F448568

General Info

Members Datasets Scaffolds Average Seq Length
460 294 425 321

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10002217|Ga0265327_100022174
Length 321
Sequence VENVYRPRRTCLSVPGSSDKMIAKAKTLPADQVFLDLEDAVAADAKAAARTRVAEALCEPGWAGQLRGLRVNDWTTPWTYADVIEVVTAVARGGGELDVIVLPKVSDVSHVHALDLLLTQLERTHGLPVGRIGIEAQIEDAKGLTNADAIAGGPRVQALIFGPGDLMASLNMRTLVVGEQPVGYGVGDAYHHVLMTILVAARAHGINAIDGPYFKVKDTEAFTRVAGQTAALGYDGKWVLHPDQIAAGNEIFSPRQADYDHAELILEAYEWHTSQAGGARGAVLLGDEMIDEASRKMALVIAGKGRAAGMTRTGERFSPPA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
6 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
7 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
8 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
9 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
10 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
11 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
12 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
13 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
14 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
15 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
16 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
17 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
18 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
19 2891562705 Microbispora tritici MT50 Isolate Unclassified
20 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
21 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
22 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
23 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
24 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
25 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
26 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
27 2922554459 Rhodococcus sp. 66b Isolate Unclassified
28 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
29 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
30 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
31 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
32 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
36 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
184 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
188 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
204 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
293 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
294 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.74
Metatranscriptomes 0.65
Isolates 7.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 5.87
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10050123 3300001990 Bacteria 1269
2 JGI24735J21928_10007384 3300002067 Bacteria 3587
3 JGI24735J21928_10032429 3300002067 Bacteria 1546
4 JGI24745J21846_1001351 3300002073 Bacteria 2368
5 JGI25406J46586_10005170 3300003203 Bacteria 6053
6 Ga0055540_1000052 3300003792 Bacteria 143472
7 Ga0070670_100434066 3300005331 Bacteria 1162
8 Ga0068869_100017531 3300005334 Bacteria 4855
9 Ga0068869_100087056 3300005334 Bacteria 2343
10 Ga0070682_100230845 3300005337 Bacteria 1323
11 Ga0068868_100156744 3300005338 Bacteria 1878
12 Ga0068868_100309555 3300005338 Bacteria 1343
13 Ga0070660_100009360 3300005339 Bacteria 6885
14 Ga0070660_100043510 3300005339 Bacteria 3432
15 Ga0070689_100136404 3300005340 Bacteria 1970
16 Ga0070689_100219564 3300005340 Bacteria 1559
17 Ga0070687_100003775 3300005343 Bacteria 5939
18 Ga0070692_10079081 3300005345 Bacteria 1767
19 Ga0070668_100043811 3300005347 Bacteria 3432
20 Ga0070668_100267111 3300005347 Bacteria 1425
21 Ga0070671_100001748 3300005355 Bacteria 16507
22 Ga0070674_100113325 3300005356 Bacteria 1995
23 Ga0070673_100213194 3300005364 Bacteria 1669
24 Ga0070688_100040582 3300005365 Bacteria 2853
25 Ga0070659_100000118 3300005366 Bacteria 59407
26 Ga0070667_100007753 3300005367 Bacteria 8902
27 Ga0070667_100021634 3300005367 Bacteria 5338
28 Ga0070667_100269657 3300005367 Bacteria 1526
29 Ga0070714_100007102 3300005435 Bacteria 8686
30 Ga0070714_100034904 3300005435 Bacteria 4212
31 Ga0070714_100216703 3300005435 Bacteria 1757
32 Ga0070714_100262909 3300005435 Bacteria 1598
33 Ga0070713_100047311 3300005436 Bacteria 3535
34 Ga0070713_100184931 3300005436 Bacteria 1875
35 Ga0070710_10007632 3300005437 Bacteria 5242
36 Ga0070710_10081063 3300005437 Bacteria 1894
37 Ga0070711_100002351 3300005439 Bacteria 10752
38 Ga0070700_100000031 3300005441 Bacteria 117217
39 Ga0070700_100005474 3300005441 Bacteria 6733
40 Ga0070694_100019599 3300005444 Bacteria 4304
41 Ga0070663_100181417 3300005455 Bacteria 1633
42 Ga0070678_100030266 3300005456 Bacteria 3719
43 Ga0070678_100082677 3300005456 Bacteria 2438
44 Ga0070678_100459238 3300005456 Bacteria 1117
45 Ga0070662_100010287 3300005457 Bacteria 6133
46 Ga0070679_100006550 3300005530 Bacteria 10855
47 Ga0070684_100327574 3300005535 Bacteria 1407
48 Ga0068853_100232066 3300005539 Bacteria 1688
49 Ga0070672_100174693 3300005543 Bacteria 1788
50 Ga0070686_100010222 3300005544 Bacteria 5284
51 Ga0070695_100107622 3300005545 Bacteria 1887
52 Ga0070696_100129354 3300005546 Bacteria 1836
53 Ga0070665_100003039 3300005548 Bacteria 18078
54 Ga0070665_100011089 3300005548 Bacteria 9106
55 Ga0070665_100022561 3300005548 Bacteria 6336
56 Ga0068855_100014800 3300005563 Bacteria 9393
57 Ga0070664_100108679 3300005564 Bacteria 2419
58 Ga0070664_100126594 3300005564 Bacteria 2241
59 Ga0068857_100090200 3300005577 Bacteria 2743
60 Ga0068854_100019370 3300005578 Bacteria 4584
61 Ga0068856_100006403 3300005614 Bacteria 11551
62 Ga0068856_100009036 3300005614 Bacteria 9696
63 Ga0068856_100106497 3300005614 Bacteria 2798
64 Ga0068856_100156708 3300005614 Bacteria 2287
65 Ga0068852_100345320 3300005616 Bacteria 1452
66 Ga0068864_100071913 3300005618 Bacteria 3013
67 Ga0068866_10021408 3300005718 Bacteria 2978
68 Ga0068866_10106690 3300005718 Bacteria 1555
69 Ga0068851_10098218 3300005834 Bacteria 1550
70 Ga0068870_10063842 3300005840 Bacteria 1987
71 Ga0068863_100000580 3300005841 Bacteria 37264
72 Ga0068863_100109068 3300005841 Bacteria 2635
73 Ga0068858_100000328 3300005842 Bacteria 50178
74 Ga0068858_100020931 3300005842 Bacteria 6112
75 Ga0068860_100000345 3300005843 Bacteria 62383
76 Ga0068860_100042279 3300005843 Bacteria 4353
77 Ga0068860_100060595 3300005843 Bacteria 3597
78 Ga0081455_10000507 3300005937 Bacteria 50462
79 Ga0081455_10033981 3300005937 Bacteria 4575
80 Ga0081455_10040578 3300005937 Bacteria 4102
81 Ga0081538_10000095 3300005981 Bacteria 86487
