F448489

General Info

Members Datasets Scaffolds Average Seq Length
460 174 460 228

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100103997|Ga0070690_1001039973
Length 245
Sequence MSRLDPRLLLQGYATGIFPMADSRDAAELFWVEPRNRAIMPLNSFHLSRSLKRTLRSGRFAVTHDLDFQAIITACADREETWINDDLERAMLALHSSGHAHSVEVWSDGKLVGGLYGVKLGRAFFGESMFSRMRDASKVALAWLVARLKVGNFTLLDCQFMTEHLASLGAVSVPRETYVALLSAALGGGGAVGVSATGALVEGLGRTPDAAPDFVALDRLLELAGAAGTGGPAGYVISQLLGHTS

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
143 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 6.3
Rhizosphere 92.83
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1016406 3300001904 Bacteria 1180
2 JGI24735J21928_10003507 3300002067 Bacteria 5344
3 JGI24735J21928_10071646 3300002067 Bacteria 993
4 Ga0065715_10019104 3300005293 Bacteria 2197
5 Ga0070658_10014524 3300005327 Bacteria 6320
6 Ga0070658_10018546 3300005327 Bacteria 5572
7 Ga0070658_10132875 3300005327 Bacteria 2075
8 Ga0070658_10147609 3300005327 Bacteria 1967
9 Ga0070658_10150010 3300005327 Bacteria 1951
10 Ga0070658_10312141 3300005327 Bacteria 1342
11 Ga0070658_10320340 3300005327 Bacteria 1324
12 Ga0070676_10031422 3300005328 Bacteria 3034
13 Ga0070676_10124588 3300005328 Bacteria 1622
14 Ga0070683_100044160 3300005329 Bacteria 4109
15 Ga0070683_100116560 3300005329 Bacteria 2522
16 Ga0070690_100103997 3300005330 Bacteria 1886
17 Ga0070670_100003619 3300005331 Bacteria 12864
18 Ga0070670_100008647 3300005331 Bacteria 8691
19 Ga0070670_100017460 3300005331 Bacteria 6155
20 Ga0070670_100021582 3300005331 Bacteria 5538
21 Ga0070670_100089817 3300005331 Bacteria 2641
22 Ga0070670_100104330 3300005331 Bacteria 2442
23 Ga0070670_100104764 3300005331 Bacteria 2437
24 Ga0070670_100396535 3300005331 Bacteria 1218
25 Ga0070677_10150589 3300005333 Bacteria 1082
26 Ga0070666_10006214 3300005335 Bacteria 7348
27 Ga0070666_10065689 3300005335 Bacteria 2462
28 Ga0070680_100007743 3300005336 Bacteria 8188
29 Ga0068868_100034206 3300005338 Bacteria 3923
30 Ga0070660_100071797 3300005339 Bacteria 2703
31 Ga0070660_100077654 3300005339 Bacteria 2602
32 Ga0070660_100552782 3300005339 Bacteria 960
33 Ga0070689_100088320 3300005340 Bacteria 2440
34 Ga0070689_100261650 3300005340 Bacteria 1430
35 Ga0070691_10008635 3300005341 Bacteria 4664
36 Ga0070661_100007349 3300005344 Bacteria 7595
37 Ga0070661_100038051 3300005344 Bacteria 3501
38 Ga0070661_100067692 3300005344 Bacteria 2624
39 Ga0070661_100076832 3300005344 Bacteria 2461
40 Ga0070661_100142440 3300005344 Bacteria 1807
41 Ga0070661_100294403 3300005344 Bacteria 1262
42 Ga0070668_100088496 3300005347 Bacteria 2438
43 Ga0070668_100218625 3300005347 Bacteria 1570
44 Ga0070669_100071343 3300005353 Bacteria 2570
45 Ga0070669_100218533 3300005353 Bacteria 1506
46 Ga0070669_100234565 3300005353 Bacteria 1455
47 Ga0070675_100002201 3300005354 Bacteria 14455
48 Ga0070675_100060274 3300005354 Bacteria 3133
49 Ga0070671_100007366 3300005355 Bacteria 8789
50 Ga0070671_100093739 3300005355 Bacteria 2516
51 Ga0070671_100452379 3300005355 Bacteria 1102
52 Ga0070674_100027437 3300005356 Bacteria 3731
53 Ga0070673_100001900 3300005364 Bacteria 12530
54 Ga0070673_100125368 3300005364 Bacteria 2148
55 Ga0070673_100141243 3300005364 Bacteria 2031
56 Ga0070688_100372263 3300005365 Bacteria 1051
57 Ga0070659_100039124 3300005366 Bacteria 3701
58 Ga0070659_100078215 3300005366 Bacteria 2638
59 Ga0070659_100118786 3300005366 Bacteria 2139
60 Ga0070659_100154732 3300005366 Bacteria 1872
61 Ga0070667_100190589 3300005367 Bacteria 1816
62 Ga0070714_100052566 3300005435 Bacteria 3475
63 Ga0070714_100207466 3300005435 Bacteria 1795
64 Ga0070678_100000630 3300005456 Bacteria 17294
65 Ga0070678_100136030 3300005456 Bacteria 1960
66 Ga0070662_100022468 3300005457 Bacteria 4320
67 Ga0070662_100031843 3300005457 Bacteria 3704
68 Ga0070662_100085668 3300005457 Bacteria 2355
69 Ga0070662_100102383 3300005457 Bacteria 2170
70 Ga0070662_100337519 3300005457 Bacteria 1232
71 Ga0070681_10035548 3300005458 Bacteria 5005
72 Ga0070681_10079488 3300005458 Bacteria 3236
73 Ga0068867_100003866 3300005459 Bacteria 10535
74 Ga0068867_100147779 3300005459 Bacteria 1844
75 Ga0070685_10087557 3300005466 Bacteria 1879
76 Ga0070679_100018253 3300005530 Bacteria 6804
77 Ga0070679_100245692 3300005530 Bacteria 1746
78 Ga0070679_100320762 3300005530 Bacteria 1499
79 Ga0070684_100025627 3300005535 Bacteria 4960
80 Ga0068853_100015827 3300005539 Bacteria 6194
81 Ga0068853_100020632 3300005539 Bacteria 5479
82 Ga0068853_100035713 3300005539 Bacteria 4223
83 Ga0070672_100029297 3300005543 Bacteria 4127
84 Ga0070672_100034782 3300005543 Bacteria 3826
85 Ga0070696_100012975 3300005546 Bacteria 5593
86 Ga0070693_100083745 3300005547 Bacteria 1907
87 Ga0070693_100084825 3300005547 Bacteria 1897
88 Ga0070693_100307414 3300005547 Bacteria 1071
89 Ga0070665_100032897 3300005548 Bacteria 5217
90 Ga0068855_100053659 3300005563 Bacteria 4741
91 Ga0068855_100300775 3300005563 Bacteria 1777
92 Ga0070664_100013303 3300005564 Bacteria 6701
93 Ga0070664_100018769 3300005564 Bacteria 5688
94 Ga0070664_100020614 3300005564 Bacteria 5429
95 Ga0070664_100043491 3300005564 Bacteria 3790
96 Ga0070664_100090518 3300005564 Bacteria 2648
97 Ga0070664_100104208 3300005564 Bacteria 2470
98 Ga0070664_100373418 3300005564 Bacteria 1300
99 Ga0070664_100432078 3300005564 Bacteria 1207
100 Ga0070664_100607044 3300005564 Bacteria 1015
101 Ga0068857_100025979 3300005577 Bacteria 5158
102 Ga0068857_100041788 3300005577 Bacteria 4065
103 Ga0068857_100054910 3300005577 Bacteria 3535
104 Ga0068857_100237943 3300005577 Bacteria 1666
105 Ga0068854_100010860 3300005578 Bacteria 5909
106 Ga0068854_100015686 3300005578 Bacteria 5029
107 Ga0068854_100018007 3300005578 Bacteria 4735
108 Ga0068854_100036262 3300005578 Bacteria 3456
109 Ga0068856_100030079 3300005614 Bacteria 5308
110 Ga0068856_100078003 3300005614 Bacteria 3283
111 Ga0068856_100133696 3300005614 Bacteria 2486
112 Ga0068856_100297950 3300005614 Bacteria 1630
113 Ga0068852_100011217 3300005616 Bacteria 6734
114 Ga0068852_100046007 3300005616 Bacteria 3715
115 Ga0068852_100208671 3300005616 Bacteria 1852
116 Ga0068852_100253948 3300005616 Bacteria 1685
117 Ga0068859_100031361 3300005617 Bacteria 5337
118 Ga0068864_100023431 3300005618 Bacteria 5184
119 Ga0068864_100118668 3300005618 Bacteria 2362
120 Ga0068864_100874146 3300005618 Bacteria 887
121 Ga0068851_10034858 3300005834 Bacteria 2514
122 Ga0068851_10058848 3300005834 Bacteria 1965
123 Ga0068851_10128923 3300005834 Bacteria 1366
