F448592

General Info

Members Datasets Scaffolds Average Seq Length
460 270 920 129

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0018161|Ga0466969_0018161_2075_2473
Length 132
Sequence MALRVVRLGTERQRDEGTRIGTVRRPPRGVPKSEFASQNWYDVWFPNLAPSLDLTKFALQSKGDAAQWKVFVRKYKAEMAQPDASHAIELLATLSQHADFSVGCYCEDEAWCHRSVLRELLADRGAKLAEHR

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
219 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
220 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
241 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
265 2643221559 Lysobacter sp. Root559 Isolate Unclassified
266 2643221586 Lysobacter sp. Root667 Isolate Unclassified
267 2643221612 Lysobacter sp. Root76 Isolate Unclassified
268 2643221727 Lysobacter sp. Root96 Isolate Unclassified
269 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
270 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0.65
Rhizoplane 2.61
Rhizosphere 85.43
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0018161 3300044656 Bacteria 3667
2 rootH1_10170785 3300003323 Bacteria 6105
3 Ga0065715_10129151 3300005293 Bacteria 2051
4 Ga0070676_10207221 3300005328 Bacteria 1288
5 Ga0070677_10004666 3300005333 Bacteria 4484
6 Ga0068869_100061399 3300005334 Unclassified 2757
7 Ga0068869_100072884 3300005334 Bacteria 2545
8 Ga0068869_100296523 3300005334 Bacteria 1304
9 Ga0068869_100380109 3300005334 Bacteria 1157
10 Ga0070666_10004385 3300005335 Bacteria 8596
11 Ga0070666_10013781 3300005335 Bacteria 5135
12 Ga0070666_10785047 3300005335 Bacteria 701
13 Ga0070680_100375561 3300005336 Bacteria 1210
14 Ga0068868_100004933 3300005338 Bacteria 9373
15 Ga0068868_100008290 3300005338 Bacteria 7442
16 Ga0068868_100011587 3300005338 Bacteria 6422
17 Ga0070689_100027465 3300005340 Bacteria 4291
18 Ga0070689_100140067 3300005340 Bacteria 1945
19 Ga0070689_100553996 3300005340 Bacteria 991
20 Ga0070668_100003653 3300005347 Bacteria 11348
21 Ga0070668_100025295 3300005347 Bacteria 4500
22 Ga0070669_100187494 3300005353 Bacteria 1621
23 Ga0070669_100298271 3300005353 Bacteria 1295
24 Ga0070675_100008171 3300005354 Bacteria 8111
25 Ga0070675_100008971 3300005354 Bacteria 7768
26 Ga0070671_100002283 3300005355 Bacteria 14795
27 Ga0070674_100001737 3300005356 Bacteria 11801
28 Ga0070674_100042754 3300005356 Bacteria 3080
29 Ga0070673_100000414 3300005364 Bacteria 22528
30 Ga0070673_100024254 3300005364 Bacteria 4445
31 Ga0070673_100052622 3300005364 Bacteria 3196
32 Ga0070673_100075977 3300005364 Bacteria 2711
33 Ga0070688_100007290 3300005365 Bacteria 5957
34 Ga0070688_100734963 3300005365 Bacteria 767
35 Ga0070659_101417061 3300005366 Unclassified 618
36 Ga0070667_100004577 3300005367 Bacteria 11619
37 Ga0070667_100112213 3300005367 Bacteria 2365
38 Ga0070667_100268791 3300005367 Bacteria 1528
39 Ga0070667_101020152 3300005367 Bacteria 772
40 Ga0070700_100473709 3300005441 Bacteria 958
41 Ga0070700_100706468 3300005441 Bacteria 802
42 Ga0070708_100355629 3300005445 Bacteria 1380
43 Ga0070663_100040669 3300005455 Bacteria 3257
44 Ga0070678_100034195 3300005456 Bacteria 3538
45 Ga0070678_100039661 3300005456 Bacteria 3325
46 Ga0070678_100326234 3300005456 Bacteria 1312
47 Ga0070662_100048909 3300005457 Bacteria 3048
48 Ga0068867_100004322 3300005459 Bacteria 10002