82 Ga0081540_1000710 3300005983 Bacteria 30907
83 Ga0081540_1066502 3300005983 Bacteria 1689
84 Ga0081539_10000272 3300005985 Bacteria 118649
85 Ga0081539_10005560 3300005985 Bacteria 12768
86 Ga0081539_10020947 3300005985 Bacteria 4390
87 Ga0070717_10075662 3300006028 Bacteria 2816
88 Ga0070717_10350538 3300006028 Bacteria 1320
89 Ga0075363_100046156 3300006048 Bacteria 2311
90 Ga0070715_10005387 3300006163 Bacteria 4263
91 Ga0070716_100001095 3300006173 Bacteria 11898
92 Ga0070716_100005851 3300006173 Bacteria 5975
93 Ga0070712_100005917 3300006175 Bacteria 7568
94 Ga0097621_100019065 3300006237 Bacteria 5259
95 Ga0097621_100166517 3300006237 Bacteria 1898
96 Ga0068871_100105622 3300006358 Bacteria 2363
97 Ga0068871_100282500 3300006358 Bacteria 1452
98 Ga0075428_100002618 3300006844 Bacteria 19591
99 Ga0075428_100023167 3300006844 Bacteria 6869
100 Ga0075430_100000734 3300006846 Bacteria 25115
101 Ga0075431_100001048 3300006847 Bacteria 24677
102 Ga0075431_100002049 3300006847 Bacteria 19255
103 Ga0075429_100000366 3300006880 Bacteria 33350
104 Ga0075429_100026194 3300006880 Bacteria 5061
105 Ga0068865_100129155 3300006881 Bacteria 1891
106 Ga0075436_100112115 3300006914 Bacteria 1904
107 Ga0075435_100007664 3300007076 Bacteria 7710
108 Ga0105240_10053377 3300009093 Bacteria 5073
109 Ga0105240_10119840 3300009093 Bacteria 3169
110 Ga0105240_10481320 3300009093 Bacteria 1384
111 Ga0105240_10683817 3300009093 Bacteria 1121
112 Ga0105245_10043338 3300009098 Bacteria 4013
113 Ga0105245_10174023 3300009098 Bacteria 2052
114 Ga0114129_10003185 3300009147 Bacteria 23009
115 Ga0114129_10091315 3300009147 Bacteria 4219
116 Ga0105243_10000243 3300009148 Bacteria 62451
117 Ga0105241_10292680 3300009174 Bacteria 1395
118 Ga0105248_10000450 3300009177 Bacteria 46809
119 Ga0105248_10023561 3300009177 Bacteria 6839
120 Ga0105248_10031564 3300009177 Bacteria 5920
121 Ga0105248_10338197 3300009177 Bacteria 1695
122 Ga0105237_10048304 3300009545 Bacteria 4278
123 Ga0105237_10188298 3300009545 Bacteria 2064
124 Ga0105238_10032836 3300009551 Bacteria 5283
125 Ga0105249_10004171 3300009553 Bacteria 12481
126 Ga0105249_10075485 3300009553 Bacteria 3122
127 Ga0105239_10118719 3300010375 Bacteria 2935
128 Ga0105239_10169295 3300010375 Bacteria 2443
129 Ga0105246_10016685 3300011119 Bacteria 4654
130 Ga0157373_10132994 3300013100 Bacteria 1749
131 Ga0157370_10018215 3300013104 Bacteria 7066
132 Ga0157370_10064903 3300013104 Bacteria 3455
133 Ga0157369_10442983 3300013105 Bacteria 1345
134 Ga0157378_10254131 3300013297 Bacteria 1684
135 Ga0163162_10159020 3300013306 Bacteria 2380
136 Ga0157372_10000023 3300013307 Bacteria 198536
137 Ga0157372_10074981 3300013307 Bacteria 3816
138 Ga0157375_10498275 3300013308 Bacteria 1382
139 Ga0163163_10008174 3300014325 Bacteria 9280
140 Ga0163163_10079453 3300014325 Bacteria 3278
141 Ga0163163_10086125 3300014325 Bacteria 3150
142 Ga0157380_10186319 3300014326 Bacteria 1828
143 Ga0157377_10037100 3300014745 Bacteria 2685
144 Ga0157379_10000015 3300014968 Bacteria 104289
145 Ga0157379_10002387 3300014968 Bacteria 15694
146 Ga0163161_10005938 3300017792 Bacteria 8463
147 Ga0206353_11004473 3300020082 Bacteria 1608
148 Ga0224712_10009359 3300022467 Bacteria 2950
149 Ga0207692_10000457 3300025898 Bacteria 14468
150 Ga0207692_10003071 3300025898 Bacteria 6481
151 Ga0207642_10065658 3300025899 Bacteria 1706
152 Ga0207710_10067393 3300025900 Bacteria 1635
153 Ga0207688_10000271 3300025901 Bacteria 23580
154 Ga0207680_10120961 3300025903 Bacteria 1712
155 Ga0207680_10189588 3300025903 Bacteria 1395
156 Ga0207647_10046448 3300025904 Bacteria 2706
157 Ga0207647_10068168 3300025904 Bacteria 2154
158 Ga0207647_10098969 3300025904 Bacteria 1732
159 Ga0207685_10012715 3300025905 Bacteria 2579
160 Ga0207699_10088511 3300025906 Bacteria 1938
161 Ga0207645_10058998 3300025907 Bacteria 2450
162 Ga0207643_10013687 3300025908 Bacteria 4398
163 Ga0207707_10007451 3300025912 Bacteria 9534
164 Ga0207695_10044375 3300025913 Bacteria 4728
165 Ga0207671_10055038 3300025914 Bacteria 2948
166 Ga0207693_10002100 3300025915 Bacteria 17387
167 Ga0207693_10007135 3300025915 Bacteria 9218
168 Ga0207660_10086086 3300025917 Bacteria 2320
169 Ga0207662_10008030 3300025918 Bacteria 5758
170 Ga0207662_10032360 3300025918 Bacteria 3044
171 Ga0207657_10037757 3300025919 Bacteria 4309
172 Ga0207657_10169496 3300025919 Bacteria 1770
173 Ga0207657_10271298 3300025919 Bacteria 1349
174 Ga0207652_10030119 3300025921 Bacteria 4542
175 Ga0207694_10064920 3300025924 Bacteria 2846
176 Ga0207694_10317040 3300025924 Bacteria 1286
177 Ga0207687_10015443 3300025927 Bacteria 5008
178 Ga0207687_10024623 3300025927 Bacteria 4023
179 Ga0207687_10068687 3300025927 Bacteria 2525
180 Ga0207687_10077583 3300025927 Bacteria 2389
181 Ga0207700_10036912 3300025928 Bacteria 3534
182 Ga0207700_10041369 3300025928 Bacteria 3371
183 Ga0207664_10000002 3300025929 Bacteria 657053
184 Ga0207664_10003961 3300025929 Bacteria 9968
185 Ga0207664_10014039 3300025929 Bacteria 5775
186 Ga0207664_10168631 3300025929 Bacteria 1872
187 Ga0207644_10001436 3300025931 Bacteria 15349
188 Ga0207690_10000065 3300025932 Bacteria 94536
189 Ga0207690_10006056 3300025932 Bacteria 7164
190 Ga0207690_10023030 3300025932 Bacteria 3883
191 Ga0207686_10015402 3300025934 Bacteria 4275
192 Ga0207709_10006172 3300025935 Bacteria 6749
193 Ga0207709_10118437 3300025935 Bacteria 1784
194 Ga0207709_10120355 3300025935 Bacteria 1771
195 Ga0207670_10103154 3300025936 Bacteria 2040
196 Ga0207665_10000467 3300025939 Bacteria 27660
197 Ga0207665_10002449 3300025939 Bacteria 12529
198 Ga0207691_10189698 3300025940 Bacteria 1793
199 Ga0207711_10000395 3300025941 Bacteria 46418
200 Ga0207711_10000967 3300025941 Bacteria 27498
201 Ga0207689_10003447 3300025942 Bacteria 14440
202 Ga0207689_10065156 3300025942 Bacteria 2997
203 Ga0207689_10082249 3300025942 Bacteria 2647
204 Ga0207679_10116457 3300025945 Bacteria 2119
205 Ga0207667_10046503 3300025949 Bacteria 4595
206 Ga0207667_10052382 3300025949 Bacteria 4298
207 Ga0207712_10005038 3300025961 Bacteria 8360
208 Ga0207712_10037930 3300025961 Bacteria 3292
209 Ga0207668_10127149 3300025972 Bacteria 1940
210 Ga0207668_10166232 3300025972 Bacteria 1725
211 Ga0207658_10002834 3300025986 Bacteria 12422
212 Ga0207658_10085348 3300025986 Bacteria 2432
213 Ga0207677_10018006 3300026023 Bacteria 4230
214 Ga0207703_10000094 3300026035 Bacteria 104297
215 Ga0207703_10000264 3300026035 Bacteria 58616
216 Ga0207639_10053748 3300026041 Bacteria 3074