124 Ga0068863_100007726 3300005841 Bacteria 10514
125 Ga0068863_100030469 3300005841 Bacteria 5151
126 Ga0068858_100003126 3300005842 Bacteria 16570
127 Ga0068860_100268026 3300005843 Bacteria 1666
128 Ga0068862_100479517 3300005844 Bacteria 1177
129 Ga0081539_10048957 3300005985 Bacteria 2401
130 Ga0097621_100004933 3300006237 Bacteria 9362
131 Ga0068871_100005449 3300006358 Bacteria 8922
132 Ga0068871_100476523 3300006358 Bacteria 1122
133 Ga0097620_100031363 3300006931 Bacteria 5337
134 Ga0105241_10066740 3300009174 Bacteria 2783
135 Ga0105241_10514203 3300009174 Bacteria 1070
136 Ga0105242_10177910 3300009176 Bacteria 1875
137 Ga0105248_10002629 3300009177 Bacteria 19979
138 Ga0105248_10020096 3300009177 Bacteria 7398
139 Ga0105248_10069239 3300009177 Bacteria 3962
140 Ga0105248_10307198 3300009177 Bacteria 1786
141 Ga0105237_10155437 3300009545 Bacteria 2284
142 Ga0105238_10014708 3300009551 Bacteria 7913
143 Ga0105238_10159429 3300009551 Bacteria 2231
144 Ga0105238_10348557 3300009551 Bacteria 1470
145 Ga0105239_10468523 3300010375 Bacteria 1430
146 Ga0105246_10037031 3300011119 Bacteria 3272
147 Ga0157373_10010802 3300013100 Bacteria 6721
148 Ga0157373_10020196 3300013100 Bacteria 4845
149 Ga0157373_10031179 3300013100 Bacteria 3836
150 Ga0157371_10037560 3300013102 Bacteria 3465
151 Ga0157371_10073988 3300013102 Bacteria 2413
152 Ga0157371_10088750 3300013102 Bacteria 2189
153 Ga0157371_10483585 3300013102 Bacteria 913
154 Ga0157370_10001094 3300013104 Bacteria 33972
155 Ga0157370_10010418 3300013104 Bacteria 9797
156 Ga0157370_10046919 3300013104 Bacteria 4141
157 Ga0157370_10053896 3300013104 Bacteria 3834
158 Ga0157370_10163559 3300013104 Bacteria 2070
159 Ga0157370_10359744 3300013104 Bacteria 1341
160 Ga0157370_10402290 3300013104 Bacteria 1260
161 Ga0157369_10068780 3300013105 Bacteria 3804
162 Ga0157369_10129608 3300013105 Bacteria 2673
163 Ga0157374_10001508 3300013296 Bacteria 19606
164 Ga0163162_10002279 3300013306 Bacteria 18008
165 Ga0157372_10002710 3300013307 Bacteria 19159
166 Ga0157375_10001921 3300013308 Bacteria 17878
167 Ga0163163_10002130 3300014325 Bacteria 16711
168 Ga0163163_10210786 3300014325 Bacteria 1992
169 Ga0157377_10053228 3300014745 Bacteria 2288
170 Ga0213876_10029539 3300021384 Bacteria 2888
171 Ga0207656_10020682 3300025321 Bacteria 2619
172 Ga0207656_10088768 3300025321 Bacteria 1400
173 Ga0207656_10113407 3300025321 Bacteria 1255
174 Ga0207682_10022844 3300025893 Bacteria 2467
175 Ga0207680_10007732 3300025903 Bacteria 5254
176 Ga0207680_10013223 3300025903 Bacteria 4232
177 Ga0207647_10001865 3300025904 Bacteria 16141
178 Ga0207647_10026799 3300025904 Bacteria 3765
179 Ga0207645_10090382 3300025907 Bacteria 1969
180 Ga0207643_10110999 3300025908 Bacteria 1616
181 Ga0207705_10002069 3300025909 Bacteria 15599
182 Ga0207705_10014968 3300025909 Bacteria 5576
183 Ga0207705_10068786 3300025909 Bacteria 2564
184 Ga0207705_10080309 3300025909 Bacteria 2376
185 Ga0207705_10173092 3300025909 Bacteria 1626
186 Ga0207705_10251735 3300025909 Bacteria 1347
187 Ga0207707_10056812 3300025912 Bacteria 3406
188 Ga0207695_10055298 3300025913 Bacteria 4137
189 Ga0207671_10035639 3300025914 Bacteria 3691
190 Ga0207660_10085185 3300025917 Bacteria 2330
191 Ga0207660_10384021 3300025917 Bacteria 1129
192 Ga0207657_10004331 3300025919 Bacteria 15036
193 Ga0207657_10079415 3300025919 Bacteria 2760
194 Ga0207649_10014720 3300025920 Bacteria 4385
195 Ga0207649_10050773 3300025920 Bacteria 2566
196 Ga0207649_10058372 3300025920 Bacteria 2416
197 Ga0207649_10067533 3300025920 Bacteria 2270
198 Ga0207649_10120589 3300025920 Bacteria 1767
199 Ga0207652_10017090 3300025921 Bacteria 5934
200 Ga0207652_10104809 3300025921 Bacteria 2501
201 Ga0207681_10029760 3300025923 Bacteria 3552
202 Ga0207694_10002652 3300025924 Bacteria 14514
203 Ga0207694_10777503 3300025924 Bacteria 808
204 Ga0207650_10004500 3300025925 Bacteria 9532
205 Ga0207650_10008196 3300025925 Bacteria 7129
206 Ga0207650_10022254 3300025925 Bacteria 4485
207 Ga0207650_10060519 3300025925 Bacteria 2826
208 Ga0207650_10062204 3300025925 Bacteria 2789
209 Ga0207650_10377107 3300025925 Bacteria 1171
210 Ga0207659_10008159 3300025926 Bacteria 6483
211 Ga0207659_10036165 3300025926 Bacteria 3419
212 Ga0207659_10071063 3300025926 Bacteria 2540
213 Ga0207659_10355887 3300025926 Bacteria 1216
214 Ga0207659_10374161 3300025926 Bacteria 1187
215 Ga0207664_10024751 3300025929 Bacteria 4514
216 Ga0207664_10144544 3300025929 Bacteria 2016
217 Ga0207644_10000746 3300025931 Bacteria 20634
218 Ga0207644_10003693 3300025931 Bacteria 9926
219 Ga0207644_10092087 3300025931 Bacteria 2261
220 Ga0207644_10506229 3300025931 Bacteria 996
221 Ga0207690_10004345 3300025932 Bacteria 8374
222 Ga0207690_10006912 3300025932 Bacteria 6725
223 Ga0207690_10022117 3300025932 Bacteria 3951
224 Ga0207706_10031514 3300025933 Bacteria 4723
225 Ga0207706_10036568 3300025933 Bacteria 4362
226 Ga0207706_10055495 3300025933 Bacteria 3493
227 Ga0207706_10083007 3300025933 Bacteria 2816
228 Ga0207706_10429001 3300025933 Bacteria 1145
229 Ga0207686_10242264 3300025934 Bacteria 1313
230 Ga0207669_10034345 3300025937 Bacteria 2873
231 Ga0207691_10000892 3300025940 Bacteria 29583
232 Ga0207691_10018513 3300025940 Bacteria 6600
233 Ga0207691_10154483 3300025940 Bacteria 2016
234 Ga0207691_10689680 3300025940 Bacteria 862
235 Ga0207711_10001850 3300025941 Bacteria 19299
236 Ga0207711_10775704 3300025941 Bacteria 893
237 Ga0207661_10003155 3300025944 Bacteria 11437
238 Ga0207661_10152760 3300025944 Bacteria 1997
239 Ga0207661_10608910 3300025944 Bacteria 1003
240 Ga0207679_10010222 3300025945 Bacteria 6037
241 Ga0207679_10115871 3300025945 Bacteria 2123
242 Ga0207679_10287136 3300025945 Bacteria 1413
243 Ga0207679_10449112 3300025945 Bacteria 1143
244 Ga0207667_10043334 3300025949 Bacteria 4776
245 Ga0207667_10138676 3300025949 Bacteria 2504
246 Ga0207651_10019737 3300025960 Bacteria 4048
247 Ga0207651_10043633 3300025960 Bacteria 2995
248 Ga0207640_10005356 3300025981 Bacteria 6996
249 Ga0207640_10029580 3300025981 Bacteria 3364
250 Ga0207640_10035260 3300025981 Bacteria 3130
251 Ga0207640_10075767 3300025981 Bacteria 2281
252 Ga0207640_10145440 3300025981 Bacteria 1734
253 Ga0207640_10330554 3300025981 Bacteria 1217
254 Ga0207658_10004498 3300025986 Bacteria 9687
255 Ga0207677_10211285 3300026023 Bacteria 1550
256 Ga0207677_10244561 3300026023 Bacteria 1453
257 Ga0207703_10008160 3300026035 Bacteria 8276
258 Ga0207639_10000124 3300026041 Bacteria 57560
