F448560

General Info

Members Datasets Scaffolds Average Seq Length
460 225 921 163

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10767079|Ga0207668_107670791
Length 188
Sequence LKKFIEYFFRFQKYAILIRIKKYVCGAMINQSVYLLIGSNVGDRRKHLSDALWAIETRAGVIRGRSSVYETAAWGKTDQPSFYNQAIRITTFLNPSELLAQLQLIEKSLGRERKEKWGERVIDIDILFFGDHIIDTPDLKVPHPELQNRRFALVPMSEIADDLIHPRLYQTIHELLKNCADTLPVKKI

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
199 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
212 2738541302 Pedobacter sp. CF074 Isolate Unclassified
213 2739367651 Pedobacter sp. OK291 Isolate Unclassified
214 2739367656 Pedobacter sp. CF523 Isolate Unclassified
215 2739367663 Pedobacter sp. YR510 Isolate Unclassified
216 2818991437 Pedobacter terrae 518 Isolate Unclassified
217 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
218 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
219 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
220 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
221 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
222 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
223 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
224 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
225 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 0
Isolates 3.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0
Rhizoplane 0.87
Rhizosphere 90.22
Stem 0
Stem Tuber 0
Unclassified 19.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10767079 3300025972 Bacteria 852
2 JGI25152J39213_1000017 3300002773 Bacteria 109718
3 JGI25150J39212_1000001 3300002774 Bacteria 1318726
4 JGI25151J46595_10000001 3300003187 Bacteria 887211
5 JGI25153J46596_10000053 3300003215 Bacteria 138301
6 rootH1_10001275 3300003316 Bacteria 21026
7 rootH1_10019234 3300003316 Bacteria 23179
8 rootH2_10002905 3300003320 Bacteria 36151
9 rootH2_10071687 3300003320 Unclassified 1256
10 rootL2_10000133 3300003322 Bacteria 40358
11 rootL2_10184856 3300003322 Bacteria 5341
12 rootL2_10276523 3300003322 Bacteria 3056
13 rootH1_10015770 3300003323 Bacteria 25525
14 rootH1_10029390 3300003316 Bacteria 4608
15 rootH1_10029390 3300003323 Bacteria 24130
16 rootH1_10037052 3300003323 Bacteria 14989
17 rootH1_10037070 3300003323 Bacteria 2989
18 rootH1_10042262 3300003323 Bacteria 8082
19 rootH1_10144022 3300003323 Bacteria 1284
20 Ga0055536_1000001 3300003781 Bacteria 630663
21 Ga0055530_10006389 3300003791 Bacteria 5282
22 Ga0065165_1014484 3300005262 Unclassified 3059
23 Ga0065714_10002285 3300005288 Bacteria 27785
24 Ga0065714_10002947 3300005288 Bacteria 9455
25 Ga0070676_10000263 3300005328 Bacteria 22940
26 Ga0070676_10017885 3300005328 Bacteria 3925
27 Ga0070676_10019279 3300005328 Bacteria 3793
28 Ga0070676_10246114 3300005328 Unclassified 1191
29 Ga0070683_100087498 3300005329 Unclassified 2922
30 Ga0070690_100311665 3300005330 Unclassified 1131
31 Ga0070670_100052282 3300005331 Unclassified 3508
32 Ga0070670_100078185 3300005331 Unclassified 2842
33 Ga0070670_100086988 3300005331 Bacteria 2685
34 Ga0070677_10005260 3300005333 Bacteria 4259
35 Ga0068869_100146755 3300005334 Bacteria 1826
36 Ga0068869_100175527 3300005334 Bacteria 1677
37 Ga0068869_100574013 3300005334 Unclassified 950
38 Ga0070666_10004806 3300005335 Bacteria 8262
39 Ga0070666_10009062 3300005335 Bacteria 6203
40 Ga0070682_100000044 3300005337 Bacteria 133653
41 Ga0068868_100001950 3300005338 Bacteria 14152
42 Ga0068868_100003187 3300005338 Bacteria 11411
43 Ga0068868_100043145 3300005338 Unclassified 3523
44 Ga0068868_100084823 3300005338 Bacteria 2544
45 Ga0068868_100098052 3300005338 Bacteria 2369
46 Ga0068868_100764009 3300005338 Bacteria 869
47 Ga0070689_100005285 3300005340 Bacteria 8798
48 Ga0070661_100014590 3300005344 Bacteria 5538
49 Ga0070661_100735017 3300005344 Unclassified 806
50 Ga0070668_100000106 3300005347 Bacteria 51244
51 Ga0070668_100036094 3300005347 Bacteria 3772
52 Ga0070669_100041950 3300005353 Bacteria 3329
53 Ga0070669_100491504 3300005353 Bacteria 1017
54 Ga0070675_100220545 3300005354 Bacteria 1651
55 Ga0070671_100002242 3300005355 Bacteria 14920
56 Ga0070671_100077412 3300005355 Bacteria 2779
57 Ga0070671_100134157 3300005355 Bacteria 2086
58 Ga0070671_100321168 3300005355 Bacteria 1319
59 Ga0070674_100234659 3300005356 Bacteria 1433
60 Ga0070673_100000229 3300005364 Bacteria 28088
61 Ga0070673_100007488 3300005364 Bacteria 7206
62 Ga0070673_100035166 3300005364 Unclassified 3796
63 Ga0070688_100005254 3300005365 Bacteria 6806
64 Ga0070688_100905940 3300005365 Unclassified 696