217 Ga0207639_10157600 3300026041 Bacteria 1909
218 Ga0207678_10261818 3300026067 Bacteria 1482
219 Ga0207708_10000046 3300026075 Bacteria 116515
220 Ga0207708_10027529 3300026075 Bacteria 4304
221 Ga0207702_10014132 3300026078 Bacteria 6630
222 Ga0207702_10032629 3300026078 Bacteria 4345
223 Ga0207702_10096079 3300026078 Bacteria 2605
224 Ga0207641_10000562 3300026088 Bacteria 41565
225 Ga0207641_10003346 3300026088 Bacteria 14253
226 Ga0207641_10024371 3300026088 Bacteria 4987
227 Ga0207641_10116438 3300026088 Bacteria 2378
228 Ga0207648_10020505 3300026089 Bacteria 5951
229 Ga0207674_10023402 3300026116 Bacteria 6618
230 Ga0207675_100010593 3300026118 Bacteria 8636
231 Ga0207675_100256268 3300026118 Bacteria 1695
232 Ga0207683_10003326 3300026121 Bacteria 14009
233 Ga0207683_10255656 3300026121 Bacteria 1599
234 Ga0207698_10024682 3300026142 Bacteria 4224
235 Ga0268266_10010107 3300028379 Bacteria 8273
236 Ga0268266_10016725 3300028379 Bacteria 6271
237 Ga0268266_10035341 3300028379 Bacteria 4251
238 Ga0268266_10101574 3300028379 Bacteria 2536
239 Ga0268266_10112095 3300028379 Bacteria 2418
240 Ga0268266_10187609 3300028379 Bacteria 1886
241 Ga0268266_10345617 3300028379 Bacteria 1397
242 Ga0268265_10038419 3300028380 Bacteria 3522
243 Ga0268264_10000257 3300028381 Bacteria 96251
244 Ga0268264_10003187 3300028381 Bacteria 14212
245 Ga0307511_10022840 3300030521 Bacteria 5848
246 Ga0316180_1041813 3300030736 Bacteria 1580
247 Ga0265327_10002217 3300031251 Bacteria 21198
248 Ga0307513_10013296 3300031456 Bacteria 10107
249 Ga0307509_10026874 3300031507 Bacteria 6411
250 Ga0307509_10050338 3300031507 Bacteria 4461
251 Ga0316579_10001073 3300031691 Bacteria 9668
252 Ga0316579_10006195 3300031691 Bacteria 4867
253 Ga0316576_10022525 3300031727 Bacteria 4376
254 Ga0316576_10036229 3300031727 Bacteria 3526
255 Ga0316576_10053157 3300031727 Bacteria 2951
256 Ga0316576_10081277 3300031727 Bacteria 2404
257 Ga0316578_10026645 3300031728 Bacteria 3262
258 Ga0316578_10042850 3300031728 Bacteria 2626
259 Ga0307409_100394359 3300031995 Bacteria 1320
260 Ga0307415_100024379 3300032126 Bacteria 3776
261 Ga0316585_10005101 3300032137 Bacteria 3694
262 Ga0316580_10010547 3300032139 Bacteria 2795
263 Ga0307507_10000113 3300033179 Bacteria 133812
264 Ga0373929_0011094 3300035085 Bacteria 1693
265 Ga0373940_0024768 3300035088 Bacteria 1558
266 Ga0373939_0023207 3300035114 Bacteria 1717
267 Ga0316574_0076919 3300035398 Bacteria 2114
268 Ga0373931_0003248 3300035691 Bacteria 7265
269 Ga0372808_000099 3300036459 Bacteria 4349
270 Ga0316582_0031606 3300036647 Bacteria 3237
271 Ga0316582_0293105 3300036647 Bacteria 1117
272 Ga0316584_0063639 3300036712 Bacteria 2761
273 Ga0373925_0002789 3300037068 Bacteria 13799
274 Ga0373925_0145569 3300037068 Bacteria 1857
275 Ga0395900_0135773 3300037418 Bacteria 2520
276 Ga0395898_0275835 3300037466 Bacteria 1604
277 Ga0316581_0007610 3300037588 Bacteria 2915
278 Ga0436365_0414071 3300039437 Bacteria 3216
279 Ga0451797_1504186 3300041453 Bacteria 1113
280 Ga0451802_1703259 3300041460 Bacteria 1408
281 Ga0451853_3757730 3300041512 Bacteria 6863
282 Ga0451577_0341974 3300042876 Bacteria 1357
283 Ga0466969_0008445 3300044656 Bacteria 5464
284 Ga0466965_0121452 3300044683 Bacteria 1350
285 Ga0466966_0006392 3300044684 Bacteria 7792
286 Ga0466966_0012359 3300044684 Bacteria 5657
287 Ga0466966_0087660 3300044684 Bacteria 1934
288 Ga0466966_0281719 3300044684 Bacteria 1000
289 Ga0466961_0018149 3300044693 Bacteria 4525
290 Ga0466961_0028853 3300044693 Bacteria 3568
291 Ga0466961_0033302 3300044693 Bacteria 3312
292 Ga0466961_0054786 3300044693 Bacteria 2543
293 Ga0466961_0075845 3300044693 Bacteria 2131
294 Ga0466963_0002774 3300044694 Bacteria 9872
295 Ga0466963_0094390 3300044694 Bacteria 2040
296 Ga0466964_0053300 3300044706 Bacteria 1665
297 Ga0466971_0001405 3300044719 Bacteria 10116
298 Ga0466971_0009818 3300044719 Bacteria 4179
299 Ga0466971_0018780 3300044719 Bacteria 3065
300 Ga0466971_0063241 3300044719 Bacteria 1675
301 Ga0466970_0050697 3300044765 Bacteria 2214
302 Ga0466970_0070336 3300044765 Bacteria 1881
303 Ga0466957_0083747 3300044842 Bacteria 1990
304 Ga0466957_0129469 3300044842 Bacteria 1615
305 Ga0466960_0006063 3300044901 Bacteria 4832
306 Ga0466960_0013453 3300044901 Bacteria 3477
307 Ga0466959_0002255 3300045049 Bacteria 12286
308 Ga0466959_0020629 3300045049 Bacteria 4856
309 Ga0466959_0054433 3300045049 Bacteria 2923
310 Ga0466959_0162401 3300045049 Bacteria 1570
311 Ga0466958_0012043 3300045836 Bacteria 4888
312 Ga0466958_0013606 3300045836 Bacteria 4636
313 Ga0466958_0025781 3300045836 Bacteria 3469
314 Ga0466958_0068841 3300045836 Bacteria 2164
315 Ga0466958_0143499 3300045836 Bacteria 1504
316 Ga0466958_0145696 3300045836 Bacteria 1492
317 Ga0466958_0152176 3300045836 Bacteria 1459
318 Ga0466967_0002592 3300045976 Bacteria 11362
319 Ga0466967_0006323 3300045976 Bacteria 8363
320 Ga0466967_0017321 3300045976 Bacteria 5715
321 Ga0466967_0042666 3300045976 Bacteria 3921
322 Ga0466967_0145185 3300045976 Bacteria 2213
323 Ga0466967_0146178 3300045976 Bacteria 2205
324 Ga0495592_0126695 3300046454 Bacteria 1790
325 Ga0495651_0014196 3300046462 Bacteria 6156
326 Ga0495662_0073527 3300046476 Bacteria 1658
327 Ga0495664_0015224 3300046477 Bacteria 4370
328 Ga0495594_0002125 3300046499 Bacteria 10318
329 Ga0495652_0027338 3300046529 Bacteria 5026
330 Ga0495652_0160811 3300046529 Bacteria 1744
331 Ga0495665_0018528 3300046531 Bacteria 3740
332 Ga0495665_0020375 3300046531 Bacteria 3562
333 Ga0495640_0021235 3300046533 Bacteria 4768
334 Ga0495645_0127341 3300046543 Bacteria 1788
335 Ga0495645_0248414 3300046543 Bacteria 1183
336 Ga0495656_0145649 3300046615 Bacteria 1140
337 Ga0495635_0027273 3300046663 Bacteria 3973
338 Ga0495588_0062705 3300046674 Bacteria 1927
339 Ga0495599_0166061 3300046678 Bacteria 1363
340 Ga0495623_0006899 3300046679 Bacteria 7386
341 Ga0495646_0151876 3300046680 Bacteria 1287
342 Ga0495600_0024783 3300046809 Bacteria 3863
343 Ga0495581_0020290 3300047315 Bacteria 3858
344 Ga0495581_0095423 3300047315 Bacteria 1727
345 Ga0495674_0001809 3300047319 Bacteria 21070
346 Ga0495672_0048202 3300047320 Bacteria 2528
347 Ga0495675_0164531 3300047444 Bacteria 1365
348 Ga0495602_0066827 3300048088 Bacteria 3096
349 Ga0496100_0366178 3300048903 Bacteria 1092
350 Ga0496101_0112881 3300048904 Bacteria 2047
351 Ga0496102_0028239 3300048905 Bacteria 5010
352 Ga0496104_0000745 3300048907 Bacteria 27865
353 Ga0496105_0001842 3300048908 Bacteria 15200