259 Ga0207639_10015790 3300026041 Bacteria 5330
260 Ga0207678_10352552 3300026067 Bacteria 1269
261 Ga0207702_10045189 3300026078 Bacteria 3705
262 Ga0207702_10067353 3300026078 Bacteria 3073
263 Ga0207702_10144387 3300026078 Bacteria 2158
264 Ga0207702_10249283 3300026078 Bacteria 1667
265 Ga0207702_10262753 3300026078 Bacteria 1626
266 Ga0207702_10358274 3300026078 Bacteria 1397
267 Ga0207702_10483642 3300026078 Bacteria 1205
268 Ga0207641_10013067 3300026088 Bacteria 6809
269 Ga0207641_10112587 3300026088 Bacteria 2415
270 Ga0207648_10138652 3300026089 Bacteria 2143
271 Ga0207648_10294045 3300026089 Bacteria 1455
272 Ga0207676_10002747 3300026095 Bacteria 12530
273 Ga0207676_10124524 3300026095 Bacteria 2180
274 Ga0207674_10000756 3300026116 Bacteria 42260
275 Ga0207674_10001923 3300026116 Bacteria 26367
276 Ga0207674_10007288 3300026116 Bacteria 12892
277 Ga0207683_10003876 3300026121 Bacteria 12973
278 Ga0207683_10297908 3300026121 Bacteria 1475
279 Ga0207683_10400354 3300026121 Bacteria 1263
280 Ga0207698_10012949 3300026142 Bacteria 5483
281 Ga0207698_10034677 3300026142 Bacteria 3681
282 Ga0207698_10039763 3300026142 Bacteria 3487
283 Ga0207698_10130551 3300026142 Bacteria 2146
284 Ga0207698_10273683 3300026142 Bacteria 1558
285 Ga0207698_10371221 3300026142 Bacteria 1358
286 Ga0207698_10737390 3300026142 Bacteria 983
287 Ga0207698_10779020 3300026142 Bacteria 957
288 Ga0268266_10024946 3300028379 Bacteria 5087
289 Ga0268265_10118995 3300028380 Bacteria 2173
290 Ga0268264_10389702 3300028381 Bacteria 1336
291 Ga0307408_100025110 3300031548 Bacteria 4077
292 Ga0307408_100087115 3300031548 Bacteria 2348
293 Ga0307408_100146408 3300031548 Bacteria 1860
294 Ga0307405_10006118 3300031731 Bacteria 5892
295 Ga0307405_10268391 3300031731 Bacteria 1278
296 Ga0307405_10359992 3300031731 Bacteria 1125
297 Ga0307413_10055538 3300031824 Bacteria 2410
298 Ga0307413_10058949 3300031824 Bacteria 2356
299 Ga0307413_10177280 3300031824 Bacteria 1515
300 Ga0307410_10000754 3300031852 Bacteria 13563
301 Ga0307410_10101152 3300031852 Bacteria 2066
302 Ga0307410_10173899 3300031852 Bacteria 1625
303 Ga0307410_10189419 3300031852 Bacteria 1563
304 Ga0307410_10437377 3300031852 Bacteria 1064
305 Ga0307410_10682659 3300031852 Bacteria 864
306 Ga0307406_10029891 3300031901 Bacteria 3303
307 Ga0307406_10039665 3300031901 Bacteria 2923
308 Ga0307406_10107224 3300031901 Bacteria 1915
309 Ga0307406_10225197 3300031901 Bacteria 1396
310 Ga0307406_10286112 3300031901 Bacteria 1260
311 Ga0307407_10200908 3300031903 Bacteria 1336
312 Ga0307407_10295087 3300031903 Bacteria 1128
313 Ga0307412_10014981 3300031911 Bacteria 4585
314 Ga0307409_100029936 3300031995 Bacteria 3904
315 Ga0307409_100044740 3300031995 Bacteria 3337
316 Ga0307409_100109470 3300031995 Bacteria 2313
317 Ga0307409_100174964 3300031995 Bacteria 1893
318 Ga0307409_100302993 3300031995 Bacteria 1487
319 Ga0307416_100043161 3300032002 Bacteria 3529
320 Ga0307416_100048577 3300032002 Bacteria 3368
321 Ga0307416_100105581 3300032002 Bacteria 2466
322 Ga0307416_100235245 3300032002 Bacteria 1770
323 Ga0307416_100315459 3300032002 Bacteria 1562
324 Ga0307416_100323063 3300032002 Bacteria 1546
325 Ga0307414_10003556 3300032004 Bacteria 8345
326 Ga0307414_10167003 3300032004 Bacteria 1755
327 Ga0307414_10502940 3300032004 Bacteria 1072
328 Ga0307411_10008007 3300032005 Bacteria 5441
329 Ga0307411_10126912 3300032005 Bacteria 1857
330 Ga0307411_10196039 3300032005 Bacteria 1546
331 Ga0307411_10217698 3300032005 Bacteria 1479
332 Ga0307411_10230039 3300032005 Bacteria 1444
333 Ga0307411_10297607 3300032005 Bacteria 1292
334 Ga0307411_10833988 3300032005 Bacteria 814
335 Ga0307415_100029468 3300032126 Bacteria 3508
336 Ga0307415_100043989 3300032126 Bacteria 2982
337 Ga0307415_100047218 3300032126 Bacteria 2898
338 Ga0307415_100133721 3300032126 Bacteria 1882
339 Ga0307415_100227981 3300032126 Bacteria 1498
340 Ga0307415_100234006 3300032126 Bacteria 1481
341 Ga0307415_100238797 3300032126 Bacteria 1468
342 Ga0395899_0002780 3300037312 Bacteria 14109
343 Ga0395899_0004300 3300037312 Bacteria 11125
344 Ga0395899_0022771 3300037312 Bacteria 4747
345 Ga0395899_0062084 3300037312 Bacteria 2751
346 Ga0395899_0076542 3300037312 Bacteria 2442
347 Ga0395899_0138778 3300037312 Bacteria 1731
348 Ga0395899_0203447 3300037312 Bacteria 1379
349 Ga0395900_0000221 3300037418 Bacteria 89883
350 Ga0395900_0000968 3300037418 Bacteria 37351
351 Ga0395900_0023882 3300037418 Bacteria 6256
352 Ga0395900_0034402 3300037418 Bacteria 5217
353 Ga0395900_0049293 3300037418 Bacteria 4338
354 Ga0395900_0067801 3300037418 Bacteria 3665
355 Ga0395900_0128441 3300037418 Bacteria 2598
356 Ga0395900_0133723 3300037418 Bacteria 2541
357 Ga0395900_0145227 3300037418 Bacteria 2426
358 Ga0395900_0249723 3300037418 Bacteria 1776
359 Ga0395900_0250933 3300037418 Bacteria 1771
360 Ga0395900_0342398 3300037418 Bacteria 1470
361 Ga0395900_0922453 3300037418 Bacteria 796
362 Ga0395898_0000053 3300037466 Bacteria 279600
363 Ga0395898_0001961 3300037466 Bacteria 25920
364 Ga0395898_0020946 3300037466 Bacteria 6634
365 Ga0395898_0024770 3300037466 Bacteria 6050
366 Ga0395898_0124354 3300037466 Bacteria 2471
367 Ga0395898_0627368 3300037466 Bacteria 1017
368 Ga0395905_0000031 3300037471 Bacteria 286757
369 Ga0395905_0000735 3300037471 Bacteria 43152
370 Ga0395905_0003464 3300037471 Bacteria 16874
371 Ga0395905_0003694 3300037471 Bacteria 16206
372 Ga0395905_0004414 3300037471 Bacteria 14630
373 Ga0395905_0004891 3300037471 Bacteria 13804
374 Ga0395905_0005686 3300037471 Bacteria 12670
375 Ga0395905_0006451 3300037471 Bacteria 11809
376 Ga0395905_0019042 3300037471 Bacteria 6511
377 Ga0395905_0023458 3300037471 Bacteria 5829
378 Ga0395905_0044552 3300037471 Bacteria 4164
379 Ga0395905_0061782 3300037471 Bacteria 3504
380 Ga0395905_0079552 3300037471 Bacteria 3073
381 Ga0395905_0103444 3300037471 Bacteria 2673
382 Ga0395905_0103763 3300037471 Bacteria 2669
383 Ga0395905_0141675 3300037471 Bacteria 2261
384 Ga0395905_0186883 3300037471 Bacteria 1944
385 Ga0395905_0224620 3300037471 Bacteria 1757
386 Ga0395905_0320990 3300037471 Bacteria 1438
387 Ga0395901_0000163 3300038443 Bacteria 87103
388 Ga0395901_0000469 3300038443 Bacteria 46905
389 Ga0395901_0010246 3300038443 Bacteria 9496
390 Ga0395901_0010473 3300038443 Bacteria 9391
391 Ga0395901_0013560 3300038443 Bacteria 8288
392 Ga0395901_0017880 3300038443 Bacteria 7236
393 Ga0395901_0035840 3300038443 Bacteria 5126
394 Ga0395901_0123692 3300038443 Bacteria 2718
395 Ga0395901_0164372 3300038443 Bacteria 2330
