F448567

General Info

Members Datasets Scaffolds Average Seq Length
460 217 920 216

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10168878|Ga0307517_101688782
Length 232
Sequence VTLYGIDSVGTSGGLMLVLHGSAISNYYNKVKLALLEKGVPFEEAYAATHSSDEAVLSASPLGKIPFVTTPEGSLCESQPLLEWIETRWPTPPLLPADPFAAAKVRELTTFIDWHLEIVARQLYGSAFFGSAPLSEANSARIRRQLVDNIAAFKRLARFAPLVAGNQFTQADCAAFNHLPLVAMASKAVYGEDLLQAGGIDHRGYGKLIAERPSAQKVVADRKAAQARLQAP

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
193 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
194 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 2585428062 Methylibium sp. CF059 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.48
Nodule 0
Rhizoplane 3.7
Rhizosphere 74.35
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10168878 3300028786 Bacteria 1444
2 rootH1_10023632 3300003316 Bacteria 4084
3 rootL2_10030690 3300003322 Bacteria 2981
4 rootL2_10055025 3300003322 Bacteria 6343
5 rootL2_10064422 3300003322 Bacteria 3576
6 Ga0070658_10122059 3300005327 Bacteria 2165
7 Ga0070676_10044798 3300005328 Bacteria 2576
8 Ga0070676_10052822 3300005328 Bacteria 2391
9 Ga0070676_10080695 3300005328 Bacteria 1973
10 Ga0070690_100017916 3300005330 Bacteria 4269
11 Ga0070670_100031808 3300005331 Bacteria 4544
12 Ga0070670_100065069 3300005331 Bacteria 3128
13 Ga0070670_100181440 3300005331 Bacteria 1828
14 Ga0070670_100310829 3300005331 Bacteria 1380
15 Ga0070670_100378162 3300005331 Bacteria 1247
16 Ga0070677_10003375 3300005333 Bacteria 5144
17 Ga0070677_10004032 3300005333 Bacteria 4770
18 Ga0070677_10063235 3300005333 Bacteria 1533
19 Ga0070677_10324548 3300005333 Bacteria 789
20 Ga0068869_100031723 3300005334 Bacteria 3718
21 Ga0068869_100068797 3300005334 Bacteria 2616
22 Ga0068869_100412298 3300005334 Bacteria 1113
23 Ga0068869_100951345 3300005334 Bacteria 746
24 Ga0070666_10026658 3300005335 Bacteria 3779
25 Ga0070666_10353027 3300005335 Bacteria 1052
26 Ga0068868_100001457 3300005338 Bacteria 16334
27 Ga0068868_100031936 3300005338 Bacteria 4048
28 Ga0068868_100039730 3300005338 Bacteria 3658
29 Ga0068868_100073557 3300005338 Bacteria 2729
30 Ga0068868_100074461 3300005338 Bacteria 2712
31 Ga0070660_100155951 3300005339 Bacteria 1837
32 Ga0070689_100127097 3300005340 Bacteria 2041
33 Ga0070661_100236422 3300005344 Bacteria 1405
34 Ga0070668_100489099 3300005347 Bacteria 1063
35 Ga0070669_100050469 3300005353 Bacteria 3039
36 Ga0070669_100234215 3300005353 Bacteria 1456
37 Ga0070675_100006016 3300005354 Bacteria 9298
38 Ga0070675_100336738 3300005354 Bacteria 1336
39 Ga0070675_100380919 3300005354 Bacteria 1256
40 Ga0070671_100004591 3300005355 Bacteria 10941
41 Ga0070671_100013382 3300005355 Bacteria 6614
42 Ga0070671_100018567 3300005355 Bacteria 5649
43 Ga0070671_100054525 3300005355 Bacteria 3324
44 Ga0070671_100066172 3300005355 Bacteria 3012
45 Ga0070674_100199102 3300005356 Bacteria 1545
46 Ga0070674_100464806 3300005356 Bacteria 1047
47 Ga0070674_100505080 3300005356 Bacteria 1008
48 Ga0070673_100012681 3300005364 Bacteria 5797
49 Ga0070673_100049472 3300005364 Bacteria 3282
50 Ga0070673_100229662 3300005364 Bacteria 1609
51 Ga0070688_100039631 3300005365 Bacteria 2884
52 Ga0070667_100002713 3300005367 Bacteria 15329
53 Ga0070667_100004227 3300005367 Bacteria 12123
54 Ga0070667_100300049 3300005367 Bacteria 1446
55 Ga0070667_100475892 3300005367 Bacteria 1143
56 Ga0070667_100951076 3300005367 Bacteria 801
57 Ga0070663_100195063 3300005455 Bacteria 1578
58 Ga0070678_100006997 3300005456 Bacteria 6661
59 Ga0070678_100014518 3300005456 Bacteria 4974
60 Ga0070678_100053946 3300005456 Bacteria 2926
61 Ga0070678_100204635 3300005456 Bacteria 1631
62 Ga0070678_100223049 3300005456 Bacteria 1568
63 Ga0070662_100225871 3300005457 Bacteria 1496
64 Ga0068867_100000074 3300005459 Bacteria 61448
65 Ga0068867_100009306 3300005459 Bacteria 6929
66 Ga0068867_100063407 3300005459 Bacteria 2747
67 Ga0068867_100183759 3300005459 Bacteria 1664
68 Ga0068867_100307995 3300005459 Bacteria 1308
69 Ga0068867_100695313 3300005459 Bacteria 897
70 Ga0070706_100150841 3300005467 Bacteria 2170
71 Ga0070679_100399813 3300005530 Bacteria 1320
72 Ga0070672_100019534 3300005543 Bacteria 4920
73 Ga0070672_100194036 3300005543 Bacteria 1696
74 Ga0070672_100290614 3300005543 Bacteria 1384
75 Ga0070665_100045320 3300005548 Bacteria 4417
76 Ga0070665_100087205 3300005548 Bacteria 3126
77 Ga0070665_100166986 3300005548 Bacteria 2203