65 Ga0070667_100000931 3300005367 Bacteria 27021
66 Ga0070667_100009450 3300005367 Bacteria 8088
67 Ga0070667_100088830 3300005367 Unclassified 2654
68 Ga0070667_100355989 3300005367 Bacteria 1326
69 Ga0070667_100500710 3300005367 Bacteria 1113
70 Ga0070667_100528819 3300005367 Bacteria 1082
71 Ga0070700_100635377 3300005441 Bacteria 841
72 Ga0070663_100104642 3300005455 Unclassified 2117
73 Ga0070663_100620519 3300005455 Unclassified 911
74 Ga0070663_100890908 3300005455 Bacteria 768
75 Ga0070678_100008756 3300005456 Bacteria 6080
76 Ga0070678_100052658 3300005456 Bacteria 2957
77 Ga0070678_100193333 3300005456 Unclassified 1674
78 Ga0070662_100009238 3300005457 Bacteria 6440
79 Ga0070662_100034986 3300005457 Unclassified 3545
80 Ga0070662_100514852 3300005457 Bacteria 999
81 Ga0068867_100001703 3300005459 Bacteria 15314
82 Ga0068867_100009241 3300005459 Bacteria 6956
83 Ga0068867_100035369 3300005459 Bacteria 3623
84 Ga0068867_100077339 3300005459 Bacteria 2500
85 Ga0070699_100449508 3300005518 Bacteria 1168
86 Ga0070684_100010684 3300005535 Bacteria 7282
87 Ga0068853_100072516 3300005539 Unclassified 3001
88 Ga0068853_100180102 3300005539 Unclassified 1916
89 Ga0068853_100870889 3300005539 Bacteria 864
90 Ga0070672_100000325 3300005543 Bacteria 27226
91 Ga0070672_100006683 3300005543 Bacteria 7770
92 Ga0070672_100035809 3300005543 Unclassified 3774
93 Ga0070686_100151912 3300005544 Bacteria 1623
94 Ga0070665_100000570 3300005548 Bacteria 51526
95 Ga0070665_100045100 3300005548 Bacteria 4427
96 Ga0070665_100322144 3300005548 Bacteria 1550
97 Ga0068855_100301826 3300005563 Bacteria 1773
98 Ga0068855_100432613 3300005563 Unclassified 1438
99 Ga0070664_100010065 3300005564 Bacteria 7666
100 Ga0070664_100559587 3300005564 Unclassified 1058
101 Ga0070664_101929676 3300005564 Unclassified 560
102 Ga0068857_100039837 3300005577 Bacteria 4164
103 Ga0068854_100030289 3300005578 Bacteria 3753
104 Ga0068854_100301672 3300005578 Bacteria 1296
105 Ga0068856_100179618 3300005614 Bacteria 2129
106 Ga0068859_100066631 3300005617 Bacteria 3636
107 Ga0068859_100202762 3300005617 Bacteria 2068
108 Ga0068859_100216204 3300005617 Unclassified 2004
109 Ga0068859_100307599 3300005617 Bacteria 1678
110 Ga0068859_100399066 3300005617 Bacteria 1471
111 Ga0068864_100001209 3300005618 Bacteria 21452
112 Ga0068864_100052879 3300005618 Unclassified 3501
113 Ga0068864_100734872 3300005618 Bacteria 966
114 Ga0068866_10018833 3300005718 Bacteria 3131
115 Ga0068866_10023694 3300005718 Bacteria 2858
116 Ga0068866_11183043 3300005718 Unclassified 551
117 Ga0068861_100728722 3300005719 Bacteria 924
118 Ga0068851_10093384 3300005834 Bacteria 1587
119 Ga0068851_10313135 3300005834 Unclassified 905
120 Ga0068870_10013382 3300005840 Bacteria 3855
121 Ga0068863_100003303 3300005841 Bacteria 15923
122 Ga0068863_100036503 3300005841 Unclassified 4682
123 Ga0068863_100073161 3300005841 Bacteria 3242
124 Ga0068863_100139222 3300005841 Bacteria 2319
125 Ga0068863_101916967 3300005841 Unclassified 602
126 Ga0068858_100001322 3300005842 Bacteria 25607
127 Ga0068858_100285677 3300005842 Unclassified 1571
128 Ga0068860_100014141 3300005843 Bacteria 7828
129 Ga0068860_100028713 3300005843 Bacteria 5355
130 Ga0068860_100084825 3300005843 Bacteria 3013
131 Ga0068860_100265273 3300005843 Bacteria 1675
132 Ga0068862_100498956 3300005844 Bacteria 1155
133 Ga0075366_10020956 3300006195 Bacteria 3798
134 Ga0097621_100000143 3300006237 Bacteria 43193
135 Ga0097621_100015299 3300006237 Bacteria 5770
136 Ga0097621_100088421 3300006237 Bacteria 2589
137 Ga0068871_100000741 3300006358 Bacteria 22178
138 Ga0068871_100002881 3300006358 Bacteria 11796
139 Ga0068871_100154122 3300006358 Bacteria 1961
140 Ga0075428_100045782 3300006844 Bacteria 4807
141 Ga0075428_101490096 3300006844 Bacteria 709
142 Ga0075430_100082739 3300006846 Bacteria 2690
143 Ga0068865_100000299 3300006881 Bacteria 27298
144 Ga0068865_100007419 3300006881 Bacteria 6747
145 Ga0068865_100192101 3300006881 Bacteria 1580
146 Ga0097620_100066632 3300006931 Bacteria 3636
147 Ga0097620_100202765 3300006931 Bacteria 2068
148 Ga0097620_100216219 3300006931 Unclassified 2004
149 Ga0097620_100307578 3300006931 Bacteria 1678
150 Ga0097620_100399047 3300006931 Bacteria 1471
151 Ga0097620_100864394 3300006931 Bacteria 990
152 Ga0105240_10000263 3300009093 Bacteria 103973
153 Ga0105240_10137465 3300009093 Bacteria 2925
154 Ga0111539_10087450 3300009094 Unclassified 3661
155 Ga0111539_10102168 3300009094 Bacteria 3365
156 Ga0105245_10366720 3300009098 Unclassified 1431