396 Ga0395901_0220121 3300038443 Bacteria 1984
397 Ga0395901_0333361 3300038443 Bacteria 1568
398 Ga0395901_0366991 3300038443 Bacteria 1483
399 Ga0395901_0369089 3300038443 Bacteria 1479
400 Ga0395901_0431223 3300038443 Bacteria 1350
401 Ga0395901_0451646 3300038443 Bacteria 1314
402 Ga0436365_0402833 3300039437 Bacteria 5418
403 Ga0451849_1117364 3300041505 Bacteria 1005
404 Ga0439448_0085469 3300042005 Bacteria 1063
405 Ga0439432_022167 3300042006 Bacteria 2099
406 Ga0439449_0051218 3300042007 Bacteria 1527
407 Ga0439449_0128581 3300042007 Bacteria 941
408 Ga0439455_0003025 3300042012 Bacteria 3158
409 Ga0450920_026938 3300042122 Bacteria 1123
410 Ga0439458_0001618 3300042157 Bacteria 5624
411 Ga0439458_0021002 3300042157 Bacteria 1510
412 Ga0451577_0215105 3300042876 Bacteria 1737
413 Ga0466972_0058232 3300044658 Bacteria 1855
414 Ga0466966_0029913 3300044684 Bacteria 3541
415 Ga0466961_0141764 3300044693 Bacteria 1504
416 Ga0466961_0188641 3300044693 Bacteria 1278
417 Ga0466963_0004194 3300044694 Bacteria 8351
418 Ga0466964_0021015 3300044706 Bacteria 2520
419 Ga0466968_0067375 3300044735 Bacteria 1552
420 Ga0466970_0047063 3300044765 Bacteria 2298
421 Ga0466957_0270076 3300044842 Bacteria 1135
422 Ga0466959_0039218 3300045049 Bacteria 3500
423 Ga0466959_0093308 3300045049 Bacteria 2160
424 Ga0466958_0003120 3300045836 Bacteria 8520
425 Ga0466958_0007407 3300045836 Bacteria 6036
426 Ga0466958_0013343 3300045836 Bacteria 4676
427 Ga0466967_0077446 3300045976 Bacteria 2993
428 Ga0495643_0212973 3300046522 Bacteria 921
429 Ga0495669_0004740 3300046684 Bacteria 5641
430 Ga0496100_0083604 3300048903 Bacteria 2162
431 Ga0496100_0134604 3300048903 Bacteria 1744
432 Ga0496101_0043435 3300048904 Bacteria 3213
433 Ga0496101_0154195 3300048904 Bacteria 1758
434 Ga0496101_0345838 3300048904 Bacteria 1168
435 Ga0496102_0180825 3300048905 Bacteria 1987
436 Ga0496104_0144227 3300048907 Bacteria 2287
437 Ga0496106_0057281 3300048909 Bacteria 2947
438 Ga0496107_0042554 3300048910 Bacteria 3262
439 Ga0496107_0093562 3300048910 Bacteria 2198
440 Ga0496107_0262397 3300048910 Bacteria 1285
441 Ga0496108_0001090 3300048911 Bacteria 21199
442 Ga0496108_0189455 3300048911 Bacteria 1783
443 Ga0496109_0049291 3300048912 Bacteria 3833
444 Ga0496110_0000437 3300048913 Bacteria 28365
445 Ga0496110_0022445 3300048913 Bacteria 5359
446 Ga0496110_0048121 3300048913 Bacteria 3737
447 Ga0496111_0009715 3300048914 Bacteria 6430
448 Ga0496111_0013324 3300048914 Bacteria 5592
449 Ga0496112_0013047 3300048915 Bacteria 7664
450 Ga0496112_0031168 3300048915 Bacteria 5168
451 Ga0496112_0042330 3300048915 Bacteria 4455
452 Ga0496112_0054147 3300048915 Bacteria 3941
453 Ga0496113_0020112 3300048916 Bacteria 4686
454 Ga0496113_0207801 3300048916 Bacteria 1558
455 Ga0496113_0308095 3300048916 Bacteria 1268
456 Ga0496114_0005913 3300048917 Bacteria 9616
457 Ga0496114_0235284 3300048917 Bacteria 1610
458 Ga0496115_0001337 3300048918 Bacteria 17576
459 Ga0501268_002453 3300049765 Bacteria 2446
460 Ga0500658_0000194 3300053134 Bacteria 29048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100190589 Ga0070667_1001905893 194
2 3300031731 Ga0307405_10359992 Ga0307405_103599921 195
3 3300031995 Ga0307409_100174964 Ga0307409_1001749643 195
4 3300032005 Ga0307411_10230039 Ga0307411_102300392 195
5 3300005355 Ga0070671_100007366 Ga0070671_1000073665 196
6 3300025931 Ga0207644_10003693 Ga0207644_100036938 196
7 3300026095 Ga0207676_10124524 Ga0207676_101245243 196
8 3300026142 Ga0207698_10012949 Ga0207698_100129494 196
9 3300037471 Ga0395905_0103763 Ga0395905_0103763_99_842 196
10 3300005364 Ga0070673_100141243 Ga0070673_1001412433 197
11 3300048907 Ga0496104_0144227 Ga0496104_0144227_328_1071 197
12 3300048914 Ga0496111_0013324 Ga0496111_0013324_457_1200 197
13 3300031824 Ga0307413_10177280 Ga0307413_101772802 200
14 3300031911 Ga0307412_10014981 Ga0307412_100149811 200
15 3300031995 Ga0307409_100302993 Ga0307409_1003029932 200
16 3300032002 Ga0307416_100315459 Ga0307416_1003154592 200
17 3300032005 Ga0307411_10297607 Ga0307411_102976071 200
18 3300032126 Ga0307415_100227981 Ga0307415_1002279812 200
19 3300013102 Ga0157371_10483585 Ga0157371_104835851 203
20 3300048913 Ga0496110_0048121 Ga0496110_0048121_2099_2833 204
21 3300005459 Ga0068867_100003866 Ga0068867_10000386613 206
22 3300005616 Ga0068852_100046007 Ga0068852_1000460072 206
23 3300005834 Ga0068851_10034858 Ga0068851_100348583 206
24 3300025321 Ga0207656_10020682 Ga0207656_100206823 206
25 3300026089 Ga0207648_10138652 Ga0207648_101386523 206
26 3300026142 Ga0207698_10130551 Ga0207698_101305513 206
27 3300005985 Ga0081539_10048957 Ga0081539_100489574 207
28 3300013102 Ga0157371_10088750 Ga0157371_100887504 207
29 3300037471 Ga0395905_0186883 Ga0395905_0186883_75_812 207
30 3300005331 Ga0070670_100104330 Ga0070670_1001043303 208
31 3300005340 Ga0070689_100088320 Ga0070689_1000883203 208
32 3300005344 Ga0070661_100294403 Ga0070661_1002944032 208
33 3300005347 Ga0070668_100218625 Ga0070668_1002186252 208
34 3300005354 Ga0070675_100060274 Ga0070675_1000602744 208
35 3300005457 Ga0070662_100337519 Ga0070662_1003375192 208
36 3300005564 Ga0070664_100432078 Ga0070664_1004320782 208
37 3300005617 Ga0068859_100031361 Ga0068859_1000313616 208
38 3300006931 Ga0097620_100031363 Ga0097620_1000313633 208
39 3300025925 Ga0207650_10060519 Ga0207650_100605194 208
40 3300025926 Ga0207659_10355887 Ga0207659_103558872 208
41 3300025933 Ga0207706_10031514 Ga0207706_100315143 208
42 3300025945 Ga0207679_10115871 Ga0207679_101158711 208
43 3300026088 Ga0207641_10112587 Ga0207641_101125874 208
44 3300009177 Ga0105248_10020096 Ga0105248_100200968 209
45 3300025931 Ga0207644_10092087 Ga0207644_100920874 209
46 3300044694 Ga0466963_0004194 Ga0466963_0004194_3290_4027 209
47 3300045836 Ga0466958_0003120 Ga0466958_0003120_5017_5754 209
48 3300045976 Ga0466967_0077446 Ga0466967_0077446_668_1405 209
49 3300048911 Ga0496108_0189455 Ga0496108_0189455_165_896 209
50 3300048915 Ga0496112_0013047 Ga0496112_0013047_397_1128 209
51 3300048916 Ga0496113_0207801 Ga0496113_0207801_227_958 209
52 3300005327 Ga0070658_10018546 Ga0070658_100185464 210
53 3300009551 Ga0105238_10014708 Ga0105238_100147081 210
54 3300025909 Ga0207705_10014968 Ga0207705_100149684 210
55 3300025931 Ga0207644_10506229 Ga0207644_105062291 210
56 3300048903 Ga0496100_0083604 Ga0496100_0083604_347_1081 210
57 3300048904 Ga0496101_0043435 Ga0496101_0043435_559_1293 210
58 3300048910 Ga0496107_0093562 Ga0496107_0093562_685_1419 210