78 Ga0068857_100076045 3300005577 Bacteria 2994
79 Ga0068854_100212225 3300005578 Bacteria 1527
80 Ga0068854_100357938 3300005578 Bacteria 1196
81 Ga0068854_100429572 3300005578 Bacteria 1099
82 Ga0068854_100599523 3300005578 Bacteria 940
83 Ga0070702_100270342 3300005615 Bacteria 1162
84 Ga0070702_100370803 3300005615 Bacteria 1015
85 Ga0068852_100016267 3300005616 Bacteria 5795
86 Ga0068852_100238422 3300005616 Bacteria 1737
87 Ga0068852_100358121 3300005616 Bacteria 1426
88 Ga0068852_100655188 3300005616 Bacteria 1058
89 Ga0068859_100003627 3300005617 Bacteria 15741
90 Ga0068859_100045671 3300005617 Bacteria 4401
91 Ga0068859_100799744 3300005617 Bacteria 1031
92 Ga0068864_100010738 3300005618 Bacteria 7569
93 Ga0068864_100611234 3300005618 Bacteria 1059
94 Ga0068866_10132858 3300005718 Bacteria 1418
95 Ga0068866_10270473 3300005718 Bacteria 1048
96 Ga0068861_100286597 3300005719 Bacteria 1420
97 Ga0068861_100556805 3300005719 Bacteria 1046
98 Ga0068861_100593116 3300005719 Bacteria 1016
99 Ga0068851_10080650 3300005834 Bacteria 1698
100 Ga0068870_10028809 3300005840 Bacteria 2791
101 Ga0068863_100016977 3300005841 Bacteria 6981
102 Ga0068863_100163956 3300005841 Bacteria 2130
103 Ga0068863_100271906 3300005841 Bacteria 1640
104 Ga0068858_100007036 3300005842 Bacteria 10927
105 Ga0068860_100357178 3300005843 Bacteria 1439
106 Ga0068860_100392991 3300005843 Bacteria 1371
107 Ga0068862_100191079 3300005844 Bacteria 1842
108 Ga0068862_100267775 3300005844 Bacteria 1562
109 Ga0068862_100492245 3300005844 Bacteria 1162
110 Ga0075365_10031156 3300006038 Bacteria 3419
111 Ga0075365_10177521 3300006038 Bacteria 1488
112 Ga0075365_10301814 3300006038 Bacteria 1127
113 Ga0075363_100010961 3300006048 Bacteria 4325
114 Ga0075363_100038550 3300006048 Bacteria 2514
115 Ga0075362_10010090 3300006177 Bacteria 3676
116 Ga0075362_10020573 3300006177 Bacteria 2759
117 Ga0075362_10112619 3300006177 Bacteria 1282
118 Ga0075367_10207233 3300006178 Bacteria 1225
119 Ga0075366_10003600 3300006195 Bacteria 8205
120 Ga0075366_10006446 3300006195 Bacteria 6431
121 Ga0075366_10007391 3300006195 Bacteria 6066
122 Ga0075366_10048866 3300006195 Bacteria 2510
123 Ga0075366_10058930 3300006195 Bacteria 2281
124 Ga0075366_10160137 3300006195 Bacteria 1364
125 Ga0075366_10448005 3300006195 Bacteria 796
126 Ga0097621_100071580 3300006237 Bacteria 2865
127 Ga0097621_100136114 3300006237 Bacteria 2095
128 Ga0097621_100195498 3300006237 Bacteria 1753
129 Ga0075370_10000145 3300006353 Bacteria 24072
130 Ga0075370_10008235 3300006353 Bacteria 5352
131 Ga0075370_10010600 3300006353 Bacteria 4827
132 Ga0075370_10022521 3300006353 Bacteria 3460
133 Ga0075370_10133205 3300006353 Bacteria 1451
134 Ga0075370_10394915 3300006353 Bacteria 829
135 Ga0075370_10456102 3300006353 Bacteria 769
136 Ga0068871_100076248 3300006358 Bacteria 2768
137 Ga0068871_100167190 3300006358 Bacteria 1883
138 Ga0068871_100215081 3300006358 Bacteria 1663
139 Ga0068865_100279955 3300006881 Bacteria 1327
140 Ga0097620_100003627 3300006931 Bacteria 15741
141 Ga0097620_100045673 3300006931 Bacteria 4401
142 Ga0097620_100799751 3300006931 Bacteria 1031
143 Ga0105245_10180004 3300009098 Bacteria 2019
144 Ga0105245_11035091 3300009098 Bacteria 866
145 Ga0105243_10000513 3300009148 Bacteria 39564
146 Ga0105243_10230250 3300009148 Bacteria 1644
147 Ga0105243_10324489 3300009148 Bacteria 1404
148 Ga0105248_10046443 3300009177 Bacteria 4867
149 Ga0105248_10198308 3300009177 Bacteria 2261
150 Ga0105248_10398667 3300009177 Bacteria 1549
151 Ga0105248_10588617 3300009177 Bacteria 1255
152 Ga0105248_11119145 3300009177 Bacteria 890
153 Ga0105237_10220122 3300009545 Bacteria 1898
154 Ga0105237_10827571 3300009545 Bacteria 932
155 Ga0105238_10142726 3300009551 Bacteria 2371
156 Ga0105238_10559573 3300009551 Bacteria 1148
157 Ga0105249_10024209 3300009553 Bacteria 5456
158 Ga0105249_10129971 3300009553 Bacteria 2403
159 Ga0105246_10673517 3300011119 Bacteria 903
160 Ga0157369_11159866 3300013105 Bacteria 789
161 Ga0157374_10225256 3300013296 Bacteria 1841
162 Ga0157374_10291298 3300013296 Bacteria 1613
163 Ga0157378_10074890 3300013297 Bacteria 3047
164 Ga0157378_10986704 3300013297 Bacteria 876
165 Ga0163162_10052155 3300013306 Bacteria 4108
166 Ga0163162_10066138 3300013306 Bacteria 3664
167 Ga0163162_10131629 3300013306 Bacteria 2610
168 Ga0157375_10123191 3300013308 Bacteria 2705