157 Ga0105243_10270072 3300009148 Unclassified 1526
158 Ga0105243_10351156 3300009148 Bacteria 1354
159 Ga0105241_10000384 3300009174 Bacteria 33496
160 Ga0105241_10053980 3300009174 Bacteria 3075
161 Ga0105242_10004236 3300009176 Bacteria 11182
162 Ga0105242_10022831 3300009176 Bacteria 4926
163 Ga0105242_10311998 3300009176 Unclassified 1439
164 Ga0105248_10293026 3300009177 Bacteria 1832
165 Ga0105248_12241268 3300009177 Bacteria 622
166 Ga0105237_10015253 3300009545 Bacteria 8004
167 Ga0105237_10770574 3300009545 Unclassified 969
168 Ga0105238_10000536 3300009551 Bacteria 39756
169 Ga0105249_10004490 3300009553 Bacteria 12063
170 Ga0105249_10015175 3300009553 Bacteria 6817
171 Ga0105249_10018666 3300009553 Bacteria 6176
172 Ga0105249_10051417 3300009553 Bacteria 3759
173 Ga0105249_10067702 3300009553 Bacteria 3290
174 Ga0105249_10626920 3300009553 Bacteria 1132
175 Ga0105249_10887002 3300009553 Bacteria 958
176 Ga0105249_10955690 3300009553 Bacteria 925
177 Ga0105249_11381920 3300009553 Bacteria 776
178 Ga0105249_11593814 3300009553 Bacteria 725
179 Ga0105239_10004319 3300010375 Bacteria 17042
180 Ga0105239_10353846 3300010375 Unclassified 1658
181 Ga0105239_10711924 3300010375 Bacteria 1148
182 Ga0105246_10020739 3300011119 Bacteria 4219
183 Ga0105246_10096265 3300011119 Unclassified 2145
184 Ga0105246_10282940 3300011119 Unclassified 1331
185 Ga0157373_10271312 3300013100 Bacteria 1201
186 Ga0157371_10000021 3300013102 Bacteria 301017
187 Ga0157371_10540030 3300013102 Bacteria 863
188 Ga0157370_10004406 3300013104 Bacteria 16155
189 Ga0157370_10178601 3300013104 Bacteria 1973
190 Ga0157369_10000008 3300013105 Bacteria 309315
191 Ga0157374_10000089 3300013296 Bacteria 89250
192 Ga0157374_10018673 3300013296 Bacteria 6125
193 Ga0157374_10053957 3300013296 Bacteria 3748
194 Ga0157378_10005286 3300013297 Bacteria 11339
195 Ga0157378_10040087 3300013297 Bacteria 4153
196 Ga0157378_10040776 3300013297 Bacteria 4118
197 Ga0157378_10055412 3300013297 Bacteria 3532
198 Ga0163162_10000084 3300013306 Bacteria 86252
199 Ga0163162_10000206 3300013306 Bacteria 54701
200 Ga0163162_10006680 3300013306 Bacteria 11191
201 Ga0163162_10013609 3300013306 Bacteria 7948
202 Ga0163162_10181511 3300013306 Bacteria 2231
203 Ga0163162_10217582 3300013306 Bacteria 2040
204 Ga0163162_11032835 3300013306 Bacteria 930
205 Ga0157372_10062059 3300013307 Unclassified 4186
206 Ga0157372_10741418 3300013307 Unclassified 1142
207 Ga0157372_11217905 3300013307 Bacteria 870
208 Ga0157372_11389841 3300013307 Bacteria 809
209 Ga0157375_10000057 3300013308 Bacteria 122654
210 Ga0157375_10003373 3300013308 Bacteria 13848
211 Ga0157375_10015071 3300013308 Bacteria 6913
212 Ga0157375_10038254 3300013308 Bacteria 4606
213 Ga0157375_10371592 3300013308 Bacteria 1596
214 Ga0163163_10000804 3300014325 Bacteria 26629
215 Ga0163163_10001267 3300014325 Bacteria 21322
216 Ga0163163_10084270 3300014325 Unclassified 3184
217 Ga0163163_10178860 3300014325 Bacteria 2168
218 Ga0163163_11563780 3300014325 Unclassified 721
219 Ga0157380_10147684 3300014326 Bacteria 2028
220 Ga0157380_10171989 3300014326 Bacteria 1894
221 Ga0157380_10203522 3300014326 Bacteria 1758
222 Ga0157380_10272033 3300014326 Unclassified 1545
223 Ga0157380_10465454 3300014326 Unclassified 1218
224 Ga0157380_10676268 3300014326 Unclassified 1033
225 Ga0157380_11258877 3300014326 Unclassified 785
226 Ga0157380_11450122 3300014326 Unclassified 738
227 Ga0182008_10002479 3300014497 Bacteria 11536
228 Ga0157377_10030923 3300014745 Bacteria 2905
229 Ga0157377_10190271 3300014745 Bacteria 1296
230 Ga0157377_10281154 3300014745 Bacteria 1091
231 Ga0157379_10000032 3300014968 Bacteria 83845
232 Ga0157379_10022190 3300014968 Bacteria 5625
233 Ga0157379_10060338 3300014968 Bacteria 3391
234 Ga0157379_10231472 3300014968 Unclassified 1675
235 Ga0157376_10000318 3300014969 Bacteria 32314
236 Ga0157376_10003039 3300014969 Bacteria 11492
237 Ga0157376_10249930 3300014969 Bacteria 1656
238 Ga0157376_10353049 3300014969 Unclassified 1408
239 Ga0157376_10609042 3300014969 Bacteria 1088
240 Ga0182006_1000091 3300015261 Bacteria 109227
241 Ga0182006_1001551 3300015261 Bacteria 13722
242 Ga0182007_10000003 3300015262 Bacteria 548244
243 Ga0183373_1001 3300015682 Bacteria 1410374
244 Ga0163161_10001232 3300017792 Bacteria 19196
245 Ga0163161_10023384 3300017792 Bacteria 4360
246 Ga0163161_10030785 3300017792 Unclassified 3822
247 Ga0163161_10081322 3300017792 Bacteria 2385
248 Ga0163161_10094297 3300017792 Unclassified 2219