59 3300048917 Ga0496114_0235284 Ga0496114_0235284_188_922 210
60 3300048918 Ga0496115_0001337 Ga0496115_0001337_11309_12043 210
61 3300005339 Ga0070660_100552782 Ga0070660_1005527821 211
62 3300005356 Ga0070674_100027437 Ga0070674_1000274373 211
63 3300005614 Ga0068856_100030079 Ga0068856_1000300796 211
64 3300009551 Ga0105238_10348557 Ga0105238_103485572 211
65 3300013102 Ga0157371_10073988 Ga0157371_100739882 211
66 3300013104 Ga0157370_10001094 Ga0157370_1000109423 211
67 3300025893 Ga0207682_10022844 Ga0207682_100228441 211
68 3300025933 Ga0207706_10055495 Ga0207706_100554956 211
69 3300025937 Ga0207669_10034345 Ga0207669_100343454 211
70 3300025940 Ga0207691_10154483 Ga0207691_101544831 211
71 3300025944 Ga0207661_10608910 Ga0207661_106089102 211
72 3300025981 Ga0207640_10330554 Ga0207640_103305542 211
73 3300031852 Ga0307410_10000754 Ga0307410_1000075414 211
74 3300031995 Ga0307409_100029936 Ga0307409_1000299363 211
75 3300032002 Ga0307416_100105581 Ga0307416_1001055814 211
76 3300032004 Ga0307414_10003556 Ga0307414_1000355611 211
77 3300032005 Ga0307411_10008007 Ga0307411_100080076 211
78 3300032126 Ga0307415_100047218 Ga0307415_1000472183 211
79 3300005327 Ga0070658_10147609 Ga0070658_101476092 212
80 3300005328 Ga0070676_10124588 Ga0070676_101245882 212
81 3300005353 Ga0070669_100218533 Ga0070669_1002185333 212
82 3300005457 Ga0070662_100102383 Ga0070662_1001023832 212
83 3300005459 Ga0068867_100147779 Ga0068867_1001477793 212
84 3300005546 Ga0070696_100012975 Ga0070696_1000129755 212
85 3300005547 Ga0070693_100084825 Ga0070693_1000848252 212
86 3300005578 Ga0068854_100015686 Ga0068854_1000156866 212
87 3300005578 Ga0068854_100036262 Ga0068854_1000362622 212
88 3300013100 Ga0157373_10031179 Ga0157373_100311793 212
89 3300025981 Ga0207640_10029580 Ga0207640_100295803 212
90 3300025981 Ga0207640_10035260 Ga0207640_100352604 212
91 3300026089 Ga0207648_10294045 Ga0207648_102940452 212
92 3300037312 Ga0395899_0022771 Ga0395899_0022771_553_1305 212
93 3300037312 Ga0395899_0203447 Ga0395899_0203447_115_855 212
94 3300037418 Ga0395900_0000968 Ga0395900_0000968_31570_32322 212
95 3300037418 Ga0395900_0249723 Ga0395900_0249723_1012_1749 212
96 3300037418 Ga0395900_0342398 Ga0395900_0342398_653_1393 212
97 3300037466 Ga0395898_0001961 Ga0395898_0001961_19584_20309 212
98 3300037466 Ga0395898_0020946 Ga0395898_0020946_3812_4564 212
99 3300037471 Ga0395905_0005686 Ga0395905_0005686_6025_6777 212
100 3300037471 Ga0395905_0006451 Ga0395905_0006451_5688_6428 212
101 3300037471 Ga0395905_0079552 Ga0395905_0079552_1415_2149 212
102 3300037471 Ga0395905_0224620 Ga0395905_0224620_29_766 212
103 3300038443 Ga0395901_0010473 Ga0395901_0010473_4182_4934 212
104 3300038443 Ga0395901_0013560 Ga0395901_0013560_5623_6363 212
105 3300038443 Ga0395901_0017880 Ga0395901_0017880_6043_6768 212
106 3300042157 Ga0439458_0001618 Ga0439458_0001618_945_1682 212
107 3300005331 Ga0070670_100396535 Ga0070670_1003965352 213
108 3300025925 Ga0207650_10377107 Ga0207650_103771071 213
109 3300031824 Ga0307413_10055538 Ga0307413_100555382 213
110 3300031852 Ga0307410_10173899 Ga0307410_101738992 213
111 3300032002 Ga0307416_100235245 Ga0307416_1002352452 213
112 3300032126 Ga0307415_100238797 Ga0307415_1002387971 213
113 3300037418 Ga0395900_0067801 Ga0395900_0067801_2858_3592 213
114 3300038443 Ga0395901_0000163 Ga0395901_0000163_39516_40253 213
115 3300038443 Ga0395901_0164372 Ga0395901_0164372_246_980 213
116 3300048915 Ga0496112_0042330 Ga0496112_0042330_3261_3986 213
117 3300048916 Ga0496113_0020112 Ga0496113_0020112_3055_3780 213
118 3300005331 Ga0070670_100104764 Ga0070670_1001047644 214
119 3300005353 Ga0070669_100234565 Ga0070669_1002345652 214
120 3300005563 Ga0068855_100300775 Ga0068855_1003007753 214
121 3300005564 Ga0070664_100373418 Ga0070664_1003734181 214
122 3300005577 Ga0068857_100237943 Ga0068857_1002379433 214
123 3300005618 Ga0068864_100874146 Ga0068864_1008741461 214
124 3300025908 Ga0207643_10110999 Ga0207643_101109991 214
125 3300025926 Ga0207659_10036165 Ga0207659_100361654 214
126 3300025949 Ga0207667_10138676 Ga0207667_101386762 214
127 3300028380 Ga0268265_10118995 Ga0268265_101189953 214
128 3300031731 Ga0307405_10268391 Ga0307405_102683912 214
129 3300031901 Ga0307406_10039665 Ga0307406_100396652 214
130 3300032126 Ga0307415_100234006 Ga0307415_1002340061 214
131 3300037471 Ga0395905_0023458 Ga0395905_0023458_5012_5743 214
132 3300042006 Ga0439432_022167 Ga0439432_022167_229_984 214
133 3300042007 Ga0439449_0128581 Ga0439449_0128581_154_909 214
134 3300042876 Ga0451577_0215105 Ga0451577_0215105_82_834 214
135 3300031548 Ga0307408_100146408 Ga0307408_1001464082 215
136 3300031901 Ga0307406_10029891 Ga0307406_100298911 215
137 3300032002 Ga0307416_100043161 Ga0307416_1000431614 215
138 3300037418 Ga0395900_0023882 Ga0395900_0023882_738_1493 215
139 3300037471 Ga0395905_0004891 Ga0395905_0004891_5703_6458 215
140 3300038443 Ga0395901_0366991 Ga0395901_0366991_119_874 215
141 3300044693 Ga0466961_0188641 Ga0466961_0188641_187_912 215
142 3300045049 Ga0466959_0093308 Ga0466959_0093308_69_794 215
143 3300005327 Ga0070658_10014524 Ga0070658_100145244 216
144 3300005548 Ga0070665_100032897 Ga0070665_1000328972 216
145 3300013104 Ga0157370_10402290 Ga0157370_104022902 216
146 3300025909 Ga0207705_10173092 Ga0207705_101730921 216
147 3300026142 Ga0207698_10371221 Ga0207698_103712212 216
148 3300028379 Ga0268266_10024946 Ga0268266_100249466 216
149 3300031548 Ga0307408_100025110 Ga0307408_1000251105 216
150 3300032004 Ga0307414_10167003 Ga0307414_101670032 216
151 3300037418 Ga0395900_0250933 Ga0395900_0250933_673_1413 216
152 3300037471 Ga0395905_0000735 Ga0395905_0000735_41213_41950 216
153 3300037471 Ga0395905_0044552 Ga0395905_0044552_2127_2852 216
154 3300049765 Ga0501268_002453 Ga0501268_002453_23_757 216
155 3300053134 Ga0500658_0000194 Ga0500658_0000194_8747_9475 216
156 3300005564 Ga0070664_100607044 Ga0070664_1006070441 217
157 3300009177 Ga0105248_10307198 Ga0105248_103071981 217
158 3300013104 Ga0157370_10053896 Ga0157370_100538962 217
159 3300021384 Ga0213876_10029539 Ga0213876_100295392 217
160 3300025941 Ga0207711_10775704 Ga0207711_107757041 217
161 3300025960 Ga0207651_10043633 Ga0207651_100436332 217
162 3300031548 Ga0307408_100087115 Ga0307408_1000871152 217
163 3300031852 Ga0307410_10189419 Ga0307410_101894193 217
164 3300031852 Ga0307410_10682659 Ga0307410_106826591 217
165 3300031901 Ga0307406_10225197 Ga0307406_102251971 217
166 3300031903 Ga0307407_10200908 Ga0307407_102009082 217