169 Ga0157375_10192903 3300013308 Bacteria 2192
170 Ga0157375_10211724 3300013308 Bacteria 2096
171 Ga0157375_11807106 3300013308 Bacteria 725
172 Ga0163163_10010495 3300014325 Bacteria 8334
173 Ga0163163_10099087 3300014325 Bacteria 2936
174 Ga0157380_10213423 3300014326 Bacteria 1722
175 Ga0157380_10234296 3300014326 Bacteria 1651
176 Ga0157380_10748105 3300014326 Bacteria 989
177 Ga0157380_11309488 3300014326 Bacteria 772
178 Ga0157377_10000006 3300014745 Bacteria 419853
179 Ga0157379_10009717 3300014968 Bacteria 8378
180 Ga0157379_10373510 3300014968 Bacteria 1308
181 Ga0157379_10413421 3300014968 Bacteria 1241
182 Ga0157376_10003299 3300014969 Bacteria 11110
183 Ga0157376_10043631 3300014969 Bacteria 3681
184 Ga0157376_10084425 3300014969 Bacteria 2734
185 Ga0157376_10203209 3300014969 Bacteria 1824
186 Ga0163161_10062575 3300017792 Bacteria 2711
187 Ga0163161_10252243 3300017792 Bacteria 1376
188 Ga0163161_10356699 3300017792 Bacteria 1164
189 Ga0207656_10306990 3300025321 Bacteria 786
190 Ga0207682_10001533 3300025893 Bacteria 10619
191 Ga0207682_10009893 3300025893 Bacteria 3748
192 Ga0207682_10046543 3300025893 Bacteria 1783
193 Ga0207642_10152620 3300025899 Bacteria 1231
194 Ga0207688_10066753 3300025901 Bacteria 2035
195 Ga0207680_10003469 3300025903 Bacteria 7431
196 Ga0207680_10227896 3300025903 Bacteria 1280
197 Ga0207645_10077310 3300025907 Bacteria 2132
198 Ga0207645_10147120 3300025907 Bacteria 1536
199 Ga0207643_10102051 3300025908 Bacteria 1683
200 Ga0207705_10050589 3300025909 Bacteria 2991
201 Ga0207684_10100111 3300025910 Bacteria 2476
202 Ga0207660_10060744 3300025917 Bacteria 2719
203 Ga0207657_10084106 3300025919 Bacteria 2668
204 Ga0207652_10038730 3300025921 Bacteria 4043
205 Ga0207652_10395180 3300025921 Bacteria 1248
206 Ga0207681_10554672 3300025923 Bacteria 946
207 Ga0207650_10006348 3300025925 Bacteria 8053
208 Ga0207650_10035884 3300025925 Bacteria 3604
209 Ga0207650_10062106 3300025925 Bacteria 2791
210 Ga0207650_10067442 3300025925 Bacteria 2685
211 Ga0207650_10085591 3300025925 Bacteria 2399
212 Ga0207650_10337957 3300025925 Bacteria 1236
213 Ga0207659_10000163 3300025926 Bacteria 39698
214 Ga0207659_10147450 3300025926 Bacteria 1834
215 Ga0207659_10486549 3300025926 Bacteria 1043
216 Ga0207659_10993673 3300025926 Bacteria 722
217 Ga0207687_10112080 3300025927 Bacteria 2026
218 Ga0207644_10000531 3300025931 Bacteria 24678
219 Ga0207644_10004224 3300025931 Bacteria 9324
220 Ga0207644_10096702 3300025931 Bacteria 2211
221 Ga0207644_10169351 3300025931 Bacteria 1704
222 Ga0207706_10006111 3300025933 Bacteria 11183
223 Ga0207706_10068405 3300025933 Bacteria 3124
224 Ga0207706_10149581 3300025933 Bacteria 2053
225 Ga0207706_10694134 3300025933 Bacteria 870
226 Ga0207686_10023828 3300025934 Bacteria 3538
227 Ga0207709_10000398 3300025935 Bacteria 42657
228 Ga0207709_10215474 3300025935 Bacteria 1381
229 Ga0207709_10328917 3300025935 Bacteria 1147
230 Ga0207670_10007887 3300025936 Bacteria 5978
231 Ga0207669_10107769 3300025937 Bacteria 1859
232 Ga0207669_10900323 3300025937 Bacteria 739
233 Ga0207704_10341106 3300025938 Bacteria 1163
234 Ga0207704_10459070 3300025938 Bacteria 1018
235 Ga0207704_10644239 3300025938 Bacteria 872
236 Ga0207691_10019547 3300025940 Bacteria 6408
237 Ga0207691_10126226 3300025940 Bacteria 2264
238 Ga0207691_10148952 3300025940 Bacteria 2058
239 Ga0207691_10295606 3300025940 Bacteria 1392
240 Ga0207691_10554181 3300025940 Bacteria 974
241 Ga0207711_10016732 3300025941 Bacteria 6090
242 Ga0207711_10137473 3300025941 Bacteria 2196
243 Ga0207711_10152616 3300025941 Bacteria 2085
244 Ga0207711_10176677 3300025941 Bacteria 1940
245 Ga0207689_10032170 3300025942 Bacteria 4363
246 Ga0207689_10070633 3300025942 Bacteria 2868
247 Ga0207689_10192157 3300025942 Bacteria 1684
248 Ga0207679_10068965 3300025945 Bacteria 2659
249 Ga0207679_10143856 3300025945 Bacteria 1931
250 Ga0207667_10040364 3300025949 Bacteria 4969
251 Ga0207667_10382512 3300025949 Bacteria 1434
252 Ga0207651_10007334 3300025960 Bacteria 5865
253 Ga0207651_10040046 3300025960 Bacteria 3096
254 Ga0207712_10541048 3300025961 Bacteria 1000
255 Ga0207668_10040855 3300025972 Bacteria 3132
256 Ga0207658_10011911 3300025986 Bacteria 5929
257 Ga0207658_10014762 3300025986 Bacteria 5352
258 Ga0207658_10243670 3300025986 Bacteria 1524
259 Ga0207677_10000975 3300026023 Bacteria 15826
260 Ga0207677_10021342 3300026023 Bacteria 3955