354 Ga0496105_0016809 3300048908 Bacteria 5849
355 Ga0496105_0184945 3300048908 Bacteria 1705
356 Ga0496106_0016463 3300048909 Bacteria 5470
357 Ga0496107_0028579 3300048910 Bacteria 3963
358 Ga0496108_0011563 3300048911 Bacteria 7177
359 Ga0496108_0032843 3300048911 Bacteria 4310
360 Ga0496108_0160083 3300048911 Bacteria 1945
361 Ga0496109_0021867 3300048912 Bacteria 5662
362 Ga0496109_0029648 3300048912 Bacteria 4901
363 Ga0496110_0188457 3300048913 Bacteria 1873
364 Ga0496111_0163791 3300048914 Bacteria 1651
365 Ga0496111_0248109 3300048914 Bacteria 1321
366 Ga0496112_0000115 3300048915 Bacteria 49432
367 Ga0496112_0297024 3300048915 Bacteria 1561
368 Ga0496113_0013815 3300048916 Bacteria 5486
369 Ga0496113_0089431 3300048916 Bacteria 2370
370 Ga0496113_0220529 3300048916 Bacteria 1511
371 Ga0496114_0086463 3300048917 Bacteria 2657
372 Ga0496114_0304664 3300048917 Bacteria 1407
373 Ga0496115_0032381 3300048918 Bacteria 4124
374 Ga0496119_0000549 3300048922 Bacteria 51126
375 Ga0496120_0004382 3300048923 Bacteria 11881
376 Ga0496126_0000035 3300048929 Bacteria 361590
377 Ga0501032_0098116 3300049569 Bacteria 1942
378 Ga0501034_0033748 3300049571 Bacteria 5188
379 Ga0501034_0122311 3300049571 Bacteria 2589
380 Ga0501036_0002148 3300049572 Bacteria 15399
381 Ga0501036_0002746 3300049572 Bacteria 13913
382 Ga0501037_0007682 3300049573 Bacteria 7893
383 Ga0501037_0090921 3300049573 Bacteria 2207
384 Ga0501038_0035020 3300049574 Bacteria 4412
385 Ga0501038_0093802 3300049574 Bacteria 2510
386 Ga0501039_0001814 3300049575 Bacteria 15781
387 Ga0501039_0053836 3300049575 Bacteria 3115
388 Ga0501040_0061253 3300049576 Bacteria 2587
389 Ga0501040_0062059 3300049576 Bacteria 2571
390 Ga0501042_0049122 3300049578 Bacteria 3009
391 Ga0501043_0002254 3300049579 Bacteria 16404
392 Ga0501046_0063856 3300049580 Bacteria 2875
393 Ga0501047_0001099 3300049581 Bacteria 26908
394 Ga0501047_0061428 3300049581 Bacteria 3625
395 Ga0501048_0012395 3300049582 Bacteria 6342
396 Ga0501048_0057187 3300049582 Bacteria 2766
397 Ga0501068_0004875 3300049584 Bacteria 7306
398 Ga0501071_0056001 3300049587 Bacteria 2847
399 Ga0501071_0089816 3300049587 Bacteria 2255
400 Ga0501072_0001733 3300049588 Bacteria 16265
401 Ga0501074_0103279 3300049590 Bacteria 2040
402 Ga0501075_0060512 3300049591 Bacteria 2853
403 Ga0501075_0108114 3300049591 Bacteria 2114
404 Ga0501076_0047495 3300049592 Bacteria 3394
405 Ga0501077_0033585 3300049593 Bacteria 3266
406 Ga0501077_0034314 3300049593 Bacteria 3229
407 Ga0501081_0091046 3300049743 Bacteria 2145
408 Ga0501081_0220765 3300049743 Bacteria 1378
409 Ga0501035_0021109 3300049822 Bacteria 5988
410 Ga0501045_0024592 3300049824 Bacteria 4325
411 Ga0501045_0202932 3300049824 Bacteria 1477
412 Ga0501045_0358819 3300049824 Bacteria 1085
413 nmdc:mga03n38_89668_c1 3300050490 Bacteria 1461
414 nmdc:mga05p37_2502_c1 3300050507 Bacteria 21370
415 nmdc:mga05p37_6774_c1 3300050507 Bacteria 13505
416 nmdc:mga09592_2961_c1 3300050508 Bacteria 13762
417 nmdc:mga09592_890_c1 3300050508 Bacteria 23417
418 nmdc:mga06r32_12_c1 3300050510 Bacteria 111318
419 nmdc:mga08y16_199598_c1 3300050511 Bacteria 2073
420 Ga0495612_0020139 3300053078 Bacteria 2673
421 Ga0495619_0122646 3300053085 Bacteria 1782
422 Ga0500559_0002151 3300053136 Bacteria 10482
423 Ga0501082_0207835 3300060353 Bacteria 1703
424 Ga0466962_0000133 3300061719 Bacteria 30437
425 Ga0530510_0095418 3300061734 Bacteria 2172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100043510 Ga0070660_1000435104 306
2 3300005366 Ga0070659_100000118 Ga0070659_10000011833 306
3 3300025919 Ga0207657_10169496 Ga0207657_101694963 306
4 3300025932 Ga0207690_10000065 Ga0207690_100000652 306
5 3300026023 Ga0207677_10018006 Ga0207677_100180065 306
6 3300048908 Ga0496105_0001842 Ga0496105_0001842_10382_11347 306
7 3300048914 Ga0496111_0163791 Ga0496111_0163791_269_1234 306
8 3300005367 Ga0070667_100007753 Ga0070667_1000077537 308
9 3300009553 Ga0105249_10075485 Ga0105249_100754853 308
10 3300025932 Ga0207690_10023030 Ga0207690_100230305 308
11 3300037466 Ga0395898_0275835 Ga0395898_0275835_624_1550 308
12 3300039437 Ga0436365_0414071 Ga0436365_0414071_1787_2719 308
13 iso_pu_bacteria 2856741275 2856748425 308
14 iso_pu_bacteria 2891395885 2891399458 308
15 iso_pu_bacteria 2891554331 2891560758 308
16 iso_pu_bacteria 2891562705 2891564233 308
17 iso_pu_bacteria 3002998708 3003005793 309
18 iso_pu_bacteria 8053945823 8053946410 309
19 iso_pu_bacteria 2744054611 2744954662 310
20 iso_pu_bacteria 2751185725 2753039123 310
21 iso_pu_bacteria 2751185792 2753327634 310
22 iso_pu_bacteria 2547132424 2548698674 311
23 iso_pu_bacteria 2919713450 2919719349 311
24 3300005530 Ga0070679_100006550 Ga0070679_10000655011 312
25 3300009177 Ga0105248_10000450 Ga0105248_1000045043 312
26 3300014325 Ga0163163_10079453 Ga0163163_100794533 312
27 3300014968 Ga0157379_10000015 Ga0157379_1000001570 312
28 3300025912 Ga0207707_10007451 Ga0207707_100074519 312
29 3300025917 Ga0207660_10086086 Ga0207660_100860862 312
30 3300025921 Ga0207652_10030119 Ga0207652_100301194 312
31 3300025941 Ga0207711_10000967 Ga0207711_1000096724 312
32 3300026035 Ga0207703_10000094 Ga0207703_1000009470 312
33 3300049569 Ga0501032_0098116 Ga0501032_0098116_390_1328 312
34 3300049571 Ga0501034_0033748 Ga0501034_0033748_272_1210 312
35 3300049572 Ga0501036_0002746 Ga0501036_0002746_5102_6040 312
36 3300049573 Ga0501037_0090921 Ga0501037_0090921_841_1779 312
37 3300049574 Ga0501038_0035020 Ga0501038_0035020_499_1437 312
38 3300049579 Ga0501043_0002254 Ga0501043_0002254_499_1437 312
39 3300049581 Ga0501047_0061428 Ga0501047_0061428_2188_3126 312
40 3300049593 Ga0501077_0034314 Ga0501077_0034314_1535_2473 312
41 3300049824 Ga0501045_0358819 Ga0501045_0358819_27_965 312
42 iso_pu_bacteria 2558860280 2559426963 312
43 3300041453 Ga0451797_1504186 Ga0451797_1504186_96_1037 313
44 3300044719 Ga0466971_0009818 Ga0466971_0009818_1654_2595 313
45 3300045836 Ga0466958_0143499 Ga0466958_0143499_424_1365 313
46 3300046476 Ga0495662_0073527 Ga0495662_0073527_566_1585 313
47 3300046499 Ga0495594_0002125 Ga0495594_0002125_8485_9432 313
48 3300046543 Ga0495645_0127341 Ga0495645_0127341_87_1106 313
49 3300047315 Ga0495581_0095423 Ga0495581_0095423_245_1192 313
50 iso_pu_bacteria 2738543034 2739366130 313
51 iso_pu_bacteria 2738543011 2739238539 314
52 iso_pu_bacteria 2863067949 2863068902 314
53 iso_pu_bacteria 2870782633 2870783481 314
54 iso_pu_bacteria 2889300758 2889302973 314
55 iso_pu_bacteria 2904765812 2904767289 314