49 Ga0068867_100005598 3300005459 Bacteria 8900
50 Ga0070685_10077459 3300005466 Bacteria 1985
51 Ga0070685_10316219 3300005466 Bacteria 1057
52 Ga0068853_100005722 3300005539 Bacteria 9783
53 Ga0068853_100393387 3300005539 Bacteria 1296
54 Ga0068853_101317664 3300005539 Bacteria 698
55 Ga0070672_100009932 3300005543 Bacteria 6582
56 Ga0070672_100218937 3300005543 Bacteria 1596
57 Ga0070695_100290450 3300005545 Bacteria 1205
58 Ga0070696_100309538 3300005546 Bacteria 1212
59 Ga0070665_100042494 3300005548 Bacteria 4569
60 Ga0070665_100060912 3300005548 Bacteria 3783
61 Ga0070665_100124742 3300005548 Bacteria 2577
62 Ga0070665_100341078 3300005548 Unclassified 1503
63 Ga0070704_100768538 3300005549 Unclassified 859
64 Ga0070704_100898897 3300005549 Bacteria 796
65 Ga0068857_100425098 3300005577 Bacteria 1239
66 Ga0070702_101155614 3300005615 Bacteria 621
67 Ga0068852_100156332 3300005616 Bacteria 2124
68 Ga0068859_100025433 3300005617 Bacteria 5938
69 Ga0068859_100648383 3300005617 Bacteria 1148
70 Ga0068859_101042424 3300005617 Bacteria 899
71 Ga0068864_100000046 3300005618 Bacteria 151661
72 Ga0068864_100003522 3300005618 Bacteria 12945
73 Ga0068864_100004730 3300005618 Bacteria 11150
74 Ga0068864_100143009 3300005618 Unclassified 2160
75 Ga0068861_100020784 3300005719 Bacteria 4708
76 Ga0068861_100031275 3300005719 Bacteria 3909
77 Ga0068861_100090966 3300005719 Bacteria 2408
78 Ga0068861_100152102 3300005719 Bacteria 1900
79 Ga0068861_100352945 3300005719 Unclassified 1291
80 Ga0068861_101272997 3300005719 Unclassified 714
81 Ga0068851_10000963 3300005834 Bacteria 12458
82 Ga0068870_10029085 3300005840 Bacteria 2781
83 Ga0068870_10224121 3300005840 Bacteria 1152
84 Ga0068870_10337103 3300005840 Bacteria 963
85 Ga0068863_100003538 3300005841 Bacteria 15417
86 Ga0068863_100014047 3300005841 Bacteria 7716
87 Ga0068863_101538988 3300005841 Bacteria 674
88 Ga0068863_101577344 3300005841 Bacteria 665
89 Ga0068858_100056047 3300005842 Bacteria 3643
90 Ga0068858_100057670 3300005842 Bacteria 3589
91 Ga0068858_100649057 3300005842 Bacteria 1025
92 Ga0068860_100002164 3300005843 Bacteria 20700
93 Ga0068860_100515606 3300005843 Bacteria 1195
94 Ga0068860_102570797 3300005843 Bacteria 528
95 Ga0068862_100380708 3300005844 Bacteria 1316
96 Ga0075368_10327983 3300006042 Bacteria 664
97 Ga0075363_100011486 3300006048 Bacteria 4242
98 Ga0075364_10322441 3300006051 Unclassified 1052
99 Ga0075362_10020687 3300006177 Bacteria 2752
100 Ga0075367_10003340 3300006178 Bacteria 7625
101 Ga0075367_10593146 3300006178 Bacteria 704
102 Ga0075369_10013614 3300006186 Bacteria 3234
103 Ga0075369_10068668 3300006186 Unclassified 1558
104 Ga0075427_10041461 3300006194 Bacteria 777
105 Ga0075366_10072882 3300006195 Bacteria 2047
106 Ga0075366_10101992 3300006195 Bacteria 1722
107 Ga0075366_10127633 3300006195 Bacteria 1534
108 Ga0075366_10246569 3300006195 Bacteria 1089
109 Ga0075366_10843438 3300006195 Bacteria 570
110 Ga0075366_11074172 3300006195 Bacteria 503
111 Ga0097621_100071436 3300006237 Bacteria 2868
112 Ga0097621_100258906 3300006237 Bacteria 1526
113 Ga0097621_100269370 3300006237 Unclassified 1496
114 Ga0097621_101868698 3300006237 Unclassified 573
115 Ga0075370_10002789 3300006353 Bacteria 8190
116 Ga0075370_10027526 3300006353 Bacteria 3155