261 Ga0207677_10039052 3300026023 Bacteria 3117
262 Ga0207677_10047433 3300026023 Bacteria 2884
263 Ga0207677_10137041 3300026023 Bacteria 1868
264 Ga0207677_10406896 3300026023 Bacteria 1155
265 Ga0207703_10003822 3300026035 Bacteria 12513
266 Ga0207639_10158339 3300026041 Bacteria 1905
267 Ga0207639_10266516 3300026041 Bacteria 1500
268 Ga0207678_10111513 3300026067 Bacteria 2334
269 Ga0207708_10026014 3300026075 Bacteria 4427
270 Ga0207641_10003178 3300026088 Bacteria 14698
271 Ga0207641_10278017 3300026088 Bacteria 1573
272 Ga0207648_10000039 3300026089 Bacteria 118860
273 Ga0207648_10024425 3300026089 Bacteria 5395
274 Ga0207648_10026857 3300026089 Bacteria 5113
275 Ga0207648_10041904 3300026089 Bacteria 4020
276 Ga0207648_10106055 3300026089 Bacteria 2465
277 Ga0207648_10180329 3300026089 Bacteria 1869
278 Ga0207648_10246185 3300026089 Bacteria 1593
279 Ga0207648_10719833 3300026089 Bacteria 926
280 Ga0207676_10000800 3300026095 Bacteria 24486
281 Ga0207676_10024324 3300026095 Bacteria 4480
282 Ga0207676_10181761 3300026095 Bacteria 1842
283 Ga0207676_10354842 3300026095 Bacteria 1357
284 Ga0207674_10078198 3300026116 Bacteria 3313
285 Ga0207674_10093024 3300026116 Bacteria 3004
286 Ga0207675_100063732 3300026118 Bacteria 3444
287 Ga0207675_100110357 3300026118 Bacteria 2595
288 Ga0207675_100674873 3300026118 Bacteria 1041
289 Ga0207683_10000801 3300026121 Bacteria 28739
290 Ga0207683_10083995 3300026121 Bacteria 2830
291 Ga0207683_10103727 3300026121 Bacteria 2541
292 Ga0207683_10253672 3300026121 Bacteria 1606
293 Ga0207683_10366704 3300026121 Bacteria 1323
294 Ga0207683_10499843 3300026121 Bacteria 1123
295 Ga0207698_10015994 3300026142 Bacteria 5045
296 Ga0268266_10095440 3300028379 Bacteria 2612
297 Ga0268265_10579210 3300028380 Bacteria 1069
298 Ga0268264_10194820 3300028381 Bacteria 1850
299 Ga0268264_10304620 3300028381 Bacteria 1501
300 Ga0307517_10001409 3300028786 Bacteria 40436
301 Ga0307517_10149654 3300028786 Bacteria 1606
302 Ga0307517_10149810 3300028786 Bacteria 1605
303 Ga0307517_10233573 3300028786 Bacteria 1100
304 Ga0307515_10000058 3300028794 Bacteria 259680
305 Ga0307515_10003752 3300028794 Bacteria 31839
306 Ga0307515_10017206 3300028794 Bacteria 13188
307 Ga0307515_10038797 3300028794 Bacteria 7602
308 Ga0307515_10080214 3300028794 Bacteria 4260
309 Ga0307515_10318541 3300028794 Bacteria 1223
310 Ga0307512_10012783 3300030522 Bacteria 7901
311 Ga0307512_10242001 3300030522 Bacteria 911
312 Ga0307513_10002673 3300031456 Bacteria 24572
313 Ga0307513_10010428 3300031456 Bacteria 11648
314 Ga0307513_10262735 3300031456 Bacteria 1514
315 Ga0307513_10378666 3300031456 Bacteria 1155
316 Ga0307509_10000139 3300031507 Bacteria 108589
317 Ga0307509_10017835 3300031507 Bacteria 8153
318 Ga0307509_10026441 3300031507 Bacteria 6470
319 Ga0307408_100087956 3300031548 Bacteria 2339
320 Ga0307508_10005043 3300031616 Bacteria 12682
321 Ga0307508_10124597 3300031616 Bacteria 2179
322 Ga0307514_10233929 3300031649 Bacteria 1109
323 Ga0265314_10059747 3300031711 Bacteria 2606
324 Ga0307516_10003955 3300031730 Bacteria 18624
325 Ga0307516_10004445 3300031730 Bacteria 17289
326 Ga0307516_10069159 3300031730 Bacteria 3397
327 Ga0307516_10197245 3300031730 Unclassified 1735
328 Ga0307413_10148996 3300031824 Bacteria 1628
329 Ga0307518_10187775 3300031838 Bacteria 1389
330 Ga0307410_10414140 3300031852 Bacteria 1092
331 Ga0307412_10113069 3300031911 Bacteria 1942
332 Ga0307412_10153467 3300031911 Bacteria 1702
333 Ga0307412_10445460 3300031911 Bacteria 1065
334 Ga0307409_100706726 3300031995 Bacteria 1008
335 Ga0307414_10199764 3300032004 Bacteria 1625
336 Ga0307411_10126359 3300032005 Bacteria 1860
337 Ga0307507_10037593 3300033179 Bacteria 4925
338 Ga0307510_10000600 3300033180 Bacteria 36430
339 Ga0307510_10010702 3300033180 Bacteria 10905
340 Ga0307510_10014748 3300033180 Bacteria 9249
341 Ga0307510_10134169 3300033180 Unclassified 2139
342 Ga0373932_0017680 3300035112 Bacteria 1834
343 Ga0373939_0121470 3300035114 Bacteria 922
344 Ga0373925_0010157 3300037068 Bacteria 6835
345 Ga0395900_0723447 3300037418 Unclassified 927
346 Ga0395898_0020344 3300037466 Bacteria 6739
347 Ga0395905_0114719 3300037471 Bacteria 2531
348 Ga0395905_0264866 3300037471 Bacteria 1604
349 Ga0395901_0020641 3300038443 Bacteria 6741
350 Ga0395901_0641385 3300038443 Bacteria 1066
351 Ga0439439_0002469 3300041406 Bacteria 3939
