1000255072 191
310 3300005344 Ga0070661_100490963 Ga0070661_1004909631 191
311 3300005353 Ga0070669_100027597 Ga0070669_1000275973 191
312 3300005354 Ga0070675_100036394 Ga0070675_1000363942 191
313 3300005355 Ga0070671_100002092 Ga0070671_1000020924 191
314 3300005356 Ga0070674_100157577 Ga0070674_1001575772 191
315 3300005364 Ga0070673_101195159 Ga0070673_1011951591 191
316 3300005367 Ga0070667_100010282 Ga0070667_1000102824 191
317 3300005367 Ga0070667_100028015 Ga0070667_1000280153 191
318 3300005367 Ga0070667_100928834 Ga0070667_1009288342 191
319 3300005456 Ga0070678_100004465 Ga0070678_1000044653 191
320 3300005456 Ga0070678_100111122 Ga0070678_1001111222 191
321 3300005459 Ga0068867_100026214 Ga0068867_1000262142 191
322 3300005459 Ga0068867_100128693 Ga0068867_1001286932 191
323 3300005466 Ga0070685_10333788 Ga0070685_103337881 191
324 3300005539 Ga0068853_100847533 Ga0068853_1008475332 191
325 3300005543 Ga0070672_100058102 Ga0070672_1000581022 191
326 3300005578 Ga0068854_100018687 Ga0068854_1000186872 191
327 3300005617 Ga0068859_100017290 Ga0068859_1000172905 191
328 3300005718 Ga0068866_10003519 Ga0068866_100035195 191
329 3300005719 Ga0068861_100421237 Ga0068861_1004212372 191
330 3300005841 Ga0068863_100580775 Ga0068863_1005807752 191
331 3300005842 Ga0068858_100474619 Ga0068858_1004746191 191
332 3300005843 Ga0068860_100201927 Ga0068860_1002019272 191
333 3300006163 Ga0070715_10510417 Ga0070715_105104172 191
334 3300006237 Ga0097621_100000710 Ga0097621_10000071026 191
335 3300006237 Ga0097621_100415525 Ga0097621_1004155252 191
336 3300006358 Ga0068871_100000044 Ga0068871_10000004411 191
337 3300006358 Ga0068871_100198191 Ga0068871_1001981912 191
338 3300006881 Ga0068865_100068544 Ga0068865_1000685442 191
339 3300006931 Ga0097620_100017290 Ga0097620_1000172905 191
340 3300009098 Ga0105245_10239636 Ga0105245_102396362 191
341 3300009174 Ga0105241_10400273 Ga0105241_104002732 191
342 3300009174 Ga0105241_10526233 Ga0105241_105262332 191
343 3300009177 Ga0105248_10012448 Ga0105248_100124486 191
344 3300009553 Ga0105249_10003142 Ga0105249_100031427 191
345 3300011119 Ga0105246_10044951 Ga0105246_100449512 191
346 3300013296 Ga0157374_10008783 Ga0157374_100087833 191
347 3300013296 Ga0157374_10778273 Ga0157374_107782732 191
348 3300013297 Ga0157378_10402125 Ga0157378_104021252 191
349 3300013306 Ga0163162_10000154 Ga0163162_1000015411 191
350 3300013306 Ga0163162_10004949 Ga0163162_1000494914 191
351 3300013306 Ga0163162_10246775 Ga0163162_102467752 191
352 3300013306 Ga0163162_10358338 Ga0163162_103583382 191
353 3300013308 Ga0157375_10000850 Ga0157375_1000085024 191
354 3300014325 Ga0163163_10000825 Ga0163163_100008257 191
355 3300014745 Ga0157377_10658657 Ga0157377_106586571 191
356 3300014968 Ga0157379_10021186 Ga0157379_100211866 191
357 3300014968 Ga0157379_10024504 Ga0157379_100245047 191
358 3300014969 Ga0157376_10002615 Ga0157376_100026156 191
359 3300014969 Ga0157376_10600735 Ga0157376_106007352 191
360 3300017792 Ga0163161_10004121 Ga0163161_100041216 191
361 3300017792 Ga0163161_10024256 Ga0163161_100242563 191
362 3300025903 Ga0207680_10027392 Ga0207680_100273922 191
363 3300025905 Ga0207685_10394224 Ga0207685_103942241 191
364 3300025907 Ga0207645_10000529 Ga0207645_100005294 191
365 3300025911 Ga0207654_10466844 Ga0207654_104668441 191
366 3300025923 Ga0207681_10037342 Ga0207681_100373422 191
367 3300025925 Ga0207650_10202797 Ga0207650_102027972 191
368 3300025931 Ga0207644_10001410 Ga0207644_100014108 191