117 Ga0075370_10039911 3300006353 Bacteria 2646
118 Ga0075370_10074024 3300006353 Bacteria 1952
119 Ga0075370_10892543 3300006353 Bacteria 543
120 Ga0068871_100110972 3300006358 Bacteria 2307
121 Ga0068871_100117282 3300006358 Bacteria 2245
122 Ga0068871_100300819 3300006358 Bacteria 1408
123 Ga0068871_100565308 3300006358 Bacteria 1031
124 Ga0075428_100000133 3300006844 Bacteria 65398
125 Ga0075428_100051798 3300006844 Bacteria 4501
126 Ga0075428_100114848 3300006844 Bacteria 2933
127 Ga0075428_100965143 3300006844 Bacteria 903
128 Ga0075430_100141658 3300006846 Bacteria 2002
129 Ga0075430_101425893 3300006846 Bacteria 569
130 Ga0075431_100244486 3300006847 Bacteria 1824
131 Ga0075429_101054404 3300006880 Bacteria 710
132 Ga0068865_100101685 3300006881 Bacteria 2105
133 Ga0068865_100131619 3300006881 Bacteria 1875
134 Ga0068865_101085519 3300006881 Bacteria 704
135 Ga0097620_100025432 3300006931 Bacteria 5938
136 Ga0097620_100155782 3300006931 Bacteria 2362
137 Ga0097620_100648525 3300006931 Bacteria 1148
138 Ga0097620_101042312 3300006931 Bacteria 899
139 Ga0099826_10457401 3300006948 Bacteria 606
140 Ga0105251_10158598 3300009011 Bacteria 1020
141 Ga0105240_10130469 3300009093 Bacteria 3015
142 Ga0105240_12173381 3300009093 Bacteria 576
143 Ga0111539_10000654 3300009094 Bacteria 44760
144 Ga0111539_10322958 3300009094 Unclassified 1796
145 Ga0105245_10247432 3300009098 Bacteria 1731
146 Ga0105245_10339284 3300009098 Bacteria 1485
147 Ga0105245_11082615 3300009098 Bacteria 847
148 Ga0105247_10021490 3300009101 Bacteria 3884
149 Ga0114129_11061071 3300009147 Bacteria 1017
150 Ga0105243_10024169 3300009148 Bacteria 4634
151 Ga0105243_10478819 3300009148 Bacteria 1174
152 Ga0105248_10003651 3300009177 Bacteria 17086
153 Ga0105248_10019374 3300009177 Bacteria 7530
154 Ga0105248_10078334 3300009177 Bacteria 3715
155 Ga0105248_10555988 3300009177 Bacteria 1295
156 Ga0105237_10057642 3300009545 Bacteria 3887
157 Ga0105249_10047847 3300009553 Bacteria 3898
158 Ga0105239_10040126 3300010375 Bacteria 5129
159 Ga0105239_11167124 3300010375 Bacteria 887
160 Ga0157374_10015238 3300013296 Bacteria 6742
161 Ga0157374_10034007 3300013296 Bacteria 4654
162 Ga0157378_10024746 3300013297 Bacteria 5286
163 Ga0157378_10072118 3300013297 Bacteria 3103
164 Ga0157378_10519654 3300013297 Bacteria 1192
165 Ga0163162_10060010 3300013306 Bacteria 3837
166 Ga0163162_10068114 3300013306 Bacteria 3610
167 Ga0157375_10000991 3300013308 Bacteria 24533
168 Ga0157375_10382621 3300013308 Bacteria 1574
169 Ga0157375_10501963 3300013308 Bacteria 1377
170 Ga0163163_10029012 3300014325 Bacteria 5320
171 Ga0163163_10479608 3300014325 Unclassified 1305
172 Ga0157380_10036291 3300014326 Bacteria 3813
173 Ga0157380_10177359 3300014326 Bacteria 1869
174 Ga0157380_10271386 3300014326 Bacteria 1547
175 Ga0157380_10308298 3300014326 Bacteria 1462
176 Ga0157380_10665009 3300014326 Bacteria 1041
177 Ga0157380_11052233 3300014326 Bacteria 850
178 Ga0157377_10555550 3300014745 Bacteria 812
179 Ga0157379_10004507 3300014968 Bacteria 11946
180 Ga0157376_10050766 3300014969 Bacteria 3443
181 Ga0183360_10001 3300015689 Bacteria 3943671
182 Ga0163161_10087328 3300017792 Bacteria 2303
183 Ga0163161_10224674 3300017792 Bacteria 1455
184 Ga0209565_1002300 3300025263 Bacteria 7018