249 Ga0163161_11291937 3300017792 Bacteria 634
250 Ga0207425_1000002 3300025245 Bacteria 1362590
251 Ga0209129_1000002 3300025258 Bacteria 1359086
252 Ga0209676_1000008 3300025292 Bacteria 991778
253 Ga0209025_1000004 3300025294 Bacteria 1361782
254 Ga0209758_1000006 3300025297 Bacteria 1359562
255 Ga0209050_1000045 3300025298 Bacteria 388022
256 Ga0207697_10023743 3300025315 Bacteria 2511
257 Ga0207697_10255000 3300025315 Unclassified 776
258 Ga0207688_10041309 3300025901 Unclassified 2565
259 Ga0207688_10384720 3300025901 Unclassified 868
260 Ga0207680_10000845 3300025903 Bacteria 14475
261 Ga0207680_10019077 3300025903 Bacteria 3662
262 Ga0207647_10051106 3300025904 Bacteria 2556
263 Ga0207647_10173864 3300025904 Unclassified 1253
264 Ga0207645_10000638 3300025907 Bacteria 29117
265 Ga0207645_10001413 3300025907 Bacteria 19673
266 Ga0207645_10073434 3300025907 Bacteria 2190
267 Ga0207645_10527396 3300025907 Bacteria 800
268 Ga0207643_10018778 3300025908 Bacteria 3786
269 Ga0207643_10094115 3300025908 Bacteria 1750
270 Ga0207654_10000887 3300025911 Bacteria 16589
271 Ga0207654_10083671 3300025911 Bacteria 1927
272 Ga0207695_10004554 3300025913 Bacteria 18847
273 Ga0207695_10125536 3300025913 Bacteria 2529
274 Ga0207671_10001944 3300025914 Bacteria 22809
275 Ga0207671_10461159 3300025914 Unclassified 1012
276 Ga0207671_10802584 3300025914 Unclassified 746
277 Ga0207681_10471492 3300025923 Bacteria 1024
278 Ga0207694_10000720 3300025924 Bacteria 29711
279 Ga0207650_10024854 3300025925 Unclassified 4264
280 Ga0207650_10199635 3300025925 Unclassified 1601
281 Ga0207659_10010296 3300025926 Bacteria 5870
282 Ga0207687_10248283 3300025927 Unclassified 1413
283 Ga0207644_10002179 3300025931 Bacteria 12702
284 Ga0207644_10366492 3300025931 Bacteria 1173
285 Ga0207644_10603036 3300025931 Unclassified 912
286 Ga0207690_10106176 3300025932 Bacteria 2015
287 Ga0207690_10670516 3300025932 Unclassified 851
288 Ga0207706_10007388 3300025933 Bacteria 10158
289 Ga0207706_10039794 3300025933 Unclassified 4168
290 Ga0207706_10117833 3300025933 Bacteria 2335
291 Ga0207706_10871013 3300025933 Bacteria 762
292 Ga0207686_10078238 3300025934 Unclassified 2150
293 Ga0207686_10123951 3300025934 Bacteria 1763
294 Ga0207709_10235997 3300025935 Unclassified 1327
295 Ga0207669_10063693 3300025937 Bacteria 2277
296 Ga0207704_10145975 3300025938 Bacteria 1662
297 Ga0207704_10595649 3300025938 Unclassified 904
298 Ga0207691_10000014 3300025940 Bacteria 142542
299 Ga0207691_10011084 3300025940 Bacteria 8652
300 Ga0207691_10233381 3300025940 Bacteria 1592
301 Ga0207689_10000939 3300025942 Bacteria 28012
302 Ga0207689_10002211 3300025942 Bacteria 18237
303 Ga0207689_10004402 3300025942 Bacteria 12804
304 Ga0207689_10202795 3300025942 Bacteria 1637
305 Ga0207661_10095496 3300025944 Unclassified 2485
306 Ga0207679_10060263 3300025945 Unclassified 2819
307 Ga0207679_10942994 3300025945 Bacteria 790
308 Ga0207679_11238372 3300025945 Bacteria 685
309 Ga0207667_10427435 3300025949 Unclassified 1347
310 Ga0207651_10000826 3300025960 Bacteria 13415
311 Ga0207651_10053495 3300025960 Unclassified 2760
312 Ga0207712_10012835 3300025961 Bacteria 5358
313 Ga0207712_10014875 3300025961 Bacteria 5010
314 Ga0207712_10110889 3300025961 Bacteria 2058
315 Ga0207712_10183091 3300025961 Unclassified 1647
316 Ga0207712_10437131 3300025961 Bacteria 1107
317 Ga0207668_10000124 3300025972 Bacteria 54437
318 Ga0207668_10474750 3300025972 Bacteria 1071
319 Ga0207640_10064491 3300025981 Bacteria 2439
320 Ga0207640_10192885 3300025981 Bacteria 1537
321 Ga0207658_10000242 3300025986 Bacteria 57191
322 Ga0207658_10013413 3300025986 Bacteria 5598
323 Ga0207658_10128644 3300025986 Unclassified 2031
324 Ga0207658_10139025 3300025986 Bacteria 1963
325 Ga0207658_10395624 3300025986 Unclassified 1213
326 Ga0207658_10922426 3300025986 Bacteria 795
327 Ga0207677_10003043 3300026023 Bacteria 8867
328 Ga0207677_10018269 3300026023 Bacteria 4205
329 Ga0207677_10030799 3300026023 Unclassified 3430
330 Ga0207677_10055599 3300026023 Bacteria 2707
331 Ga0207677_10636048 3300026023 Bacteria 940
332 Ga0207703_10000735 3300026035 Bacteria 32229
333 Ga0207639_10140300 3300026041 Bacteria 2013
334 Ga0207639_10140366 3300026041 Unclassified 2012
335 Ga0207639_11090110 3300026041 Bacteria 749
336 Ga0207678_10123011 3300026067 Unclassified 2214
337 Ga0207678_10201114 3300026067 Bacteria 1703
338 Ga0207702_10341633 3300026078 Bacteria 1430
339 Ga0207641_10013162 3300026088 Bacteria 6782
340 Ga0207641_10143459 3300026088 Bacteria 2157