167 3300032002 Ga0307416_100323063 Ga0307416_1003230633 217
168 3300032004 Ga0307414_10502940 Ga0307414_105029402 217
169 3300032005 Ga0307411_10126912 Ga0307411_101269122 217
170 3300032005 Ga0307411_10196039 Ga0307411_101960393 217
171 3300032005 Ga0307411_10217698 Ga0307411_102176982 217
172 3300032126 Ga0307415_100043989 Ga0307415_1000439894 217
173 3300037312 Ga0395899_0002780 Ga0395899_0002780_7800_8537 217
174 3300037312 Ga0395899_0138778 Ga0395899_0138778_806_1561 217
175 3300037418 Ga0395900_0000221 Ga0395900_0000221_71543_72280 217
176 3300037418 Ga0395900_0128441 Ga0395900_0128441_370_1125 217
177 3300037418 Ga0395900_0133723 Ga0395900_0133723_867_1616 217
178 3300037466 Ga0395898_0000053 Ga0395898_0000053_207321_208058 217
179 3300037466 Ga0395898_0627368 Ga0395898_0627368_114_869 217
180 3300037471 Ga0395905_0000031 Ga0395905_0000031_78700_79437 217
181 3300037471 Ga0395905_0141675 Ga0395905_0141675_610_1365 217
182 3300038443 Ga0395901_0000469 Ga0395901_0000469_40767_41501 217
183 3300038443 Ga0395901_0220121 Ga0395901_0220121_933_1688 217
184 3300038443 Ga0395901_0369089 Ga0395901_0369089_334_1083 217
185 3300039437 Ga0436365_0402833 Ga0436365_0402833_1419_2153 217
186 3300041505 Ga0451849_1117364 Ga0451849_1117364_194_955 217
187 3300044658 Ga0466972_0058232 Ga0466972_0058232_930_1685 217
188 3300044684 Ga0466966_0029913 Ga0466966_0029913_1212_1949 217
189 3300044693 Ga0466961_0141764 Ga0466961_0141764_547_1302 217
190 3300044706 Ga0466964_0021015 Ga0466964_0021015_453_1208 217
191 3300044735 Ga0466968_0067375 Ga0466968_0067375_219_974 217
192 3300044765 Ga0466970_0047063 Ga0466970_0047063_512_1249 217
193 3300044842 Ga0466957_0270076 Ga0466957_0270076_65_820 217
194 3300045049 Ga0466959_0039218 Ga0466959_0039218_2572_3327 217
195 3300045836 Ga0466958_0007407 Ga0466958_0007407_1548_2303 217
196 3300045836 Ga0466958_0013343 Ga0466958_0013343_746_1483 217
197 3300005327 Ga0070658_10150010 Ga0070658_101500102 218
198 3300005336 Ga0070680_100007743 Ga0070680_1000077431 218
199 3300005344 Ga0070661_100142440 Ga0070661_1001424401 218
200 3300005366 Ga0070659_100039124 Ga0070659_1000391242 218
201 3300005458 Ga0070681_10035548 Ga0070681_100355482 218
202 3300005530 Ga0070679_100018253 Ga0070679_1000182532 218
203 3300005539 Ga0068853_100035713 Ga0068853_1000357132 218
204 3300005547 Ga0070693_100083745 Ga0070693_1000837452 218
205 3300013100 Ga0157373_10020196 Ga0157373_100201965 218
206 3300025909 Ga0207705_10002069 Ga0207705_1000206915 218
207 3300025917 Ga0207660_10384021 Ga0207660_103840211 218
208 3300025920 Ga0207649_10050773 Ga0207649_100507733 218
209 3300025921 Ga0207652_10017090 Ga0207652_100170903 218
210 3300025932 Ga0207690_10006912 Ga0207690_100069127 218
211 3300025944 Ga0207661_10152760 Ga0207661_101527601 218
212 3300026067 Ga0207678_10352552 Ga0207678_103525521 218
213 3300026078 Ga0207702_10249283 Ga0207702_102492831 218
214 3300026142 Ga0207698_10273683 Ga0207698_102736832 218
215 3300037312 Ga0395899_0004300 Ga0395899_0004300_9471_10205 218
216 3300037312 Ga0395899_0076542 Ga0395899_0076542_327_1064 218
217 3300037471 Ga0395905_0004414 Ga0395905_0004414_503_1243 218
218 3300037471 Ga0395905_0019042 Ga0395905_0019042_5102_5839 218
219 3300038443 Ga0395901_0035840 Ga0395901_0035840_3829_4563 218
220 3300038443 Ga0395901_0333361 Ga0395901_0333361_514_1254 218
221 3300042007 Ga0439449_0051218 Ga0439449_0051218_741_1493 218
222 3300005293 Ga0065715_10019104 Ga0065715_100191043 219
223 3300005328 Ga0070676_10031422 Ga0070676_100314224 219
224 3300005331 Ga0070670_100021582 Ga0070670_1000215824 219
225 3300005331 Ga0070670_100089817 Ga0070670_1000898172 219
226 3300005333 Ga0070677_10150589 Ga0070677_101505892 219
227 3300005347 Ga0070668_100088496 Ga0070668_1000884963 219
228 3300005353 Ga0070669_100071343 Ga0070669_1000713433 219
229 3300005354 Ga0070675_100002201 Ga0070675_1000022016 219
230 3300005364 Ga0070673_100125368 Ga0070673_1001253682 219
231 3300005457 Ga0070662_100085668 Ga0070662_1000856684 219
232 3300005543 Ga0070672_100034782 Ga0070672_1000347826 219
233 3300025907 Ga0207645_10090382 Ga0207645_100903822 219
234 3300025923 Ga0207681_10029760 Ga0207681_100297605 219
235 3300025925 Ga0207650_10022254 Ga0207650_100222542 219
236 3300025925 Ga0207650_10062204 Ga0207650_100622042 219
237 3300025926 Ga0207659_10008159 Ga0207659_100081593 219
238 3300025926 Ga0207659_10071063 Ga0207659_100710633 219
239 3300025933 Ga0207706_10083007 Ga0207706_100830071 219
240 3300025940 Ga0207691_10018513 Ga0207691_100185136 219
241 3300026121 Ga0207683_10400354 Ga0207683_104003541 219
242 3300005355 Ga0070671_100452379 Ga0070671_1004523792 220
243 3300025940 Ga0207691_10689680 Ga0207691_106896802 220
244 3300026023 Ga0207677_10211285 Ga0207677_102112853 220
245 3300031903 Ga0307407_10295087 Ga0307407_102950871 220
246 3300046522 Ga0495643_0212973 Ga0495643_0212973_73_822 220
247 3300005331 Ga0070670_100008647 Ga0070670_1000086476 221
248 3300005366 Ga0070659_100154732 Ga0070659_1001547322 221
249 3300005457 Ga0070662_100031843 Ga0070662_1000318432 221
250 3300005564 Ga0070664_100090518 Ga0070664_1000905184 221
251 3300005844 Ga0068862_100479517 Ga0068862_1004795172 221
252 3300014745 Ga0157377_10053228 Ga0157377_100532284 221
253 3300025925 Ga0207650_10008196 Ga0207650_100081964 221
254 3300025933 Ga0207706_10429001 Ga0207706_104290011 221
255 3300025945 Ga0207679_10449112 Ga0207679_104491122 221
256 3300032002 Ga0307416_100048577 Ga0307416_1000485774 221
257 3300032126 Ga0307415_100133721 Ga0307415_1001337212 221
258 3300037471 Ga0395905_0061782 Ga0395905_0061782_2121_2858 221
259 3300038443 Ga0395901_0123692 Ga0395901_0123692_1202_1939 221
260 3300005327 Ga0070658_10320340 Ga0070658_103203401 222
261 3300005564 Ga0070664_100104208 Ga0070664_1001042084 222
262 3300009176 Ga0105242_10177910 Ga0105242_101779102 222
263 3300025934 Ga0207686_10242264 Ga0207686_102422642 222
264 3300025981 Ga0207640_10145440 Ga0207640_101454401 222
265 3300037418 Ga0395900_0922453 Ga0395900_0922453_24_761 222
266 3300038443 Ga0395901_0451646 Ga0395901_0451646_492_1229 222
267 3300042122 Ga0450920_026938 Ga0450920_026938_160_921 222
268 3300005335 Ga0070666_10065689 Ga0070666_100656892 223
269 3300005355 Ga0070671_100093739 Ga0070671_1000937393 223
270 3300005841 Ga0068863_100007726 Ga0068863_1000077266 223
271 3300014325 Ga0163163_10210786 Ga0163163_102107863 223
272 3300025903 Ga0207680_10007732 Ga0207680_100077322 223
273 3300026116 Ga0207674_10000756 Ga0207674_1000075628 223
274 3300037471 Ga0395905_0003694 Ga0395905_0003694_15023_15772 223