56 iso_pu_bacteria 2904770941 2904775827 314
57 iso_pu_bacteria 2908811453 2908812941 314
58 iso_pu_bacteria 2919420072 2919424089 314
59 iso_pu_bacteria 2919432681 2919436459 314
60 iso_pu_bacteria 2939743619 2939746149 314
61 iso_pu_bacteria 8056207758 8056215369 314
62 3300003792 Ga0055540_1000052 Ga0055540_10000528 315
63 3300005367 Ga0070667_100021634 Ga0070667_1000216342 315
64 3300005435 Ga0070714_100007102 Ga0070714_1000071024 315
65 3300025924 Ga0207694_10064920 Ga0207694_100649201 315
66 3300025929 Ga0207664_10168631 Ga0207664_101686312 315
67 3300026041 Ga0207639_10157600 Ga0207639_101576002 315
68 3300031251 Ga0265327_10002217 Ga0265327_100022174 315
69 3300036459 Ga0372808_000099 Ga0372808_000099_1454_2419 315
70 iso_pu_bacteria 2565956761 2566997368 315
71 iso_pu_bacteria 2738543005 2739203904 315
72 iso_pu_bacteria 2904535858 2904538297 315
73 iso_pu_bacteria 2922554459 2922557489 315
74 iso_pu_bacteria 2928142448 2928145634 315
75 3300002073 JGI24745J21846_1001351 JGI24745J21846_10013512 316
76 3300005331 Ga0070670_100434066 Ga0070670_1004340662 316
77 3300005338 Ga0068868_100309555 Ga0068868_1003095552 316
78 3300005340 Ga0070689_100136404 Ga0070689_1001364042 316
79 3300005364 Ga0070673_100213194 Ga0070673_1002131942 316
80 3300005441 Ga0070700_100005474 Ga0070700_1000054743 316
81 3300005456 Ga0070678_100082677 Ga0070678_1000826771 316
82 3300005535 Ga0070684_100327574 Ga0070684_1003275741 316
83 3300005578 Ga0068854_100019370 Ga0068854_1000193702 316
84 3300005614 Ga0068856_100156708 Ga0068856_1001567082 316
85 3300005618 Ga0068864_100071913 Ga0068864_1000719133 316
86 3300005840 Ga0068870_10063842 Ga0068870_100638422 316
87 3300005983 Ga0081540_1066502 Ga0081540_10665021 316
88 3300006237 Ga0097621_100166517 Ga0097621_1001665172 316
89 3300006358 Ga0068871_100282500 Ga0068871_1002825002 316
90 3300006844 Ga0075428_100023167 Ga0075428_1000231672 316
91 3300009098 Ga0105245_10174023 Ga0105245_101740232 316
92 3300010375 Ga0105239_10169295 Ga0105239_101692952 316
93 3300013306 Ga0163162_10159020 Ga0163162_101590202 316
94 3300013308 Ga0157375_10498275 Ga0157375_104982752 316
95 3300014745 Ga0157377_10037100 Ga0157377_100371003 316
96 3300025900 Ga0207710_10067393 Ga0207710_100673932 316
97 3300025903 Ga0207680_10189588 Ga0207680_101895882 316
98 3300025907 Ga0207645_10058998 Ga0207645_100589982 316
99 3300025908 Ga0207643_10013687 Ga0207643_100136875 316
100 3300025918 Ga0207662_10032360 Ga0207662_100323604 316
101 3300025919 Ga0207657_10037757 Ga0207657_100377572 316
102 3300025927 Ga0207687_10024623 Ga0207687_100246233 316
103 3300025927 Ga0207687_10068687 Ga0207687_100686872 316
104 3300025927 Ga0207687_10077583 Ga0207687_100775832 316
105 3300025936 Ga0207670_10103154 Ga0207670_101031542 316
106 3300025961 Ga0207712_10037930 Ga0207712_100379302 316
107 3300026075 Ga0207708_10027529 Ga0207708_100275292 316
108 3300026088 Ga0207641_10024371 Ga0207641_100243712 316
109 3300026089 Ga0207648_10020505 Ga0207648_100205052 316
110 3300026118 Ga0207675_100010593 Ga0207675_1000105939 316
111 3300028379 Ga0268266_10035341 Ga0268266_100353412 316
112 3300028379 Ga0268266_10187609 Ga0268266_101876092 316
113 3300028380 Ga0268265_10038419 Ga0268265_100384192 316
114 3300037418 Ga0395900_0135773 Ga0395900_0135773_1190_2149 316
115 3300048903 Ga0496100_0366178 Ga0496100_0366178_122_1081 316
116 3300048908 Ga0496105_0184945 Ga0496105_0184945_539_1495 316
117 3300048911 Ga0496108_0160083 Ga0496108_0160083_58_1014 316
118 3300048913 Ga0496110_0188457 Ga0496110_0188457_470_1426 316
119 3300048917 Ga0496114_0304664 Ga0496114_0304664_52_1092 316
120 3300050511 nmdc:mga08y16_199598_c1 nmdc:mga08y16_199598_c1_932_1891 316
121 iso_pu_bacteria 2558860112 2558909286 316
122 iso_pu_bacteria 2974315732 2974318200 316
123 iso_pu_bacteria 2984523437 2984526412 316
124 3300005435 Ga0070714_100262909 Ga0070714_1002629092 317
125 3300005437 Ga0070710_10007632 Ga0070710_100076324 317
126 3300005614 Ga0068856_100009036 Ga0068856_10000903610 317
127 3300006028 Ga0070717_10075662 Ga0070717_100756623 317
128 3300006163 Ga0070715_10005387 Ga0070715_100053875 317
129 3300006173 Ga0070716_100005851 Ga0070716_1000058515 317
130 3300009148 Ga0105243_10000243 Ga0105243_1000024339 317
131 3300025898 Ga0207692_10003071 Ga0207692_100030713 317
132 3300025905 Ga0207685_10012715 Ga0207685_100127152 317
133 3300025906 Ga0207699_10088511 Ga0207699_100885112 317
134 3300025915 Ga0207693_10002100 Ga0207693_1000210016 317
135 3300025928 Ga0207700_10041369 Ga0207700_100413694 317
136 3300025929 Ga0207664_10003961 Ga0207664_100039613 317
137 3300025935 Ga0207709_10006172 Ga0207709_100061725 317
138 3300025939 Ga0207665_10000467 Ga0207665_1000046728 317
139 3300026078 Ga0207702_10032629 Ga0207702_100326294 317
140 3300031691 Ga0316579_10001073 Ga0316579_100010732 317
141 3300037068 Ga0373925_0002789 Ga0373925_0002789_10955_11968 317
142 3300037068 Ga0373925_0145569 Ga0373925_0145569_341_1360 317
143 3300041460 Ga0451802_1703259 Ga0451802_1703259_372_1334 317
144 3300046529 Ga0495652_0160811 Ga0495652_0160811_56_1075 317
145 3300046531 Ga0495665_0018528 Ga0495665_0018528_1954_2916 317
146 3300046533 Ga0495640_0021235 Ga0495640_0021235_607_1626 317
147 3300046615 Ga0495656_0145649 Ga0495656_0145649_72_1034 317
148 3300046678 Ga0495599_0166061 Ga0495599_0166061_212_1231 317
149 3300047315 Ga0495581_0020290 Ga0495581_0020290_1526_2488 317
150 3300047319 Ga0495674_0001809 Ga0495674_0001809_14037_15056 317
151 3300048905 Ga0496102_0028239 Ga0496102_0028239_745_1743 317
152 3300048907 Ga0496104_0000745 Ga0496104_0000745_17977_18975 317
153 3300048911 Ga0496108_0011563 Ga0496108_0011563_1298_2296 317
154 3300048912 Ga0496109_0021867 Ga0496109_0021867_277_1275 317
155 3300048915 Ga0496112_0000115 Ga0496112_0000115_37695_38693 317
156 3300048916 Ga0496113_0013815 Ga0496113_0013815_484_1482 317
157 3300048917 Ga0496114_0086463 Ga0496114_0086463_491_1489 317
158 3300048918 Ga0496115_0032381 Ga0496115_0032381_2049_3047 317
159 3300048929 Ga0496126_0000035 Ga0496126_0000035_79052_80008 317
160 3300050490 nmdc:mga03n38_89668_c1 nmdc:mga03n38_89668_c1_12_1169 317
161 3300053136 Ga0500559_0002151 Ga0500559_0002151_1392_2351 317
162 iso_pu_bacteria 2816332119 2816426745 317
163 iso_pu_bacteria 2816332139 2816511543 317
164 3300005334 Ga0068869_100017531 Ga0068869_1000175312 318
165 3300005338 Ga0068868_100156744 Ga0068868_1001567442 318
166 3300005339 Ga0070660_100009360 Ga0070660_1000093603 318
167 3300005340 Ga0070689_100219564 Ga0070689_1002195642 318