341 Ga0207641_10232203 3300026088 Unclassified 1715
342 Ga0207648_10001686 3300026089 Bacteria 24217
343 Ga0207648_10008280 3300026089 Bacteria 10096
344 Ga0207648_10028788 3300026089 Unclassified 4924
345 Ga0207648_10153066 3300026089 Bacteria 2035
346 Ga0207676_10005744 3300026095 Bacteria 8775
347 Ga0207674_10053181 3300026116 Bacteria 4128
348 Ga0207674_11079929 3300026116 Bacteria 772
349 Ga0207683_10000535 3300026121 Bacteria 35178
350 Ga0207683_10075606 3300026121 Bacteria 2981
351 Ga0207683_10557788 3300026121 Unclassified 1059
352 Ga0207683_10866189 3300026121 Unclassified 839
353 Ga0207428_10143919 3300027907 Bacteria 1818
354 Ga0207428_10432583 3300027907 Bacteria 961
355 Ga0268266_10052763 3300028379 Bacteria 3492
356 Ga0268266_10366708 3300028379 Bacteria 1356
357 Ga0268264_10003731 3300028381 Bacteria 13086
358 Ga0268264_10215345 3300028381 Bacteria 1765
359 Ga0268264_10440701 3300028381 Bacteria 1260
360 Ga0268264_10585140 3300028381 Unclassified 1098
361 Ga0268264_10587883 3300028381 Bacteria 1096
362 Ga0316182_1034821 3300030745 Unclassified 925
363 Ga0265327_10012523 3300031251 Bacteria 5713
364 Ga0265327_10133937 3300031251 Bacteria 1163
365 Ga0307408_100202628 3300031548 Bacteria 1607
366 Ga0307405_10000042 3300031731 Bacteria 79124
367 Ga0307405_10046431 3300031731 Bacteria 2668
368 Ga0307413_10502340 3300031824 Bacteria 974
369 Ga0307407_10000022 3300031903 Bacteria 120355
370 Ga0307412_10094126 3300031911 Bacteria 2103
371 Ga0307416_100000047 3300032002 Bacteria 120385
372 Ga0307414_10100651 3300032004 Bacteria 2174
373 Ga0307414_10401445 3300032004 Bacteria 1191
374 Ga0307414_10685526 3300032004 Unclassified 926
375 Ga0307414_11083955 3300032004 Bacteria 739
376 Ga0307411_10030778 3300032005 Bacteria 3294
377 Ga0307411_10609076 3300032005 Bacteria 940
378 Ga0307411_11192301 3300032005 Bacteria 690
379 Ga0373945_0169204 3300035116 Bacteria 895
380 Ga0373946_0420598 3300035171 Bacteria 677
381 Ga0373933_0604810 3300035724 Bacteria 720
382 Ga0373937_0761740 3300036401 Unclassified 915
383 Ga0395900_0097305 3300037418 Bacteria 3024
384 Ga0395901_0882478 3300038443 Bacteria 877
385 Ga0451843_1652337 3300041509 Bacteria 1773
386 Ga0466982_0033196 3300044672 Bacteria 3077
387 Ga0495592_0200274 3300046454 Bacteria 1348
388 Ga0495594_0501114 3300046499 Bacteria 690
389 Ga0495606_0160420 3300046507 Bacteria 1312
390 Ga0495608_0179209 3300046511 Bacteria 1341
391 Ga0495610_0002045 3300046512 Bacteria 17226
392 Ga0495610_0005738 3300046512 Bacteria 8744
393 Ga0495618_0773864 3300046514 Bacteria 560
394 Ga0495630_0516863 3300046517 Bacteria 915
395 Ga0495637_0047683 3300046520 Bacteria 1807
396 Ga0495640_0343047 3300046533 Bacteria 923
397 Ga0495634_0736671 3300046642 Bacteria 565
398 Ga0495611_0040188 3300046648 Bacteria 2085
399 Ga0495625_0047308 3300046660 Bacteria 3102
400 Ga0495672_0044833 3300047320 Bacteria 2650
401 Ga0495686_0017977 3300047472 Bacteria 4754
402 Ga0495686_0027415 3300047472 Bacteria 3719
403 Ga0496109_0079110 3300048912 Bacteria 3028
404 Ga0496111_0061606 3300048914 Bacteria 2720
405 Ga0496115_0008480 3300048918 Bacteria 7604
406 Ga0496115_0750099 3300048918 Bacteria 763
407 Ga0501300_005724 3300049523 Unclassified 1831
408 Ga0501032_0004194 3300049569 Bacteria 10916
409 Ga0501034_0082082 3300049571 Bacteria 3225
410 Ga0501034_0125657 3300049571 Bacteria 2550
411 Ga0501036_0046058 3300049572 Bacteria 3693
412 Ga0501036_0246607 3300049572 Unclassified 1497
413 Ga0501037_0070692 3300049573 Bacteria 2539
414 Ga0501037_0081748 3300049573 Bacteria 2342
415 Ga0501037_0090316 3300049573 Unclassified 2216
416 Ga0501038_0012937 3300049574 Bacteria 7613
417 Ga0501039_0021089 3300049575 Bacteria 4997
418 Ga0501039_0397268 3300049575 Bacteria 1083
419 Ga0501043_0037407 3300049579 Bacteria 3817
420 Ga0501043_0037728 3300049579 Bacteria 3800
421 Ga0501043_0099252 3300049579 Bacteria 2289
422 Ga0501046_0011616 3300049580 Bacteria 7526
423 Ga0501047_0220912 3300049581 Bacteria 1751
424 Ga0501048_0036531 3300049582 Bacteria 3531
425 Ga0501067_0320374 3300049583 Bacteria 863
426 Ga0501070_0727214 3300049586 Bacteria 784
427 Ga0501074_0094787 3300049590 Bacteria 2137
428 Ga0501210_000533 3300049657 Bacteria 1836
429 Ga0501217_010252 3300049661 Unclassified 2049
430 Ga0501223_004830 3300049663 Bacteria 2864
431 Ga0501236_001959 3300049670 Bacteria 2353
432 Ga0501251_027934 3300049681 Bacteria 789
433 Ga0501083_0013683 3300049744 Bacteria 5674
434 Ga0501264_000722 3300049761 Bacteria 4451
435 Ga0501035_0049777 3300049822 Bacteria 3755