185 Ga0207697_10006798 3300025315 Bacteria 5144
186 Ga0207697_10030017 3300025315 Bacteria 2225
187 Ga0207656_10002949 3300025321 Bacteria 5803
188 Ga0207682_10001173 3300025893 Bacteria 12153
189 Ga0207682_10025400 3300025893 Bacteria 2349
190 Ga0207710_10010257 3300025900 Bacteria 3942
191 Ga0207680_10002438 3300025903 Bacteria 8673
192 Ga0207645_10001033 3300025907 Bacteria 22978
193 Ga0207645_10091588 3300025907 Bacteria 1955
194 Ga0207645_10094272 3300025907 Bacteria 1926
195 Ga0207643_10081182 3300025908 Unclassified 1879
196 Ga0207643_10213078 3300025908 Bacteria 1180
197 Ga0207654_10661615 3300025911 Bacteria 749
198 Ga0207695_10167703 3300025913 Bacteria 2123
199 Ga0207671_10018695 3300025914 Bacteria 5310
200 Ga0207660_10866612 3300025917 Bacteria 737
201 Ga0207662_10556988 3300025918 Bacteria 794
202 Ga0207681_10173270 3300025923 Bacteria 1637
203 Ga0207681_10246218 3300025923 Bacteria 1394
204 Ga0207681_10329552 3300025923 Bacteria 1217
205 Ga0207694_10775699 3300025924 Bacteria 809
206 Ga0207650_10174178 3300025925 Bacteria 1712
207 Ga0207650_11483572 3300025925 Unclassified 576
208 Ga0207659_10003127 3300025926 Bacteria 9890
209 Ga0207659_10167779 3300025926 Bacteria 1729
210 Ga0207687_10189273 3300025927 Bacteria 1600
211 Ga0207687_10401813 3300025927 Unclassified 1127
212 Ga0207700_10389005 3300025928 Unclassified 1221
213 Ga0207644_10008533 3300025931 Bacteria 6704
214 Ga0207690_11129996 3300025932 Unclassified 653
215 Ga0207706_10140717 3300025933 Bacteria 2123
216 Ga0207670_10458748 3300025936 Bacteria 1028
217 Ga0207670_10573266 3300025936 Bacteria 924
218 Ga0207669_10001098 3300025937 Bacteria 11563
219 Ga0207669_10017530 3300025937 Bacteria 3676
220 Ga0207704_10001647 3300025938 Bacteria 10023
221 Ga0207704_10016422 3300025938 Bacteria 3804
222 Ga0207691_10000006 3300025940 Bacteria 161922
223 Ga0207691_10001055 3300025940 Bacteria 27382
224 Ga0207691_10002769 3300025940 Bacteria 17084
225 Ga0207691_10230191 3300025940 Bacteria 1605
226 Ga0207711_10171912 3300025941 Bacteria 1966
227 Ga0207711_10176985 3300025941 Bacteria 1938
228 Ga0207711_10306614 3300025941 Bacteria 1465
229 Ga0207711_10353491 3300025941 Bacteria 1361
230 Ga0207689_10001598 3300025942 Bacteria 21447
231 Ga0207689_10055677 3300025942 Bacteria 3255
232 Ga0207689_10247606 3300025942 Bacteria 1474
233 Ga0207689_10294111 3300025942 Bacteria 1345
234 Ga0207689_10383675 3300025942 Bacteria 1170
235 Ga0207689_10910751 3300025942 Bacteria 742
236 Ga0207689_11770871 3300025942 Bacteria 510
237 Ga0207651_10074667 3300025960 Bacteria 2415
238 Ga0207651_10093255 3300025960 Bacteria 2210
239 Ga0207651_10137611 3300025960 Bacteria 1881
240 Ga0207668_10005508 3300025972 Bacteria 7463
241 Ga0207640_10203493 3300025981 Bacteria 1502
242 Ga0207640_10328064 3300025981 Bacteria 1221
243 Ga0207658_10046027 3300025986 Bacteria 3183
244 Ga0207658_10263501 3300025986 Bacteria 1470
245 Ga0207658_10411556 3300025986 Bacteria 1190
246 Ga0207677_10000069 3300026023 Bacteria 85177
247 Ga0207677_10023297 3300026023 Bacteria 3822
248 Ga0207703_10012059 3300026035 Bacteria 6734
249 Ga0207703_10364321 3300026035 Bacteria 1334
250 Ga0207703_10402062 3300026035 Bacteria 1271
251 Ga0207703_10531454 3300026035 Bacteria 1107
252 Ga0207639_10005406 3300026041 Bacteria 8640