275 3300042005 Ga0439448_0085469 Ga0439448_0085469_120_857 223
276 3300042012 Ga0439455_0003025 Ga0439455_0003025_860_1597 223
277 3300042157 Ga0439458_0021002 Ga0439458_0021002_441_1178 223
278 3300001904 JGI24736J21556_1016406 JGI24736J21556_10164062 224
279 3300002067 JGI24735J21928_10003507 JGI24735J21928_100035076 224
280 3300002067 JGI24735J21928_10071646 JGI24735J21928_100716462 224
281 3300005327 Ga0070658_10132875 Ga0070658_101328752 224
282 3300005327 Ga0070658_10312141 Ga0070658_103121411 224
283 3300005329 Ga0070683_100044160 Ga0070683_1000441606 224
284 3300005329 Ga0070683_100116560 Ga0070683_1001165603 224
285 3300005330 Ga0070690_100103997 Ga0070690_1001039973 224
286 3300005331 Ga0070670_100003619 Ga0070670_1000036197 224
287 3300005331 Ga0070670_100017460 Ga0070670_1000174605 224
288 3300005335 Ga0070666_10006214 Ga0070666_100062147 224
289 3300005338 Ga0068868_100034206 Ga0068868_1000342063 224
290 3300005339 Ga0070660_100071797 Ga0070660_1000717973 224
291 3300005339 Ga0070660_100077654 Ga0070660_1000776544 224
292 3300005340 Ga0070689_100261650 Ga0070689_1002616502 224
293 3300005341 Ga0070691_10008635 Ga0070691_100086351 224
294 3300005344 Ga0070661_100007349 Ga0070661_1000073491 224
295 3300005344 Ga0070661_100038051 Ga0070661_1000380514 224
296 3300005344 Ga0070661_100067692 Ga0070661_1000676924 224
297 3300005344 Ga0070661_100076832 Ga0070661_1000768321 224
298 3300005364 Ga0070673_100001900 Ga0070673_10000190010 224
299 3300005365 Ga0070688_100372263 Ga0070688_1003722632 224
300 3300005366 Ga0070659_100078215 Ga0070659_1000782152 224
301 3300005366 Ga0070659_100118786 Ga0070659_1001187862 224
302 3300005435 Ga0070714_100052566 Ga0070714_1000525662 224
303 3300005435 Ga0070714_100207466 Ga0070714_1002074661 224
304 3300005456 Ga0070678_100000630 Ga0070678_1000006307 224
305 3300005456 Ga0070678_100136030 Ga0070678_1001360302 224
306 3300005457 Ga0070662_100022468 Ga0070662_1000224681 224
307 3300005458 Ga0070681_10079488 Ga0070681_100794881 224
308 3300005466 Ga0070685_10087557 Ga0070685_100875573 224
309 3300005530 Ga0070679_100245692 Ga0070679_1002456922 224
310 3300005530 Ga0070679_100320762 Ga0070679_1003207621 224
311 3300005535 Ga0070684_100025627 Ga0070684_1000256273 224
312 3300005539 Ga0068853_100015827 Ga0068853_1000158275 224
313 3300005539 Ga0068853_100020632 Ga0068853_1000206325 224
314 3300005543 Ga0070672_100029297 Ga0070672_1000292973 224
315 3300005547 Ga0070693_100307414 Ga0070693_1003074142 224
316 3300005563 Ga0068855_100053659 Ga0068855_1000536594 224
317 3300005564 Ga0070664_100013303 Ga0070664_1000133037 224
318 3300005564 Ga0070664_100018769 Ga0070664_1000187696 224
319 3300005564 Ga0070664_100020614 Ga0070664_1000206145 224
320 3300005564 Ga0070664_100043491 Ga0070664_1000434911 224
321 3300005577 Ga0068857_100025979 Ga0068857_1000259796 224
322 3300005577 Ga0068857_100041788 Ga0068857_1000417882 224
323 3300005577 Ga0068857_100054910 Ga0068857_1000549103 224
324 3300005578 Ga0068854_100010860 Ga0068854_1000108603 224
325 3300005578 Ga0068854_100018007 Ga0068854_1000180076 224
326 3300005614 Ga0068856_100078003 Ga0068856_1000780033 224
327 3300005614 Ga0068856_100133696 Ga0068856_1001336961 224
328 3300005614 Ga0068856_100297950 Ga0068856_1002979501 224
329 3300005616 Ga0068852_100011217 Ga0068852_1000112177 224
330 3300005616 Ga0068852_100208671 Ga0068852_1002086712 224
331 3300005616 Ga0068852_100253948 Ga0068852_1002539482 224
332 3300005618 Ga0068864_100023431 Ga0068864_1000234314 224
333 3300005618 Ga0068864_100118668 Ga0068864_1001186683 224
334 3300005834 Ga0068851_10058848 Ga0068851_100588483 224
335 3300005834 Ga0068851_10128923 Ga0068851_101289232 224
336 3300005841 Ga0068863_100030469 Ga0068863_1000304694 224
337 3300005842 Ga0068858_100003126 Ga0068858_10000312612 224
338 3300005843 Ga0068860_100268026 Ga0068860_1002680263 224
339 3300006237 Ga0097621_100004933 Ga0097621_1000049335 224
340 3300006358 Ga0068871_100005449 Ga0068871_1000054495 224
341 3300006358 Ga0068871_100476523 Ga0068871_1004765231 224
342 3300009174 Ga0105241_10066740 Ga0105241_100667404 224
343 3300009174 Ga0105241_10514203 Ga0105241_105142031 224
344 3300009177 Ga0105248_10002629 Ga0105248_1000262910 224
345 3300009177 Ga0105248_10069239 Ga0105248_100692393 224
346 3300009545 Ga0105237_10155437 Ga0105237_101554371 224
347 3300009551 Ga0105238_10159429 Ga0105238_101594292 224
348 3300010375 Ga0105239_10468523 Ga0105239_104685231 224
349 3300011119 Ga0105246_10037031 Ga0105246_100370313 224
350 3300013100 Ga0157373_10010802 Ga0157373_100108026 224
351 3300013102 Ga0157371_10037560 Ga0157371_100375601 224
352 3300013104 Ga0157370_10010418 Ga0157370_100104189 224
353 3300013104 Ga0157370_10046919 Ga0157370_100469196 224
354 3300013104 Ga0157370_10163559 Ga0157370_101635593 224
355 3300013104 Ga0157370_10359744 Ga0157370_103597441 224
356 3300013105 Ga0157369_10068780 Ga0157369_100687806 224
357 3300013105 Ga0157369_10129608 Ga0157369_101296083 224
358 3300013296 Ga0157374_10001508 Ga0157374_1000150814 224
359 3300013306 Ga0163162_10002279 Ga0163162_1000227911 224
360 3300013307 Ga0157372_10002710 Ga0157372_100027101 224
361 3300013308 Ga0157375_10001921 Ga0157375_1000192113 224
362 3300014325 Ga0163163_10002130 Ga0163163_1000213010 224
363 3300025321 Ga0207656_10088768 Ga0207656_100887681 224
364 3300025321 Ga0207656_10113407 Ga0207656_101134072 224
365 3300025903 Ga0207680_10013223 Ga0207680_100132232 224
366 3300025904 Ga0207647_10001865 Ga0207647_100018655 224
367 3300025904 Ga0207647_10026799 Ga0207647_100267994 224
368 3300025909 Ga0207705_10068786 Ga0207705_100687863 224
369 3300025909 Ga0207705_10080309 Ga0207705_100803093 224
370 3300025909 Ga0207705_10251735 Ga0207705_102517352 224
371 3300025912 Ga0207707_10056812 Ga0207707_100568124 224
372 3300025913 Ga0207695_10055298 Ga0207695_100552985 224
373 3300025914 Ga0207671_10035639 Ga0207671_100356392 224
374 3300025917 Ga0207660_10085185 Ga0207660_100851852 224
375 3300025919 Ga0207657_10004331 Ga0207657_100043315 224
376 3300025919 Ga0207657_10079415 Ga0207657_100794153 224
377 3300025920 Ga0207649_10014720 Ga0207649_100147202 224
378 3300025920 Ga0207649_10058372 Ga0207649_100583724 224
379 3300025920 Ga0207649_10067533 Ga0207649_100675331 224
380 3300025920 Ga0207649_10120589 Ga0207649_101205892 224
381 3300025921 Ga0207652_10104809 Ga0207652_101048094 224
382 3300025924 Ga0207694_10002652 Ga0207694_100026523 224
383 3300025924 Ga0207694_10777503 Ga0207694_107775031 224