352 Ga0451797_1124380 3300041453 Bacteria 1717
353 Ga0451800_0219770 3300041459 Bacteria 1221
354 Ga0451802_0060982 3300041460 Bacteria 1774
355 Ga0451851_1227772 3300041507 Bacteria 1170
356 Ga0451853_1760963 3300041512 Bacteria 1449
357 Ga0439449_0001702 3300042007 Bacteria 8655
358 Ga0439450_045284 3300042008 Bacteria 1032
359 Ga0439462_0048141 3300042015 Bacteria 1143
360 Ga0439446_0019065 3300042156 Bacteria 1927
361 Ga0439434_0089075 3300042435 Bacteria 985
362 Ga0439459_0073706 3300042438 Bacteria 794
363 Ga0439464_0008479 3300042439 Bacteria 2693
364 Ga0439464_0172032 3300042439 Bacteria 683
365 Ga0450893_0002970 3300042532 Bacteria 2671
366 Ga0451577_0347007 3300042876 Bacteria 1346
367 Ga0453684_0262755 3300044712 Bacteria 1976
368 Ga0451576_0012291 3300045051 Bacteria 9630
369 Ga0451576_0104625 3300045051 Bacteria 2945
370 Ga0451576_0444885 3300045051 Bacteria 1360
371 Ga0451576_0449674 3300045051 Bacteria 1352
372 Ga0466967_0135237 3300045976 Bacteria 2292
373 Ga0495592_0000412 3300046454 Bacteria 32712
374 Ga0495605_0058037 3300046474 Bacteria 1861
375 Ga0495610_0149296 3300046512 Bacteria 999
376 Ga0495616_0049695 3300046513 Bacteria 2101
377 Ga0495620_0125311 3300046515 Bacteria 1010
378 Ga0495632_0004104 3300046519 Bacteria 10034
379 Ga0495632_0098119 3300046519 Bacteria 1382
380 Ga0495598_0186558 3300046537 Bacteria 742
381 Ga0495621_0119608 3300046539 Bacteria 1017
382 Ga0495597_0035691 3300046542 Bacteria 2242
383 Ga0495597_0037901 3300046542 Bacteria 2163
384 Ga0495668_0316079 3300046616 Bacteria 856
385 Ga0495625_0009466 3300046660 Bacteria 8151
386 Ga0495625_0014446 3300046660 Bacteria 6302
387 Ga0495625_0082746 3300046660 Bacteria 2232
388 Ga0495625_0098298 3300046660 Bacteria 2013
389 Ga0495658_0034694 3300046683 Bacteria 2770
390 Ga0495658_0044518 3300046683 Bacteria 2488
391 Ga0495658_0081402 3300046683 Bacteria 1901
392 Ga0495649_0000518 3300046694 Bacteria 32867
393 Ga0495660_0022171 3300046810 Bacteria 3629
394 Ga0495683_0273722 3300047323 Bacteria 733
395 Ga0495687_000070 3300047443 Bacteria 159227
396 Ga0495687_019017 3300047443 Bacteria 3380
397 Ga0495626_0107313 3300048091 Bacteria 1212
398 Ga0496100_0350446 3300048903 Bacteria 1115
399 Ga0496102_0003021 3300048905 Bacteria 14248
400 Ga0496104_0105836 3300048907 Bacteria 2695
401 Ga0496105_0201107 3300048908 Bacteria 1626
402 Ga0496105_0584980 3300048908 Bacteria 868
403 Ga0496108_0141210 3300048911 Bacteria 2075
404 Ga0496108_0866781 3300048911 Bacteria 776
405 Ga0496109_0116867 3300048912 Bacteria 2482
406 Ga0496110_0154670 3300048913 Bacteria 2077
407 Ga0496110_0302120 3300048913 Bacteria 1458
408 Ga0496110_0882853 3300048913 Bacteria 800
409 Ga0496111_0272483 3300048914 Bacteria 1256
410 Ga0496113_0709951 3300048916 Unclassified 802
411 Ga0496114_0838364 3300048917 Bacteria 799
412 Ga0495682_0020407 3300049460 Bacteria 2488
413 Ga0501037_0428908 3300049573 Bacteria 904
414 Ga0501263_001316 3300049760 Bacteria 2306
415 Ga0501265_002116 3300049762 Bacteria 2264
416 Ga0501266_018498 3300049763 Bacteria 938
417 Ga0501035_0044036 3300049822 Bacteria 4021
418 Ga0501035_0372877 3300049822 Bacteria 1191
419 nmdc:mga03683_14495_c1 3300050489 Bacteria 2919
420 nmdc:mga03683_151306_c1 3300050489 Bacteria 1047
421 nmdc:mga03683_240395_c1 3300050489 Bacteria 839
422 nmdc:mga03683_26700_c1 3300050489 Bacteria 2280
423 nmdc:mga00v17_115583_c1 3300050491 Bacteria 1705
424 nmdc:mga0yw44_259481_c1 3300050492 Bacteria 1158
425 nmdc:mga0yw44_324137_c1 3300050492 Bacteria 1035
426 nmdc:mga0yw44_38724_c1 3300050492 Bacteria 2823
427 nmdc:mga0k408_132255_c1 3300050493 Bacteria 1481
428 nmdc:mga0k408_1843_c1 3300050493 Bacteria 6870
429 nmdc:mga0k408_222_c1 3300050493 Bacteria 30212
430 nmdc:mga0k408_2977_c1 3300050493 Bacteria 8983
431 nmdc:mga0k408_474883_c1 3300050493 Bacteria 742
432 nmdc:mga0k408_47611_c1 3300050493 Bacteria 2478
433 nmdc:mga0k408_6455_c1 3300050493 Bacteria 6252
434 nmdc:mga0k408_83796_c1 3300050493 Bacteria 1870
435 nmdc:mga0k408_99422_c1 3300050493 Bacteria 1714
436 nmdc:mga06z11_14801_c1 3300050494 Bacteria 3464
437 nmdc:mga06z11_45141_c1 3300050494 Bacteria 2226
438 nmdc:mga04h51_15215_c1 3300050495 Bacteria 2213
439 nmdc:mga07m45_161762_c1 3300050496 Bacteria 1300
440 nmdc:mga07m45_180769_c1 3300050496 Bacteria 1227
441 nmdc:mga07m45_185507_c1 3300050496 Bacteria 1210
442 nmdc:mga07m45_267_c1 3300050496 Bacteria 21068