168 3300005343 Ga0070687_100003775 Ga0070687_1000037756 318
169 3300005345 Ga0070692_10079081 Ga0070692_100790812 318
170 3300005347 Ga0070668_100043811 Ga0070668_1000438113 318
171 3300005356 Ga0070674_100113325 Ga0070674_1001133252 318
172 3300005365 Ga0070688_100040582 Ga0070688_1000405823 318
173 3300005367 Ga0070667_100269657 Ga0070667_1002696571 318
174 3300005435 Ga0070714_100034904 Ga0070714_1000349043 318
175 3300005437 Ga0070710_10081063 Ga0070710_100810632 318
176 3300005439 Ga0070711_100002351 Ga0070711_1000023519 318
177 3300005444 Ga0070694_100019599 Ga0070694_1000195993 318
178 3300005455 Ga0070663_100181417 Ga0070663_1001814172 318
179 3300005456 Ga0070678_100030266 Ga0070678_1000302663 318
180 3300005457 Ga0070662_100010287 Ga0070662_1000102875 318
181 3300005539 Ga0068853_100232066 Ga0068853_1002320662 318
182 3300005543 Ga0070672_100174693 Ga0070672_1001746932 318
183 3300005544 Ga0070686_100010222 Ga0070686_1000102223 318
184 3300005545 Ga0070695_100107622 Ga0070695_1001076222 318
185 3300005546 Ga0070696_100129354 Ga0070696_1001293542 318
186 3300005548 Ga0070665_100022561 Ga0070665_1000225615 318
187 3300005563 Ga0068855_100014800 Ga0068855_1000148002 318
188 3300005564 Ga0070664_100108679 Ga0070664_1001086792 318
189 3300005564 Ga0070664_100126594 Ga0070664_1001265942 318
190 3300005614 Ga0068856_100106497 Ga0068856_1001064972 318
191 3300005718 Ga0068866_10106690 Ga0068866_101066901 318
192 3300005834 Ga0068851_10098218 Ga0068851_100982182 318
193 3300005842 Ga0068858_100000328 Ga0068858_10000032832 318
194 3300005842 Ga0068858_100020931 Ga0068858_1000209315 318
195 3300005843 Ga0068860_100042279 Ga0068860_1000422795 318
196 3300005937 Ga0081455_10040578 Ga0081455_100405784 318
197 3300005983 Ga0081540_1000710 Ga0081540_100071013 318
198 3300006173 Ga0070716_100001095 Ga0070716_1000010954 318
199 3300006175 Ga0070712_100005917 Ga0070712_1000059172 318
200 3300006237 Ga0097621_100019065 Ga0097621_1000190656 318
201 3300006358 Ga0068871_100105622 Ga0068871_1001056223 318
202 3300006846 Ga0075430_100000734 Ga0075430_1000007347 318
203 3300006847 Ga0075431_100001048 Ga0075431_10000104820 318
204 3300006880 Ga0075429_100000366 Ga0075429_10000036620 318
205 3300006881 Ga0068865_100129155 Ga0068865_1001291551 318
206 3300006914 Ga0075436_100112115 Ga0075436_1001121152 318
207 3300007076 Ga0075435_100007664 Ga0075435_1000076644 318
208 3300009093 Ga0105240_10481320 Ga0105240_104813201 318
209 3300009147 Ga0114129_10003185 Ga0114129_1000318520 318
210 3300009174 Ga0105241_10292680 Ga0105241_102926801 318
211 3300009177 Ga0105248_10023561 Ga0105248_100235612 318
212 3300009177 Ga0105248_10031564 Ga0105248_100315642 318
213 3300009545 Ga0105237_10188298 Ga0105237_101882982 318
214 3300009551 Ga0105238_10032836 Ga0105238_100328362 318
215 3300009553 Ga0105249_10004171 Ga0105249_1000417110 318
216 3300011119 Ga0105246_10016685 Ga0105246_100166854 318
217 3300013100 Ga0157373_10132994 Ga0157373_101329942 318
218 3300013104 Ga0157370_10064903 Ga0157370_100649034 318
219 3300013297 Ga0157378_10254131 Ga0157378_102541312 318
220 3300014325 Ga0163163_10008174 Ga0163163_100081742 318
221 3300014325 Ga0163163_10086125 Ga0163163_100861252 318
222 3300014326 Ga0157380_10186319 Ga0157380_101863192 318
223 3300014968 Ga0157379_10002387 Ga0157379_100023879 318
224 3300017792 Ga0163161_10005938 Ga0163161_100059386 318
225 3300025898 Ga0207692_10000457 Ga0207692_100004577 318
226 3300025901 Ga0207688_10000271 Ga0207688_100002713 318
227 3300025904 Ga0207647_10046448 Ga0207647_100464482 318
228 3300025914 Ga0207671_10055038 Ga0207671_100550382 318
229 3300025915 Ga0207693_10007135 Ga0207693_100071357 318
230 3300025918 Ga0207662_10008030 Ga0207662_100080303 318
231 3300025919 Ga0207657_10271298 Ga0207657_102712981 318
232 3300025927 Ga0207687_10015443 Ga0207687_100154436 318
233 3300025932 Ga0207690_10006056 Ga0207690_100060562 318
234 3300025934 Ga0207686_10015402 Ga0207686_100154024 318
235 3300025935 Ga0207709_10118437 Ga0207709_101184372 318
236 3300025939 Ga0207665_10002449 Ga0207665_100024494 318
237 3300025940 Ga0207691_10189698 Ga0207691_101896982 318
238 3300025941 Ga0207711_10000395 Ga0207711_1000039529 318
239 3300025942 Ga0207689_10003447 Ga0207689_1000344717 318
240 3300025942 Ga0207689_10065156 Ga0207689_100651563 318
241 3300025945 Ga0207679_10116457 Ga0207679_101164572 318
242 3300025949 Ga0207667_10052382 Ga0207667_100523822 318
243 3300025961 Ga0207712_10005038 Ga0207712_100050385 318
244 3300025986 Ga0207658_10085348 Ga0207658_100853481 318
245 3300026035 Ga0207703_10000264 Ga0207703_1000026436 318
246 3300026041 Ga0207639_10053748 Ga0207639_100537482 318
247 3300026067 Ga0207678_10261818 Ga0207678_102618182 318
248 3300026078 Ga0207702_10096079 Ga0207702_100960792 318
249 3300026118 Ga0207675_100256268 Ga0207675_1002562682 318
250 3300026121 Ga0207683_10003326 Ga0207683_1000332611 318
251 3300028379 Ga0268266_10101574 Ga0268266_101015742 318
252 3300030736 Ga0316180_1041813 Ga0316180_10418132 318
253 3300031456 Ga0307513_10013296 Ga0307513_100132968 318
254 3300031507 Ga0307509_10050338 Ga0307509_100503386 318
255 3300033179 Ga0307507_10000113 Ga0307507_1000011311 318
256 3300035085 Ga0373929_0011094 Ga0373929_0011094_446_1414 318
257 3300035088 Ga0373940_0024768 Ga0373940_0024768_483_1451 318
258 3300035114 Ga0373939_0023207 Ga0373939_0023207_258_1226 318
259 3300035691 Ga0373931_0003248 Ga0373931_0003248_1632_2600 318
260 3300044683 Ga0466965_0121452 Ga0466965_0121452_21_1001 318
261 3300048904 Ga0496101_0112881 Ga0496101_0112881_720_1688 318
262 3300048908 Ga0496105_0016809 Ga0496105_0016809_1238_2206 318
263 3300048909 Ga0496106_0016463 Ga0496106_0016463_3387_4355 318
264 3300048910 Ga0496107_0028579 Ga0496107_0028579_1160_2128 318
265 3300048911 Ga0496108_0032843 Ga0496108_0032843_916_1884 318
266 3300048912 Ga0496109_0029648 Ga0496109_0029648_2094_3062 318
267 3300048914 Ga0496111_0248109 Ga0496111_0248109_274_1242 318
268 3300048916 Ga0496113_0220529 Ga0496113_0220529_141_1109 318
269 3300050507 nmdc:mga05p37_6774_c1 nmdc:mga05p37_6774_c1_5466_6425 318
270 3300050508 nmdc:mga09592_2961_c1 nmdc:mga09592_2961_c1_5227_6186 318
271 iso_pu_bacteria 8054472261 8054475475 318
272 3300001990 JGI24737J22298_10050123 JGI24737J22298_100501231 319
273 3300002067 JGI24735J21928_10007384 JGI24735J21928_100073843 319
274 3300002067 JGI24735J21928_10032429 JGI24735J21928_100324292 319
275 3300003203 JGI25406J46586_10005170 JGI25406J46586_100051705 319