384 3300025925 Ga0207650_10004500 Ga0207650_100045004 224
385 3300025926 Ga0207659_10374161 Ga0207659_103741612 224
386 3300025929 Ga0207664_10024751 Ga0207664_100247515 224
387 3300025929 Ga0207664_10144544 Ga0207664_101445442 224
388 3300025931 Ga0207644_10000746 Ga0207644_100007469 224
389 3300025932 Ga0207690_10004345 Ga0207690_100043454 224
390 3300025932 Ga0207690_10022117 Ga0207690_100221175 224
391 3300025933 Ga0207706_10036568 Ga0207706_100365681 224
392 3300025940 Ga0207691_10000892 Ga0207691_1000089217 224
393 3300025941 Ga0207711_10001850 Ga0207711_1000185012 224
394 3300025944 Ga0207661_10003155 Ga0207661_100031559 224
395 3300025945 Ga0207679_10010222 Ga0207679_100102227 224
396 3300025945 Ga0207679_10287136 Ga0207679_102871361 224
397 3300025949 Ga0207667_10043334 Ga0207667_100433344 224
398 3300025960 Ga0207651_10019737 Ga0207651_100197374 224
399 3300025981 Ga0207640_10005356 Ga0207640_100053566 224
400 3300025981 Ga0207640_10075767 Ga0207640_100757672 224
401 3300025986 Ga0207658_10004498 Ga0207658_100044982 224
402 3300026023 Ga0207677_10244561 Ga0207677_102445612 224
403 3300026035 Ga0207703_10008160 Ga0207703_100081607 224
404 3300026041 Ga0207639_10000124 Ga0207639_1000012417 224
405 3300026041 Ga0207639_10015790 Ga0207639_100157906 224
406 3300026078 Ga0207702_10045189 Ga0207702_100451892 224
407 3300026078 Ga0207702_10067353 Ga0207702_100673534 224
408 3300026078 Ga0207702_10144387 Ga0207702_101443873 224
409 3300026078 Ga0207702_10262753 Ga0207702_102627532 224
410 3300026078 Ga0207702_10358274 Ga0207702_103582742 224
411 3300026078 Ga0207702_10483642 Ga0207702_104836421 224
412 3300026088 Ga0207641_10013067 Ga0207641_100130674 224
413 3300026095 Ga0207676_10002747 Ga0207676_1000274715 224
414 3300026116 Ga0207674_10001923 Ga0207674_1000192326 224
415 3300026116 Ga0207674_10007288 Ga0207674_100072884 224
416 3300026121 Ga0207683_10003876 Ga0207683_100038765 224
417 3300026121 Ga0207683_10297908 Ga0207683_102979082 224
418 3300026142 Ga0207698_10034677 Ga0207698_100346774 224
419 3300026142 Ga0207698_10039763 Ga0207698_100397633 224
420 3300026142 Ga0207698_10737390 Ga0207698_107373902 224
421 3300026142 Ga0207698_10779020 Ga0207698_107790202 224
422 3300028381 Ga0268264_10389702 Ga0268264_103897022 224
423 3300031731 Ga0307405_10006118 Ga0307405_100061186 224
424 3300031824 Ga0307413_10058949 Ga0307413_100589492 224
425 3300031852 Ga0307410_10101152 Ga0307410_101011522 224
426 3300031852 Ga0307410_10437377 Ga0307410_104373772 224
427 3300031901 Ga0307406_10107224 Ga0307406_101072243 224
428 3300031901 Ga0307406_10286112 Ga0307406_102861122 224
429 3300031995 Ga0307409_100044740 Ga0307409_1000447404 224
430 3300031995 Ga0307409_100109470 Ga0307409_1001094703 224
431 3300032005 Ga0307411_10833988 Ga0307411_108339881 224
432 3300032126 Ga0307415_100029468 Ga0307415_1000294683 224
433 3300037312 Ga0395899_0062084 Ga0395899_0062084_695_1432 224
434 3300037418 Ga0395900_0034402 Ga0395900_0034402_3038_3775 224
435 3300037418 Ga0395900_0049293 Ga0395900_0049293_1369_2106 224
436 3300037418 Ga0395900_0145227 Ga0395900_0145227_76_813 224
437 3300037466 Ga0395898_0024770 Ga0395898_0024770_2729_3466 224
438 3300037466 Ga0395898_0124354 Ga0395898_0124354_1540_2277 224
439 3300037471 Ga0395905_0003464 Ga0395905_0003464_9814_10551 224
440 3300037471 Ga0395905_0103444 Ga0395905_0103444_434_1171 224
441 3300037471 Ga0395905_0320990 Ga0395905_0320990_617_1354 224
442 3300038443 Ga0395901_0010246 Ga0395901_0010246_444_1181 224
443 3300038443 Ga0395901_0431223 Ga0395901_0431223_528_1265 224
444 3300046684 Ga0495669_0004740 Ga0495669_0004740_1564_2289 224
445 3300048903 Ga0496100_0134604 Ga0496100_0134604_647_1384 224
446 3300048904 Ga0496101_0154195 Ga0496101_0154195_192_929 224
447 3300048904 Ga0496101_0345838 Ga0496101_0345838_265_1002 224
448 3300048905 Ga0496102_0180825 Ga0496102_0180825_430_1167 224
449 3300048909 Ga0496106_0057281 Ga0496106_0057281_207_944 224
450 3300048910 Ga0496107_0042554 Ga0496107_0042554_790_1527 224
451 3300048910 Ga0496107_0262397 Ga0496107_0262397_101_838 224
452 3300048911 Ga0496108_0001090 Ga0496108_0001090_11105_11842 224
453 3300048912 Ga0496109_0049291 Ga0496109_0049291_64_801 224
454 3300048913 Ga0496110_0000437 Ga0496110_0000437_19584_20321 224
455 3300048913 Ga0496110_0022445 Ga0496110_0022445_3344_4087 224
456 3300048914 Ga0496111_0009715 Ga0496111_0009715_5629_6366 224
457 3300048915 Ga0496112_0031168 Ga0496112_0031168_629_1372 224
458 3300048915 Ga0496112_0054147 Ga0496112_0054147_2493_3230 224
459 3300048916 Ga0496113_0308095 Ga0496113_0308095_265_1002 224
460 3300048917 Ga0496114_0005913 Ga0496114_0005913_3144_3881 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03588

Leu_Phe_trans

Leucyl/phenylalanyl-tRNA protein transferase

6

174

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z3n-assembly1.cif.gz_B complex structure of lf-transferase and peptide b 0.9249 4 186
2dps-assembly1.cif.gz_A structure of leucyl/phenylalanyl-trna-protein transferase 0.9212 4 197
2z3l-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9201 4 197
2z3o-assembly1.cif.gz_A complex structure of lf-transferase and phenylalanine 0.9148 4 197
2cxa-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9146 4 193
ID Description Score Start End Superfamily
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9178 36 193 3.40.630.70
af_O96210_178_350_3.40.630.70 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.9157 37 186 3.40.630.70
2z3kA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Leucyl/phenylalanyl-tRNA-protein transferase, C-terminal domain 0.8459 36 193 3.40.630.70
af_P9WKI9_1_164_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8435 100 116 3.30.540.10
af_K7LQW1_676_805_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8194 98 149 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A547LTS0-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9756 3 187 GO:0005737
GO:0008914
GO:0030163
AF-A0A7T8SKA1-F1-model_v4 deleted 0.9745 20 187
AF-A0A3R7T362-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase 0.9718 99 184 GO:0005737
GO:0008914
GO:0030163
AF-A0A7V9FPZ1-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase 0.9718 89 184 GO:0005737
GO:0008914
GO:0030163
AF-A0A1R0F6V6-F1-model_v4 Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6) (L/F-transferase) (Leucyltransferase) (Phenyalanyltransferase) 0.9698 20 187 GO:0005737
GO:0008914
GO:0030163

Feature Viewer

pLDDT pTM Quality
91.03 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map