443 nmdc:mga07m45_34382_c1 3300050496 Bacteria 2817
444 nmdc:mga07m45_80848_c1 3300050496 Bacteria 1856
445 nmdc:mga07m45_95444_c1 3300050496 Bacteria 1706
446 nmdc:mga0qj67_126792_c1 3300050509 Bacteria 2065
447 nmdc:mga0sz30_54211_c1 3300050516 Bacteria 1705
448 Ga0500644_0000609 3300053088 Bacteria 13452
449 Ga0500646_0056543 3300053090 Bacteria 1144
450 Ga0500651_0009593 3300053093 Bacteria 5765
451 Ga0500594_0003442 3300053118 Bacteria 3474
452 Ga0500652_063276 3300053131 Bacteria 1526
453 Ga0500658_0001841 3300053134 Bacteria 8347
454 Ga0500559_0000114 3300053136 Bacteria 63472
455 Ga0500568_0005038 3300053139 Bacteria 6918
456 Ga0500616_0166558 3300053153 Bacteria 1005
457 Ga0500622_0001923 3300053156 Bacteria 15660
458 Ga0500587_005403 3300053739 Bacteria 1718
459 Ga0590075_080656 3300059424 Bacteria 843
460 2587757140 2585428062 Bacteria 6842168
461 Ga0307517_10168878
462 rootH1_10023632
463 rootL2_10030690
464 rootL2_10055025
465 rootL2_10064422
466 Ga0070658_10122059
467 Ga0070676_10044798
468 Ga0070676_10052822
469 Ga0070676_10080695
470 Ga0070690_100017916
471 Ga0070670_100031808
472 Ga0070670_100065069
473 Ga0070670_100181440
474 Ga0070670_100310829
475 Ga0070670_100378162
476 Ga0070677_10003375
477 Ga0070677_10004032
478 Ga0070677_10063235
479 Ga0070677_10324548
480 Ga0068869_100031723
481 Ga0068869_100068797
482 Ga0068869_100412298
483 Ga0068869_100951345
484 Ga0070666_10026658
485 Ga0070666_10353027
486 Ga0068868_100001457
487 Ga0068868_100031936
488 Ga0068868_100039730
489 Ga0068868_100073557
490 Ga0068868_100074461
491 Ga0070660_100155951
492 Ga0070689_100127097
493 Ga0070661_100236422
494 Ga0070668_100489099
495 Ga0070669_100050469
496 Ga0070669_100234215
497 Ga0070675_100006016
498 Ga0070675_100336738
499 Ga0070675_100380919
500 Ga0070671_100004591
501 Ga0070671_100013382
502 Ga0070671_100018567
503 Ga0070671_100054525
504 Ga0070671_100066172
505 Ga0070674_100199102
506 Ga0070674_100464806
507 Ga0070674_100505080
508 Ga0070673_100012681
509 Ga0070673_100049472
510 Ga0070673_100229662
511 Ga0070688_100039631
512 Ga0070667_100002713
513 Ga0070667_100004227
514 Ga0070667_100300049
515 Ga0070667_100475892
516 Ga0070667_100951076
517 Ga0070663_100195063
518 Ga0070678_100006997
519 Ga0070678_100014518
520 Ga0070678_100053946
521 Ga0070678_100204635
522 Ga0070678_100223049
523 Ga0070662_100225871
524 Ga0068867_100000074
525 Ga0068867_100009306
526 Ga0068867_100063407
527 Ga0068867_100183759
528 Ga0068867_100307995
529 Ga0068867_100695313
530 Ga0070706_100150841
531 Ga0070679_100399813
532 Ga0070672_100019534
533 Ga0070672_100194036
534 Ga0070672_100290614
535 Ga0070665_100045320
536 Ga0070665_100087205
537 Ga0070665_100166986
538 Ga0068857_100076045
539 Ga0068854_100212225
540 Ga0068854_100357938
541 Ga0068854_100429572
542 Ga0068854_100599523
543 Ga0070702_100270342
544 Ga0070702_100370803
545 Ga0068852_100016267
546 Ga0068852_100238422
547 Ga0068852_100358121
548 Ga0068852_100655188
549 Ga0068859_100003627
550 Ga0068859_100045671
551 Ga0068859_100799744
552 Ga0068864_100010738
553 Ga0068864_100611234
554 Ga0068866_10132858
555 Ga0068866_10270473
556 Ga0068861_100286597
557 Ga0068861_100556805
558 Ga0068861_100593116
559 Ga0068851_10080650
560 Ga0068870_10028809
561 Ga0068863_100016977
562 Ga0068863_100163956
563 Ga0068863_100271906
564 Ga0068858_100007036
565 Ga0068860_100357178
566 Ga0068860_100392991
567 Ga0068862_100191079
568 Ga0068862_100267775
569 Ga0068862_100492245
570 Ga0075365_10031156
571 Ga0075365_10177521
572 Ga0075365_10301814
573 Ga0075363_100010961
574 Ga0075363_100038550
575 Ga0075362_10010090
576 Ga0075362_10020573
577 Ga0075362_10112619
578 Ga0075367_10207233
579 Ga0075366_10003600
580 Ga0075366_10006446
581 Ga0075366_10007391
582 Ga0075366_10048866
583 Ga0075366_10058930
584 Ga0075366_10160137
585 Ga0075366_10448005
586 Ga0097621_100071580
587 Ga0097621_100136114
588 Ga0097621_100195498
589 Ga0075370_10000145
590 Ga0075370_10008235
591 Ga0075370_10010600
592 Ga0075370_10022521
593 Ga0075370_10133205
594 Ga0075370_10394915
595 Ga0075370_10456102
596 Ga0068871_100076248
597 Ga0068871_100167190
598 Ga0068871_100215081
599 Ga0068865_100279955
600 Ga0097620_100003627
601 Ga0097620_100045673
602 Ga0097620_100799751
603 Ga0105245_10180004
604 Ga0105245_11035091
605 Ga0105243_10000513
606 Ga0105243_10230250
607 Ga0105243_10324489
608 Ga0105248_10046443
609 Ga0105248_10198308
610 Ga0105248_10398667