369 3300025933 Ga0207706_10104562 Ga0207706_101045622 191
370 3300025937 Ga0207669_10025948 Ga0207669_100259483 191
371 3300025938 Ga0207704_10098509 Ga0207704_100985092 191
372 3300025940 Ga0207691_10044535 Ga0207691_100445353 191
373 3300025941 Ga0207711_10152073 Ga0207711_101520732 191
374 3300025942 Ga0207689_10005081 Ga0207689_100050816 191
375 3300025960 Ga0207651_10024921 Ga0207651_100249212 191
376 3300025972 Ga0207668_10362154 Ga0207668_103621542 191
377 3300025986 Ga0207658_10027634 Ga0207658_100276344 191
378 3300025986 Ga0207658_10671114 Ga0207658_106711142 191
379 3300026023 Ga0207677_10012986 Ga0207677_100129863 191
380 3300026035 Ga0207703_10364774 Ga0207703_103647742 191
381 3300026041 Ga0207639_11138954 Ga0207639_111389542 191
382 3300026088 Ga0207641_10121212 Ga0207641_101212123 191
383 3300026089 Ga0207648_10010710 Ga0207648_100107107 191
384 3300026089 Ga0207648_10140605 Ga0207648_101406052 191
385 3300026095 Ga0207676_10130331 Ga0207676_101303313 191
386 3300026095 Ga0207676_10432676 Ga0207676_104326761 191
387 3300026118 Ga0207675_100083159 Ga0207675_1000831592 191
388 3300026121 Ga0207683_10006970 Ga0207683_100069703 191
389 3300026121 Ga0207683_10159812 Ga0207683_101598122 191
390 3300026142 Ga0207698_10203820 Ga0207698_102038202 191
391 3300028381 Ga0268264_10968210 Ga0268264_109682101 191
392 3300031251 Ga0265327_10012985 Ga0265327_100129853 191
393 3300046517 Ga0495630_0129527 Ga0495630_0129527_118_693 191
394 3300047317 Ga0495604_0532829 Ga0495604_0532829_159_734 191
395 3300048903 Ga0496100_0011575 Ga0496100_0011575_3952_4533 191
396 3300048904 Ga0496101_0061705 Ga0496101_0061705_411_992 191
397 3300048913 Ga0496110_0343514 Ga0496110_0343514_716_1297 191
398 3300003354 JGI25160J50197_1006321 JGI25160J50197_10063213 192
399 3300005335 Ga0070666_10000106 Ga0070666_1000010628 192
400 3300005347 Ga0070668_100051737 Ga0070668_1000517373 192
401 3300005355 Ga0070671_100111788 Ga0070671_1001117882 192
402 3300005367 Ga0070667_100005817 Ga0070667_1000058175 192
403 3300005367 Ga0070667_100007281 Ga0070667_1000072813 192
404 3300005456 Ga0070678_100190735 Ga0070678_1001907352 192
405 3300005466 Ga0070685_10108565 Ga0070685_101085652 192
406 3300005616 Ga0068852_100019832 Ga0068852_1000198324 192
407 3300005617 Ga0068859_100000024 Ga0068859_10000002429 192
408 3300005617 Ga0068859_100065456 Ga0068859_1000654564 192
409 3300005618 Ga0068864_100001230 Ga0068864_10000123016 192
410 3300005834 Ga0068851_10031645 Ga0068851_100316452 192
411 3300005841 Ga0068863_100008315 Ga0068863_1000083158 192
412 3300005841 Ga0068863_100086419 Ga0068863_1000864192 192
413 3300005842 Ga0068858_100007223 Ga0068858_1000072239 192
414 3300005842 Ga0068858_100253594 Ga0068858_1002535942 192
415 3300005843 Ga0068860_100010197 Ga0068860_1000101973 192
416 3300005843 Ga0068860_100023088 Ga0068860_1000230882 192
417 3300006237 Ga0097621_100932085 Ga0097621_1009320851 192
418 3300006931 Ga0097620_100000024 Ga0097620_10000002429 192
419 3300006931 Ga0097620_100065458 Ga0097620_1000654584 192
420 3300009098 Ga0105245_10155713 Ga0105245_101557132 192
421 3300009101 Ga0105247_10007693 Ga0105247_100076935 192
422 3300009148 Ga0105243_10081324 Ga0105243_100813242 192
423 3300009174 Ga0105241_10002574 Ga0105241_100025745 192
424 3300009176 Ga0105242_10030450 Ga0105242_100304503 192
425 3300009545 Ga0105237_10001996 Ga0105237_1000199628 192
426 3300009551 Ga0105238_10583909 Ga0105238_105839092 192