276 3300005334 Ga0068869_100087056 Ga0068869_1000870563 319
277 3300005337 Ga0070682_100230845 Ga0070682_1002308452 319
278 3300005347 Ga0070668_100267111 Ga0070668_1002671112 319
279 3300005355 Ga0070671_100001748 Ga0070671_10000174815 319
280 3300005435 Ga0070714_100216703 Ga0070714_1002167031 319
281 3300005436 Ga0070713_100047311 Ga0070713_1000473112 319
282 3300005436 Ga0070713_100184931 Ga0070713_1001849312 319
283 3300005441 Ga0070700_100000031 Ga0070700_10000003164 319
284 3300005456 Ga0070678_100459238 Ga0070678_1004592381 319
285 3300005548 Ga0070665_100003039 Ga0070665_10000303911 319
286 3300005548 Ga0070665_100011089 Ga0070665_1000110892 319
287 3300005577 Ga0068857_100090200 Ga0068857_1000902003 319
288 3300005614 Ga0068856_100006403 Ga0068856_10000640312 319
289 3300005616 Ga0068852_100345320 Ga0068852_1003453202 319
290 3300005718 Ga0068866_10021408 Ga0068866_100214083 319
291 3300005841 Ga0068863_100000580 Ga0068863_10000058011 319
292 3300005841 Ga0068863_100109068 Ga0068863_1001090682 319
293 3300005843 Ga0068860_100000345 Ga0068860_10000034511 319
294 3300005843 Ga0068860_100060595 Ga0068860_1000605953 319
295 3300005937 Ga0081455_10000507 Ga0081455_1000050712 319
296 3300005937 Ga0081455_10033981 Ga0081455_100339815 319
297 3300005981 Ga0081538_10000095 Ga0081538_100000955 319
298 3300005985 Ga0081539_10000272 Ga0081539_1000027282 319
299 3300005985 Ga0081539_10005560 Ga0081539_100055609 319
300 3300005985 Ga0081539_10020947 Ga0081539_100209473 319
301 3300006028 Ga0070717_10350538 Ga0070717_103505382 319
302 3300006048 Ga0075363_100046156 Ga0075363_1000461562 319
303 3300006844 Ga0075428_100002618 Ga0075428_10000261812 319
304 3300006847 Ga0075431_100002049 Ga0075431_10000204917 319
305 3300006880 Ga0075429_100026194 Ga0075429_1000261943 319
306 3300009093 Ga0105240_10053377 Ga0105240_100533772 319
307 3300009093 Ga0105240_10119840 Ga0105240_101198402 319
308 3300009093 Ga0105240_10683817 Ga0105240_106838171 319
309 3300009098 Ga0105245_10043338 Ga0105245_100433384 319
310 3300009147 Ga0114129_10091315 Ga0114129_100913153 319
311 3300009177 Ga0105248_10338197 Ga0105248_103381971 319
312 3300009545 Ga0105237_10048304 Ga0105237_100483042 319
313 3300010375 Ga0105239_10118719 Ga0105239_101187193 319
314 3300013104 Ga0157370_10018215 Ga0157370_100182157 319
315 3300013105 Ga0157369_10442983 Ga0157369_104429831 319
316 3300013307 Ga0157372_10000023 Ga0157372_10000023152 319
317 3300013307 Ga0157372_10074981 Ga0157372_100749813 319
318 3300020082 Ga0206353_11004473 Ga0206353_110044732 319
319 3300022467 Ga0224712_10009359 Ga0224712_100093591 319
320 3300025899 Ga0207642_10065658 Ga0207642_100656581 319
321 3300025903 Ga0207680_10120961 Ga0207680_101209611 319
322 3300025904 Ga0207647_10068168 Ga0207647_100681681 319
323 3300025904 Ga0207647_10098969 Ga0207647_100989692 319
324 3300025913 Ga0207695_10044375 Ga0207695_100443756 319
325 3300025924 Ga0207694_10317040 Ga0207694_103170401 319
326 3300025928 Ga0207700_10036912 Ga0207700_100369122 319
327 3300025929 Ga0207664_10000002 Ga0207664_10000002471 319
328 3300025929 Ga0207664_10014039 Ga0207664_100140393 319
329 3300025931 Ga0207644_10001436 Ga0207644_100014365 319
330 3300025935 Ga0207709_10120355 Ga0207709_101203552 319
331 3300025942 Ga0207689_10082249 Ga0207689_100822493 319
332 3300025949 Ga0207667_10046503 Ga0207667_100465035 319
333 3300025972 Ga0207668_10127149 Ga0207668_101271492 319
334 3300025972 Ga0207668_10166232 Ga0207668_101662321 319
335 3300025986 Ga0207658_10002834 Ga0207658_1000283410 319
336 3300026075 Ga0207708_10000046 Ga0207708_1000004664 319
337 3300026078 Ga0207702_10014132 Ga0207702_100141328 319
338 3300026088 Ga0207641_10000562 Ga0207641_1000056236 319
339 3300026088 Ga0207641_10003346 Ga0207641_100033464 319
340 3300026088 Ga0207641_10116438 Ga0207641_101164382 319
341 3300026116 Ga0207674_10023402 Ga0207674_100234025 319
342 3300026121 Ga0207683_10255656 Ga0207683_102556562 319
343 3300026142 Ga0207698_10024682 Ga0207698_100246823 319
344 3300028379 Ga0268266_10010107 Ga0268266_100101072 319
345 3300028379 Ga0268266_10016725 Ga0268266_100167255 319
346 3300028379 Ga0268266_10112095 Ga0268266_101120952 319
347 3300028379 Ga0268266_10345617 Ga0268266_103456172 319
348 3300028381 Ga0268264_10000257 Ga0268264_1000025753 319
349 3300028381 Ga0268264_10003187 Ga0268264_100031873 319
350 3300030521 Ga0307511_10022840 Ga0307511_100228405 319
351 3300031507 Ga0307509_10026874 Ga0307509_100268741 319
352 3300031691 Ga0316579_10006195 Ga0316579_100061953 319
353 3300031727 Ga0316576_10022525 Ga0316576_100225252 319
354 3300031727 Ga0316576_10036229 Ga0316576_100362292 319
355 3300031727 Ga0316576_10053157 Ga0316576_100531572 319
356 3300031727 Ga0316576_10081277 Ga0316576_100812773 319
357 3300031728 Ga0316578_10026645 Ga0316578_100266451 319
358 3300031728 Ga0316578_10042850 Ga0316578_100428502 319
359 3300031995 Ga0307409_100394359 Ga0307409_1003943591 319
360 3300032126 Ga0307415_100024379 Ga0307415_1000243793 319
361 3300032137 Ga0316585_10005101 Ga0316585_100051012 319
362 3300032139 Ga0316580_10010547 Ga0316580_100105472 319
363 3300035398 Ga0316574_0076919 Ga0316574_0076919_824_1810 319
364 3300036647 Ga0316582_0031606 Ga0316582_0031606_1229_2215 319
365 3300036647 Ga0316582_0293105 Ga0316582_0293105_58_1038 319
366 3300036712 Ga0316584_0063639 Ga0316584_0063639_913_1899 319
367 3300037588 Ga0316581_0007610 Ga0316581_0007610_886_1872 319
368 3300041512 Ga0451853_3757730 Ga0451853_3757730_4512_5480 319
369 3300042876 Ga0451577_0341974 Ga0451577_0341974_365_1333 319
370 3300044656 Ga0466969_0008445 Ga0466969_0008445_2708_3667 319
371 3300044684 Ga0466966_0006392 Ga0466966_0006392_374_1333 319
372 3300044684 Ga0466966_0012359 Ga0466966_0012359_2895_3860 319
373 3300044684 Ga0466966_0087660 Ga0466966_0087660_77_1045 319
374 3300044684 Ga0466966_0281719 Ga0466966_0281719_19_978 319
375 3300044693 Ga0466961_0018149 Ga0466961_0018149_1229_2188 319
376 3300044693 Ga0466961_0028853 Ga0466961_0028853_1253_2212 319
377 3300044693 Ga0466961_0033302 Ga0466961_0033302_617_1576 319
378 3300044693 Ga0466961_0054786 Ga0466961_0054786_134_1105 319
379 3300044693 Ga0466961_0075845 Ga0466961_0075845_133_1104 319
380 3300044694 Ga0466963_0002774 Ga0466963_0002774_3293_4252 319
381 3300044694 Ga0466963_0094390 Ga0466963_0094390_95_1063 319
382 3300044706 Ga0466964_0053300 Ga0466964_0053300_92_1051 319
383 3300044719 Ga0466971_0001405 Ga0466971_0001405_5404_6363 319
384 3300044719 Ga0466971_0018780 Ga0466971_0018780_391_1356 319