436 Ga0501035_0159975 3300049822 Bacteria 1950
437 Ga0501044_0218722 3300049823 Unclassified 1856
438 nmdc:mga0k408_11496_c1 3300050493 Bacteria 4824
439 nmdc:mga0k408_46661_c1 3300050493 Bacteria 2502
440 nmdc:mga09592_347229_c1 3300050508 Bacteria 1284
441 nmdc:mga06r32_1487898_c1 3300050510 Unclassified 617
442 nmdc:mga08y16_42972_c1 3300050511 Bacteria 4734
443 nmdc:mga08y16_68129_c1 3300050511 Bacteria 3711
444 Ga0500646_0056395 3300053090 Bacteria 1146
445 Ga0500616_0278986 3300053153 Bacteria 702
446 Ga0590075_076293 3300059424 Bacteria 867
447 2586209044 2585427687 Bacteria 5544917
448 2738855620 2738541302 Bacteria 5944758
449 2739590503 2739367651 Bacteria 6359826
450 2739617255 2739367656 Bacteria 5152243
451 2739647514 2739367663 Bacteria 5040914
452 2819549304 2818991437 Bacteria 5805520
453 2839992424 2839989709 Bacteria 3773432
454 2842724815 2842722452 Bacteria 6263924
455 2842913165 2842909656 Bacteria 6185908
456 2849286928 2849281842 Bacteria 6065644
457 2902051814 2902048731 Bacteria 4976191
458 2904448303 2904445276 Bacteria 5310396
459 2910249030 2910245624 Bacteria 6935613
460 2946001803 2945997725 Bacteria 6404843
461 2954018638 2954016120 Bacteria 6446024
462 Ga0207668_10767079
463 JGI25152J39213_1000017
464 JGI25150J39212_1000001
465 JGI25151J46595_10000001
466 JGI25153J46596_10000053
467 rootH1_10001275
468 rootH1_10019234
469 rootH2_10002905
470 rootH2_10071687
471 rootL2_10000133
472 rootL2_10184856
473 rootL2_10276523
474 rootH1_10015770
475 rootH1_10029390
476 rootH1_10037052
477 rootH1_10037070
478 rootH1_10042262
479 rootH1_10144022
480 Ga0055536_1000001
481 Ga0055530_10006389
482 Ga0065165_1014484
483 Ga0065714_10002285
484 Ga0065714_10002947
485 Ga0070676_10000263
486 Ga0070676_10017885
487 Ga0070676_10019279
488 Ga0070676_10246114
489 Ga0070683_100087498
490 Ga0070690_100311665
491 Ga0070670_100052282
492 Ga0070670_100078185
493 Ga0070670_100086988
494 Ga0070677_10005260
495 Ga0068869_100146755
496 Ga0068869_100175527
497 Ga0068869_100574013
498 Ga0070666_10004806
499 Ga0070666_10009062
500 Ga0070682_100000044
501 Ga0068868_100001950
502 Ga0068868_100003187
503 Ga0068868_100043145
504 Ga0068868_100084823
505 Ga0068868_100098052
506 Ga0068868_100764009
507 Ga0070689_100005285
508 Ga0070661_100014590
509 Ga0070661_100735017
510 Ga0070668_100000106
511 Ga0070668_100036094
512 Ga0070669_100041950
513 Ga0070669_100491504
514 Ga0070675_100220545
515 Ga0070671_100002242
516 Ga0070671_100077412
517 Ga0070671_100134157
518 Ga0070671_100321168
519 Ga0070674_100234659
520 Ga0070673_100000229
521 Ga0070673_100007488
522 Ga0070673_100035166
523 Ga0070688_100005254
524 Ga0070688_100905940
525 Ga0070667_100000931
526 Ga0070667_100009450
527 Ga0070667_100088830
528 Ga0070667_100355989
529 Ga0070667_100500710
530 Ga0070667_100528819
531 Ga0070700_100635377
532 Ga0070663_100104642
533 Ga0070663_100620519
534 Ga0070663_100890908
535 Ga0070678_100008756
536 Ga0070678_100052658
537 Ga0070678_100193333
538 Ga0070662_100009238
539 Ga0070662_100034986
540 Ga0070662_100514852
541 Ga0068867_100001703
542 Ga0068867_100009241
543 Ga0068867_100035369
544 Ga0068867_100077339
545 Ga0070699_100449508
546 Ga0070684_100010684
547 Ga0068853_100072516
548 Ga0068853_100180102
549 Ga0068853_100870889
550 Ga0070672_100000325
551 Ga0070672_100006683
552 Ga0070672_100035809
553 Ga0070686_100151912
554 Ga0070665_100000570
555 Ga0070665_100045100
556 Ga0070665_100322144
557 Ga0068855_100301826
558 Ga0068855_100432613
559 Ga0070664_100010065
560 Ga0070664_100559587
561 Ga0070664_101929676
562 Ga0068857_100039837
563 Ga0068854_100030289
564 Ga0068854_100301672
565 Ga0068856_100179618
566 Ga0068859_100066631
567 Ga0068859_100202762
568 Ga0068859_100216204
569 Ga0068859_100307599
570 Ga0068859_100399066
571 Ga0068864_100001209
572 Ga0068864_100052879
573 Ga0068864_100734872
574 Ga0068866_10018833
575 Ga0068866_10023694
576 Ga0068866_11183043
577 Ga0068861_100728722
578 Ga0068851_10093384
579 Ga0068851_10313135
580 Ga0068870_10013382
581 Ga0068863_100003303
582 Ga0068863_100036503
583 Ga0068863_100073161
584 Ga0068863_100139222
585 Ga0068863_101916967
586 Ga0068858_100001322
587 Ga0068858_100285677
588 Ga0068860_100014141
589 Ga0068860_100028713
590 Ga0068860_100084825
591 Ga0068860_100265273
592 Ga0068862_100498956
593 Ga0075366_10020956
594 Ga0097621_100000143
595 Ga0097621_100015299
596 Ga0097621_100088421
597 Ga0068871_100000741
598 Ga0068871_100002881
599 Ga0068871_100154122
600 Ga0075428_100045782
601 Ga0075428_101490096
602 Ga0075430_100082739
603 Ga0068865_100000299