611 Ga0105248_10588617
612 Ga0105248_11119145
613 Ga0105237_10220122
614 Ga0105237_10827571
615 Ga0105238_10142726
616 Ga0105238_10559573
617 Ga0105249_10024209
618 Ga0105249_10129971
619 Ga0105246_10673517
620 Ga0157369_11159866
621 Ga0157374_10225256
622 Ga0157374_10291298
623 Ga0157378_10074890
624 Ga0157378_10986704
625 Ga0163162_10052155
626 Ga0163162_10066138
627 Ga0163162_10131629
628 Ga0157375_10123191
629 Ga0157375_10192903
630 Ga0157375_10211724
631 Ga0157375_11807106
632 Ga0163163_10010495
633 Ga0163163_10099087
634 Ga0157380_10213423
635 Ga0157380_10234296
636 Ga0157380_10748105
637 Ga0157380_11309488
638 Ga0157377_10000006
639 Ga0157379_10009717
640 Ga0157379_10373510
641 Ga0157379_10413421
642 Ga0157376_10003299
643 Ga0157376_10043631
644 Ga0157376_10084425
645 Ga0157376_10203209
646 Ga0163161_10062575
647 Ga0163161_10252243
648 Ga0163161_10356699
649 Ga0207656_10306990
650 Ga0207682_10001533
651 Ga0207682_10009893
652 Ga0207682_10046543
653 Ga0207642_10152620
654 Ga0207688_10066753
655 Ga0207680_10003469
656 Ga0207680_10227896
657 Ga0207645_10077310
658 Ga0207645_10147120
659 Ga0207643_10102051
660 Ga0207705_10050589
661 Ga0207684_10100111
662 Ga0207660_10060744
663 Ga0207657_10084106
664 Ga0207652_10038730
665 Ga0207652_10395180
666 Ga0207681_10554672
667 Ga0207650_10006348
668 Ga0207650_10035884
669 Ga0207650_10062106
670 Ga0207650_10067442
671 Ga0207650_10085591
672 Ga0207650_10337957
673 Ga0207659_10000163
674 Ga0207659_10147450
675 Ga0207659_10486549
676 Ga0207659_10993673
677 Ga0207687_10112080
678 Ga0207644_10000531
679 Ga0207644_10004224
680 Ga0207644_10096702
681 Ga0207644_10169351
682 Ga0207706_10006111
683 Ga0207706_10068405
684 Ga0207706_10149581
685 Ga0207706_10694134
686 Ga0207686_10023828
687 Ga0207709_10000398
688 Ga0207709_10215474
689 Ga0207709_10328917
690 Ga0207670_10007887
691 Ga0207669_10107769
692 Ga0207669_10900323
693 Ga0207704_10341106
694 Ga0207704_10459070
695 Ga0207704_10644239
696 Ga0207691_10019547
697 Ga0207691_10126226
698 Ga0207691_10148952
699 Ga0207691_10295606
700 Ga0207691_10554181
701 Ga0207711_10016732
702 Ga0207711_10137473
703 Ga0207711_10152616
704 Ga0207711_10176677
705 Ga0207689_10032170
706 Ga0207689_10070633
707 Ga0207689_10192157
708 Ga0207679_10068965
709 Ga0207679_10143856
710 Ga0207667_10040364
711 Ga0207667_10382512
712 Ga0207651_10007334
713 Ga0207651_10040046
714 Ga0207712_10541048
715 Ga0207668_10040855
716 Ga0207658_10011911
717 Ga0207658_10014762
718 Ga0207658_10243670
719 Ga0207677_10000975
720 Ga0207677_10021342
721 Ga0207677_10039052
722 Ga0207677_10047433
723 Ga0207677_10137041
724 Ga0207677_10406896
725 Ga0207703_10003822
726 Ga0207639_10158339
727 Ga0207639_10266516
728 Ga0207678_10111513
729 Ga0207708_10026014
730 Ga0207641_10003178
731 Ga0207641_10278017
732 Ga0207648_10000039
733 Ga0207648_10024425
734 Ga0207648_10026857
735 Ga0207648_10041904
736 Ga0207648_10106055
737 Ga0207648_10180329
738 Ga0207648_10246185
739 Ga0207648_10719833
740 Ga0207676_10000800
741 Ga0207676_10024324
742 Ga0207676_10181761
743 Ga0207676_10354842
744 Ga0207674_10078198
745 Ga0207674_10093024
746 Ga0207675_100063732
747 Ga0207675_100110357
748 Ga0207675_100674873
749 Ga0207683_10000801
750 Ga0207683_10083995
751 Ga0207683_10103727
752 Ga0207683_10253672
753 Ga0207683_10366704
754 Ga0207683_10499843
755 Ga0207698_10015994
756 Ga0268266_10095440
757 Ga0268265_10579210
758 Ga0268264_10194820
759 Ga0268264_10304620
760 Ga0307517_10001409
761 Ga0307517_10149654
762 Ga0307517_10149810
763 Ga0307517_10233573
764 Ga0307515_10000058
765 Ga0307515_10003752
766 Ga0307515_10017206
767 Ga0307515_10038797
768 Ga0307515_10080214
769 Ga0307515_10318541
770 Ga0307512_10012783
771 Ga0307512_10242001
772 Ga0307513_10002673
773 Ga0307513_10010428
774 Ga0307513_10262735
775 Ga0307513_10378666
776 Ga0307509_10000139
777 Ga0307509_10017835
778 Ga0307509_10026441
779 Ga0307408_100087956
780 Ga0307508_10005043
781 Ga0307508_10124597
782 Ga0307514_10233929
783 Ga0265314_10059747
784 Ga0307516_10003955
785 Ga0307516_10004445
786 Ga0307516_10069159
787 Ga0307516_10197245
788 Ga0307413_10148996
789 Ga0307518_10187775
790 Ga0307410_10414140
791 Ga0307412_10113069
792 Ga0307412_10153467
793 Ga0307412_10445460
794 Ga0307409_100706726
795 Ga0307414_10199764
796 Ga0307411_10126359
797 Ga0307507_10037593
798 Ga0307510_10000600
799 Ga0307510_10010702
800 Ga0307510_10014748
801 Ga0307510_10134169
802 Ga0373932_0017680