427 3300009553 Ga0105249_10000933 Ga0105249_1000093327 192
428 3300011119 Ga0105246_10057737 Ga0105246_100577373 192
429 3300013296 Ga0157374_10010368 Ga0157374_100103682 192
430 3300013296 Ga0157374_10115500 Ga0157374_101155002 192
431 3300013297 Ga0157378_10048875 Ga0157378_100488752 192
432 3300013306 Ga0163162_10000189 Ga0163162_1000018917 192
433 3300013308 Ga0157375_10080273 Ga0157375_100802732 192
434 3300013308 Ga0157375_10585657 Ga0157375_105856572 192
435 3300014325 Ga0163163_10224719 Ga0163163_102247192 192
436 3300014325 Ga0163163_10636338 Ga0163163_106363382 192
437 3300014968 Ga0157379_10021636 Ga0157379_100216362 192
438 3300025302 Ga0207426_1000026 Ga0207426_1000026309 192
439 3300025900 Ga0207710_10069289 Ga0207710_100692892 192
440 3300025903 Ga0207680_10000024 Ga0207680_1000002453 192
441 3300025911 Ga0207654_10001918 Ga0207654_100019185 192
442 3300025914 Ga0207671_10003098 Ga0207671_1000309817 192
443 3300025931 Ga0207644_10094683 Ga0207644_100946832 192
444 3300025942 Ga0207689_10000610 Ga0207689_1000061032 192
445 3300025986 Ga0207658_10064995 Ga0207658_100649954 192
446 3300026023 Ga0207677_10005458 Ga0207677_100054588 192
447 3300026035 Ga0207703_10009215 Ga0207703_100092153 192
448 3300026035 Ga0207703_10575451 Ga0207703_105754512 192
449 3300026088 Ga0207641_10000058 Ga0207641_1000005899 192
450 3300026088 Ga0207641_10065194 Ga0207641_100651942 192
451 3300026095 Ga0207676_10013525 Ga0207676_100135253 192
452 3300028381 Ga0268264_10010498 Ga0268264_100104983 192
453 3300028381 Ga0268264_10159874 Ga0268264_101598742 192
454 3300037418 Ga0395900_0034798 Ga0395900_0034798_4497_5081 192
455 3300037471 Ga0395905_0024221 Ga0395905_0024221_3830_4414 192
456 3300053730 Ga0500645_028316 Ga0500645_028316_801_1391 194
457 3300047320 Ga0495672_0008967 Ga0495672_0008967_3568_4182 199
458 3300003323 rootH1_10034436 rootH1_100344362 201
459 3300003320 rootH2_10007689 rootH2_100076895 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

29

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ex7-assembly1.cif.gz_A crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate 0.9522 5 187
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9427 37 87
1ex7-assembly1.cif.gz_A crystal structure of yeast guanylate kinase in complex with guanosine-5'-monophosphate 0.9324 5 187
7luy-assembly2.cif.gz_B crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9261 5 193
7luy-assembly3.cif.gz_C crystal structure of guanylate kinase from bartonella henselae str. houston-1 0.9256 5 194
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9839 37 85 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9802 37 87 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9776 37 97 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9617 37 97 3.30.63.10
2qorA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9616 37 95 3.30.63.10
ID Description Score Start End GO Terms
AF-A0A4Q5Y1J4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9884 4 166 GO:0004385
GO:0005524
GO:0005829
AF-A0A7Y2MN10-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9817 7 189 GO:0004385
GO:0005524
GO:0005829
AF-A0A249SSN2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9766 5 190 GO:0004385
GO:0005524
GO:0005829
AF-A0A4Q5Y1J4-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9764 4 166 GO:0004385
GO:0005524
GO:0005829
AF-A0A7T9CPW7-F1-model_v4 deleted 0.9753 5 188

Feature Viewer

pLDDT pTM Quality
89.65 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map