604 Ga0068865_100007419
605 Ga0068865_100192101
606 Ga0097620_100066632
607 Ga0097620_100202765
608 Ga0097620_100216219
609 Ga0097620_100307578
610 Ga0097620_100399047
611 Ga0097620_100864394
612 Ga0105240_10000263
613 Ga0105240_10137465
614 Ga0111539_10087450
615 Ga0111539_10102168
616 Ga0105245_10366720
617 Ga0105243_10270072
618 Ga0105243_10351156
619 Ga0105241_10000384
620 Ga0105241_10053980
621 Ga0105242_10004236
622 Ga0105242_10022831
623 Ga0105242_10311998
624 Ga0105248_10293026
625 Ga0105248_12241268
626 Ga0105237_10015253
627 Ga0105237_10770574
628 Ga0105238_10000536
629 Ga0105249_10004490
630 Ga0105249_10015175
631 Ga0105249_10018666
632 Ga0105249_10051417
633 Ga0105249_10067702
634 Ga0105249_10626920
635 Ga0105249_10887002
636 Ga0105249_10955690
637 Ga0105249_11381920
638 Ga0105249_11593814
639 Ga0105239_10004319
640 Ga0105239_10353846
641 Ga0105239_10711924
642 Ga0105246_10020739
643 Ga0105246_10096265
644 Ga0105246_10282940
645 Ga0157373_10271312
646 Ga0157371_10000021
647 Ga0157371_10540030
648 Ga0157370_10004406
649 Ga0157370_10178601
650 Ga0157369_10000008
651 Ga0157374_10000089
652 Ga0157374_10018673
653 Ga0157374_10053957
654 Ga0157378_10005286
655 Ga0157378_10040087
656 Ga0157378_10040776
657 Ga0157378_10055412
658 Ga0163162_10000084
659 Ga0163162_10000206
660 Ga0163162_10006680
661 Ga0163162_10013609
662 Ga0163162_10181511
663 Ga0163162_10217582
664 Ga0163162_11032835
665 Ga0157372_10062059
666 Ga0157372_10741418
667 Ga0157372_11217905
668 Ga0157372_11389841
669 Ga0157375_10000057
670 Ga0157375_10003373
671 Ga0157375_10015071
672 Ga0157375_10038254
673 Ga0157375_10371592
674 Ga0163163_10000804
675 Ga0163163_10001267
676 Ga0163163_10084270
677 Ga0163163_10178860
678 Ga0163163_11563780
679 Ga0157380_10147684
680 Ga0157380_10171989
681 Ga0157380_10203522
682 Ga0157380_10272033
683 Ga0157380_10465454
684 Ga0157380_10676268
685 Ga0157380_11258877
686 Ga0157380_11450122
687 Ga0182008_10002479
688 Ga0157377_10030923
689 Ga0157377_10190271
690 Ga0157377_10281154
691 Ga0157379_10000032
692 Ga0157379_10022190
693 Ga0157379_10060338
694 Ga0157379_10231472
695 Ga0157376_10000318
696 Ga0157376_10003039
697 Ga0157376_10249930
698 Ga0157376_10353049
699 Ga0157376_10609042
700 Ga0182006_1000091
701 Ga0182006_1001551
702 Ga0182007_10000003
703 Ga0183373_1001
704 Ga0163161_10001232
705 Ga0163161_10023384
706 Ga0163161_10030785
707 Ga0163161_10081322
708 Ga0163161_10094297
709 Ga0163161_11291937
710 Ga0207425_1000002
711 Ga0209129_1000002
712 Ga0209676_1000008
713 Ga0209025_1000004
714 Ga0209758_1000006
715 Ga0209050_1000045
716 Ga0207697_10023743
717 Ga0207697_10255000
718 Ga0207688_10041309
719 Ga0207688_10384720
720 Ga0207680_10000845
721 Ga0207680_10019077
722 Ga0207647_10051106
723 Ga0207647_10173864
724 Ga0207645_10000638
725 Ga0207645_10001413
726 Ga0207645_10073434
727 Ga0207645_10527396
728 Ga0207643_10018778
729 Ga0207643_10094115
730 Ga0207654_10000887
731 Ga0207654_10083671
732 Ga0207695_10004554
733 Ga0207695_10125536
734 Ga0207671_10001944
735 Ga0207671_10461159
736 Ga0207671_10802584
737 Ga0207681_10471492
738 Ga0207694_10000720
739 Ga0207650_10024854
740 Ga0207650_10199635
741 Ga0207659_10010296
742 Ga0207687_10248283
743 Ga0207644_10002179
744 Ga0207644_10366492
745 Ga0207644_10603036
746 Ga0207690_10106176
747 Ga0207690_10670516
748 Ga0207706_10007388
749 Ga0207706_10039794
750 Ga0207706_10117833
751 Ga0207706_10871013
752 Ga0207686_10078238
753 Ga0207686_10123951
754 Ga0207709_10235997
755 Ga0207669_10063693
756 Ga0207704_10145975
757 Ga0207704_10595649
758 Ga0207691_10000014
759 Ga0207691_10011084
760 Ga0207691_10233381
761 Ga0207689_10000939
762 Ga0207689_10002211
763 Ga0207689_10004402
764 Ga0207689_10202795
765 Ga0207661_10095496
766 Ga0207679_10060263
767 Ga0207679_10942994
768 Ga0207679_11238372
769 Ga0207667_10427435
770 Ga0207651_10000826
771 Ga0207651_10053495
772 Ga0207712_10012835
773 Ga0207712_10014875
774 Ga0207712_10110889
775 Ga0207712_10183091
776 Ga0207712_10437131
777 Ga0207668_10000124
778 Ga0207668_10474750
779 Ga0207640_10064491
780 Ga0207640_10192885
781 Ga0207658_10000242
782 Ga0207658_10013413
783 Ga0207658_10128644
784 Ga0207658_10139025
785 Ga0207658_10395624
786 Ga0207658_10922426
787 Ga0207677_10003043
788 Ga0207677_10018269
789 Ga0207677_10030799
790 Ga0207677_10055599
791 Ga0207677_10636048
792 Ga0207703_10000735
793 Ga0207639_10140300
794 Ga0207639_10140366
795 Ga0207639_11090110
796 Ga0207678_10123011
797 Ga0207678_10201114
798 Ga0207702_10341633
799 Ga0207641_10013162
800 Ga0207641_10143459
801 Ga0207641_10232203