803 Ga0373939_0121470
804 Ga0373925_0010157
805 Ga0395900_0723447
806 Ga0395898_0020344
807 Ga0395905_0114719
808 Ga0395905_0264866
809 Ga0395901_0020641
810 Ga0395901_0641385
811 Ga0439439_0002469
812 Ga0451797_1124380
813 Ga0451800_0219770
814 Ga0451802_0060982
815 Ga0451851_1227772
816 Ga0451853_1760963
817 Ga0439449_0001702
818 Ga0439450_045284
819 Ga0439462_0048141
820 Ga0439446_0019065
821 Ga0439434_0089075
822 Ga0439459_0073706
823 Ga0439464_0008479
824 Ga0439464_0172032
825 Ga0450893_0002970
826 Ga0451577_0347007
827 Ga0453684_0262755
828 Ga0451576_0012291
829 Ga0451576_0104625
830 Ga0451576_0444885
831 Ga0451576_0449674
832 Ga0466967_0135237
833 Ga0495592_0000412
834 Ga0495605_0058037
835 Ga0495610_0149296
836 Ga0495616_0049695
837 Ga0495620_0125311
838 Ga0495632_0004104
839 Ga0495632_0098119
840 Ga0495598_0186558
841 Ga0495621_0119608
842 Ga0495597_0035691
843 Ga0495597_0037901
844 Ga0495668_0316079
845 Ga0495625_0009466
846 Ga0495625_0014446
847 Ga0495625_0082746
848 Ga0495625_0098298
849 Ga0495658_0034694
850 Ga0495658_0044518
851 Ga0495658_0081402
852 Ga0495649_0000518
853 Ga0495660_0022171
854 Ga0495683_0273722
855 Ga0495687_000070
856 Ga0495687_019017
857 Ga0495626_0107313
858 Ga0496100_0350446
859 Ga0496102_0003021
860 Ga0496104_0105836
861 Ga0496105_0201107
862 Ga0496105_0584980
863 Ga0496108_0141210
864 Ga0496108_0866781
865 Ga0496109_0116867
866 Ga0496110_0154670
867 Ga0496110_0302120
868 Ga0496110_0882853
869 Ga0496111_0272483
870 Ga0496113_0709951
871 Ga0496114_0838364
872 Ga0495682_0020407
873 Ga0501037_0428908
874 Ga0501263_001316
875 Ga0501265_002116
876 Ga0501266_018498
877 Ga0501035_0044036
878 Ga0501035_0372877
879 nmdc:mga03683_14495_c1
880 nmdc:mga03683_151306_c1
881 nmdc:mga03683_240395_c1
882 nmdc:mga03683_26700_c1
883 nmdc:mga00v17_115583_c1
884 nmdc:mga0yw44_259481_c1
885 nmdc:mga0yw44_324137_c1
886 nmdc:mga0yw44_38724_c1
887 nmdc:mga0k408_132255_c1
888 nmdc:mga0k408_1843_c1
889 nmdc:mga0k408_222_c1
890 nmdc:mga0k408_2977_c1
891 nmdc:mga0k408_474883_c1
892 nmdc:mga0k408_47611_c1
893 nmdc:mga0k408_6455_c1
894 nmdc:mga0k408_83796_c1
895 nmdc:mga0k408_99422_c1
896 nmdc:mga06z11_14801_c1
897 nmdc:mga06z11_45141_c1
898 nmdc:mga04h51_15215_c1
899 nmdc:mga07m45_161762_c1
900 nmdc:mga07m45_180769_c1
901 nmdc:mga07m45_185507_c1
902 nmdc:mga07m45_267_c1
903 nmdc:mga07m45_34382_c1
904 nmdc:mga07m45_80848_c1
905 nmdc:mga07m45_95444_c1
906 nmdc:mga0qj67_126792_c1
907 nmdc:mga0sz30_54211_c1
908 Ga0500644_0000609
909 Ga0500646_0056543
910 Ga0500651_0009593
911 Ga0500594_0003442
912 Ga0500652_063276
913 Ga0500658_0001841
914 Ga0500559_0000114
915 Ga0500568_0005038
916 Ga0500616_0166558
917 Ga0500622_0001923
918 Ga0500587_005403
919 Ga0590075_080656
920 2587757140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

19

93

0.96

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

24

88

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cbu-assembly1.cif.gz_A crystal structure of a putative glutathione s-transferase (reut_a1011) from ralstonia eutropha jmp134 at 2.05 a resolution 0.9687 1 204
3pr8-assembly1.cif.gz_B structure of glutathione s-transferase(pp0183) from pseudomonas putida in complex with gsh 0.9437 1 204
3ubk-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans 0.9397 1 204
3ubl-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501770) from leptospira interrogans with gsh bound 0.9323 1 204
3cbu-assembly1.cif.gz_A crystal structure of a putative glutathione s-transferase (reut_a1011) from ralstonia eutropha jmp134 at 2.05 a resolution 0.9318 1 204
ID Description Score Start End Superfamily
3cbuA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.964 81 204 1.20.1050.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9515 3 80 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9383 1 74 3.40.30.10
3ubkA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9353 1 78 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9276 1 74 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A257GTF8-F1-model_v4 Glutathione S-transferase 0.9925 1 167 GO:0005737
GO:0016740
AF-A0A257L1A2-F1-model_v4 Glutathione S-transferase 0.9827 1 143 GO:0005737
GO:0016740
AF-A0A257GTF8-F1-model_v4 Glutathione S-transferase 0.9809 1 167 GO:0005737
GO:0016740
AF-A0A257L1A2-F1-model_v4 Glutathione S-transferase 0.976 1 143 GO:0005737
GO:0016740
AF-A0A1E4QUG2-F1-model_v4 deleted 0.9732 1 204

Map