385 3300044719 Ga0466971_0063241 Ga0466971_0063241_470_1441 319
386 3300044765 Ga0466970_0050697 Ga0466970_0050697_614_1585 319
387 3300044765 Ga0466970_0070336 Ga0466970_0070336_527_1498 319
388 3300044842 Ga0466957_0083747 Ga0466957_0083747_166_1137 319
389 3300044842 Ga0466957_0129469 Ga0466957_0129469_410_1381 319
390 3300044901 Ga0466960_0006063 Ga0466960_0006063_3421_4380 319
391 3300044901 Ga0466960_0013453 Ga0466960_0013453_2220_3215 319
392 3300045049 Ga0466959_0002255 Ga0466959_0002255_5826_6785 319
393 3300045049 Ga0466959_0020629 Ga0466959_0020629_2851_3810 319
394 3300045049 Ga0466959_0054433 Ga0466959_0054433_30_1001 319
395 3300045049 Ga0466959_0162401 Ga0466959_0162401_539_1507 319
396 3300045836 Ga0466958_0012043 Ga0466958_0012043_3870_4829 319
397 3300045836 Ga0466958_0013606 Ga0466958_0013606_420_1391 319
398 3300045836 Ga0466958_0025781 Ga0466958_0025781_25_984 319
399 3300045836 Ga0466958_0068841 Ga0466958_0068841_835_1806 319
400 3300045836 Ga0466958_0145696 Ga0466958_0145696_488_1459 319
401 3300045836 Ga0466958_0152176 Ga0466958_0152176_235_1206 319
402 3300045976 Ga0466967_0002592 Ga0466967_0002592_9716_10675 319
403 3300045976 Ga0466967_0006323 Ga0466967_0006323_443_1402 319
404 3300045976 Ga0466967_0017321 Ga0466967_0017321_4059_5018 319
405 3300045976 Ga0466967_0042666 Ga0466967_0042666_940_1911 319
406 3300045976 Ga0466967_0145185 Ga0466967_0145185_722_1681 319
407 3300045976 Ga0466967_0146178 Ga0466967_0146178_1110_2078 319
408 3300046454 Ga0495592_0126695 Ga0495592_0126695_187_1146 319
409 3300046462 Ga0495651_0014196 Ga0495651_0014196_353_1312 319
410 3300046477 Ga0495664_0015224 Ga0495664_0015224_3110_4069 319
411 3300046529 Ga0495652_0027338 Ga0495652_0027338_406_1365 319
412 3300046531 Ga0495665_0020375 Ga0495665_0020375_1174_2136 319
413 3300046543 Ga0495645_0248414 Ga0495645_0248414_65_1024 319
414 3300046663 Ga0495635_0027273 Ga0495635_0027273_1411_2370 319
415 3300046674 Ga0495588_0062705 Ga0495588_0062705_755_1717 319
416 3300046679 Ga0495623_0006899 Ga0495623_0006899_3091_4050 319
417 3300046680 Ga0495646_0151876 Ga0495646_0151876_291_1250 319
418 3300046809 Ga0495600_0024783 Ga0495600_0024783_472_1431 319
419 3300047320 Ga0495672_0048202 Ga0495672_0048202_934_1905 319
420 3300047444 Ga0495675_0164531 Ga0495675_0164531_210_1190 319
421 3300048088 Ga0495602_0066827 Ga0495602_0066827_1499_2458 319
422 3300048915 Ga0496112_0297024 Ga0496112_0297024_177_1136 319
423 3300048916 Ga0496113_0089431 Ga0496113_0089431_159_1118 319
424 3300048922 Ga0496119_0000549 Ga0496119_0000549_22080_23039 319
425 3300048923 Ga0496120_0004382 Ga0496120_0004382_10317_11276 319
426 3300049571 Ga0501034_0122311 Ga0501034_0122311_1053_2042 319
427 3300049572 Ga0501036_0002148 Ga0501036_0002148_1397_2386 319
428 3300049573 Ga0501037_0007682 Ga0501037_0007682_155_1144 319
429 3300049574 Ga0501038_0093802 Ga0501038_0093802_1436_2425 319
430 3300049575 Ga0501039_0001814 Ga0501039_0001814_13303_14292 319
431 3300049575 Ga0501039_0053836 Ga0501039_0053836_1179_2156 319
432 3300049576 Ga0501040_0061253 Ga0501040_0061253_1526_2515 319
433 3300049576 Ga0501040_0062059 Ga0501040_0062059_356_1333 319
434 3300049578 Ga0501042_0049122 Ga0501042_0049122_1602_2591 319
435 3300049580 Ga0501046_0063856 Ga0501046_0063856_1449_2426 319
436 3300049581 Ga0501047_0001099 Ga0501047_0001099_4624_5589 319
437 3300049582 Ga0501048_0012395 Ga0501048_0012395_3524_4501 319
438 3300049582 Ga0501048_0057187 Ga0501048_0057187_96_1085 319
439 3300049584 Ga0501068_0004875 Ga0501068_0004875_638_1627 319
440 3300049587 Ga0501071_0056001 Ga0501071_0056001_661_1650 319
441 3300049587 Ga0501071_0089816 Ga0501071_0089816_335_1312 319
442 3300049588 Ga0501072_0001733 Ga0501072_0001733_13626_14615 319
443 3300049590 Ga0501074_0103279 Ga0501074_0103279_12_1001 319
444 3300049591 Ga0501075_0060512 Ga0501075_0060512_1317_2306 319
445 3300049591 Ga0501075_0108114 Ga0501075_0108114_474_1451 319
446 3300049592 Ga0501076_0047495 Ga0501076_0047495_450_1427 319
447 3300049593 Ga0501077_0033585 Ga0501077_0033585_582_1571 319
448 3300049743 Ga0501081_0091046 Ga0501081_0091046_875_1852 319
449 3300049743 Ga0501081_0220765 Ga0501081_0220765_303_1292 319
450 3300049822 Ga0501035_0021109 Ga0501035_0021109_4540_5529 319
451 3300049824 Ga0501045_0024592 Ga0501045_0024592_2023_3000 319
452 3300049824 Ga0501045_0202932 Ga0501045_0202932_420_1409 319
453 3300050507 nmdc:mga05p37_2502_c1 nmdc:mga05p37_2502_c1_13254_14213 319
454 3300050508 nmdc:mga09592_890_c1 nmdc:mga09592_890_c1_13422_14381 319
455 3300050510 nmdc:mga06r32_12_c1 nmdc:mga06r32_12_c1_84008_84967 319
456 3300053078 Ga0495612_0020139 Ga0495612_0020139_12_971 319
457 3300053085 Ga0495619_0122646 Ga0495619_0122646_146_1105 319
458 3300060353 Ga0501082_0207835 Ga0501082_0207835_253_1230 319
459 3300061719 Ga0466962_0000133 Ga0466962_0000133_14011_14970 319
460 3300061734 Ga0530510_0095418 Ga0530510_0095418_939_1928 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

9

242

0.91

PF22484

DUF6986

Domain of unknown function (DUF6986)

18

315

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9771 5 251
4l9z-assembly1.cif.gz_A crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa 0.9633 6 303
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9291 9 252
4l80-assembly1.cif.gz_E crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa 0.9273 5 306
6kkh-assembly1.cif.gz_A crystal structure of the oxalate bound malyl-coa lyase from roseiflexus castenholzii 0.9164 5 303
ID Description Score Start End Superfamily
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9771 5 251 3.20.20.60
af_P0A9I1_3_299_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9211 5 307 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9142 3 252 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9116 5 251 3.20.20.60
af_Q1JPT8_41_343_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9007 1 306 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2P6FXQ0-F1-model_v4 CoA ester lyase 0.9996 22 238 GO:0000287
GO:0006107
GO:0016829
AF-A0A6B3I1H3-F1-model_v4 CoA ester lyase 0.999 18 98 GO:0000287
GO:0006107
GO:0016829
AF-D3D852-F1-model_v4 HpcH/HpaI aldolase 0.9934 5 142 GO:0000287
GO:0003824
GO:0006107
AF-A0A1Q7W2M1-F1-model_v4 CoA ester lyase 0.9877 1 246 GO:0000287
GO:0006107
GO:0016829
AF-A0A2P6FXQ0-F1-model_v4 CoA ester lyase 0.986 22 238 GO:0000287
GO:0006107
GO:0016829

Feature Viewer

pLDDT pTM Quality
94.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map