802 Ga0207648_10001686
803 Ga0207648_10008280
804 Ga0207648_10028788
805 Ga0207648_10153066
806 Ga0207676_10005744
807 Ga0207674_10053181
808 Ga0207674_11079929
809 Ga0207683_10000535
810 Ga0207683_10075606
811 Ga0207683_10557788
812 Ga0207683_10866189
813 Ga0207428_10143919
814 Ga0207428_10432583
815 Ga0268266_10052763
816 Ga0268266_10366708
817 Ga0268264_10003731
818 Ga0268264_10215345
819 Ga0268264_10440701
820 Ga0268264_10585140
821 Ga0268264_10587883
822 Ga0316182_1034821
823 Ga0265327_10012523
824 Ga0265327_10133937
825 Ga0307408_100202628
826 Ga0307405_10000042
827 Ga0307405_10046431
828 Ga0307413_10502340
829 Ga0307407_10000022
830 Ga0307412_10094126
831 Ga0307416_100000047
832 Ga0307414_10100651
833 Ga0307414_10401445
834 Ga0307414_10685526
835 Ga0307414_11083955
836 Ga0307411_10030778
837 Ga0307411_10609076
838 Ga0307411_11192301
839 Ga0373945_0169204
840 Ga0373946_0420598
841 Ga0373933_0604810
842 Ga0373937_0761740
843 Ga0395900_0097305
844 Ga0395901_0882478
845 Ga0451843_1652337
846 Ga0466982_0033196
847 Ga0495592_0200274
848 Ga0495594_0501114
849 Ga0495606_0160420
850 Ga0495608_0179209
851 Ga0495610_0002045
852 Ga0495610_0005738
853 Ga0495618_0773864
854 Ga0495630_0516863
855 Ga0495637_0047683
856 Ga0495640_0343047
857 Ga0495634_0736671
858 Ga0495611_0040188
859 Ga0495625_0047308
860 Ga0495672_0044833
861 Ga0495686_0017977
862 Ga0495686_0027415
863 Ga0496109_0079110
864 Ga0496111_0061606
865 Ga0496115_0008480
866 Ga0496115_0750099
867 Ga0501300_005724
868 Ga0501032_0004194
869 Ga0501034_0082082
870 Ga0501034_0125657
871 Ga0501036_0046058
872 Ga0501036_0246607
873 Ga0501037_0070692
874 Ga0501037_0081748
875 Ga0501037_0090316
876 Ga0501038_0012937
877 Ga0501039_0021089
878 Ga0501039_0397268
879 Ga0501043_0037407
880 Ga0501043_0037728
881 Ga0501043_0099252
882 Ga0501046_0011616
883 Ga0501047_0220912
884 Ga0501048_0036531
885 Ga0501067_0320374
886 Ga0501070_0727214
887 Ga0501074_0094787
888 Ga0501210_000533
889 Ga0501217_010252
890 Ga0501223_004830
891 Ga0501236_001959
892 Ga0501251_027934
893 Ga0501083_0013683
894 Ga0501264_000722
895 Ga0501035_0049777
896 Ga0501035_0159975
897 Ga0501044_0218722
898 nmdc:mga0k408_11496_c1
899 nmdc:mga0k408_46661_c1
900 nmdc:mga09592_347229_c1
901 nmdc:mga06r32_1487898_c1
902 nmdc:mga08y16_42972_c1
903 nmdc:mga08y16_68129_c1
904 Ga0500646_0056395
905 Ga0500616_0278986
906 Ga0590075_076293
907 2586209044
908 2738855620
909 2739590503
910 2739617255
911 2739647514
912 2819549304
913 2839992424
914 2842724815
915 2842913165
916 2849286928
917 2902051814
918 2904448303
919 2910249030
920 2946001803
921 2954018638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01288

HPPK

7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)

34

161

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cg8-assembly1.cif.gz_B-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9568 4 153
2cg8-assembly1.cif.gz_D-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9547 4 153
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9435 4 153
2cg8-assembly1.cif.gz_A-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.9395 4 153
4m5j-assembly1.cif.gz_A the identification, analysis and structure-based development of novel inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase 0.931 6 164
ID Description Score Start End Superfamily
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9779 6 154 3.30.70.560
af_Q54YD9_144_293_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9524 6 154 3.30.70.560
af_Q4LB35_295_465_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9457 6 163 3.30.70.560
af_A0A1D8PN03_274_470_3.30.70.560 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9433 4 153 3.30.70.560
2cg8A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 0.9393 7 152 3.30.70.560
ID Description Score Start End GO Terms
AF-A0A520IV99-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9866 1 164 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A0Q5TMP6-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9854 1 164 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A4Q6B3P6-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.985 6 111 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656
AF-A0A7J2JKP9-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9835 6 153 GO:0003848
GO:0003908
GO:0005524
GO:0006281
GO:0016301
GO:0032259
GO:0046654
GO:0046656
AF-A0A519UMX4-F1-model_v4 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC 2.7.6.3) 0.9795 8 164 GO:0003848
GO:0005524
GO:0016301
GO:0046654
GO:0046656

Map