253 Ga0207639_10143158 3300026041 Bacteria 1994
254 Ga0207639_10343845 3300026041 Bacteria 1331
255 Ga0207708_10069939 3300026075 Bacteria 2688
256 Ga0207641_10001705 3300026088 Bacteria 21390
257 Ga0207641_10024731 3300026088 Bacteria 4951
258 Ga0207641_10800363 3300026088 Bacteria 932
259 Ga0207641_11242138 3300026088 Bacteria 745
260 Ga0207648_10003315 3300026089 Bacteria 16908
261 Ga0207648_10121092 3300026089 Bacteria 2301
262 Ga0207648_10125362 3300026089 Bacteria 2259
263 Ga0207676_10000008 3300026095 Bacteria 588913
264 Ga0207676_10002144 3300026095 Bacteria 14263
265 Ga0207676_10021291 3300026095 Bacteria 4756
266 Ga0207676_10541961 3300026095 Bacteria 1110
267 Ga0207676_12544277 3300026095 Bacteria 508
268 Ga0207674_10054186 3300026116 Bacteria 4084
269 Ga0207674_10088969 3300026116 Bacteria 3080
270 Ga0207675_100001670 3300026118 Bacteria 22199
271 Ga0207675_100104972 3300026118 Bacteria 2663
272 Ga0207675_100124979 3300026118 Bacteria 2436
273 Ga0207675_100148786 3300026118 Bacteria 2228
274 Ga0207675_100158126 3300026118 Bacteria 2160
275 Ga0207675_102351720 3300026118 Bacteria 546
276 Ga0207683_10000250 3300026121 Bacteria 48026
277 Ga0207683_10000853 3300026121 Bacteria 27981
278 Ga0207683_10057077 3300026121 Bacteria 3427
279 Ga0207698_10003568 3300026142 Bacteria 9386
280 Ga0209282_1375077 3300027666 Bacteria 570
281 Ga0207428_10089355 3300027907 Bacteria 2394
282 Ga0207428_10299392 3300027907 Unclassified 1190
283 Ga0268266_10060333 3300028379 Bacteria 3269
284 Ga0268266_10202235 3300028379 Bacteria 1818
285 Ga0268266_10853862 3300028379 Bacteria 880
286 Ga0268265_10230416 3300028380 Bacteria 1628
287 Ga0268264_10879234 3300028381 Bacteria 898
288 Ga0268264_12507292 3300028381 Bacteria 521
289 Ga0307517_10101294 3300028786 Bacteria 2268
290 Ga0307517_10117953 3300028786 Bacteria 1978
291 Ga0307517_10164912 3300028786 Bacteria 1475
292 Ga0307513_10117936 3300031456 Bacteria 2630
293 Ga0307513_10217539 3300031456 Bacteria 1735
294 Ga0307513_10352818 3300031456 Unclassified 1218
295 Ga0307408_100188519 3300031548 Bacteria 1659
296 Ga0316575_10019694 3300031665 Bacteria 2583
297 Ga0316579_10316602 3300031691 Bacteria 754
298 Ga0316578_10484401 3300031728 Bacteria 729
299 Ga0307516_10022871 3300031730 Bacteria 6415
300 Ga0307516_10777577 3300031730 Bacteria 618
301 Ga0316577_10256301 3300031733 Bacteria 990
302 Ga0307413_11034812 3300031824 Bacteria 706
303 Ga0307409_100466734 3300031995 Bacteria 1222
304 Ga0307409_101964980 3300031995 Bacteria 614
305 Ga0307416_102055419 3300032002 Bacteria 674
306 Ga0307416_102369666 3300032002 Bacteria 631
307 Ga0307414_10983780 3300032004 Bacteria 776
308 Ga0307411_10717821 3300032005 Bacteria 872
309 Ga0307415_100965271 3300032126 Bacteria 790
310 Ga0307510_10218187 3300033180 Bacteria 1422
311 Ga0373948_0008567 3300034817 Bacteria 1743
312 Ga0373950_0003111 3300034818 Bacteria 2345
313 Ga0373940_0018466 3300035088 Bacteria 1750
314 Ga0373951_0010198 3300035091 Bacteria 2109
315 Ga0373939_0000090 3300035114 Bacteria 29085
316 Ga0373945_0323885 3300035116 Bacteria 664
317 Ga0373960_0001231 3300035121 Bacteria 5606
318 Ga0373946_0527707 3300035171 Bacteria 607
319 Ga0373961_0063068 3300035241 Bacteria 1129
320 Ga0373931_0000516 3300035691 Bacteria 15816
321 Ga0373937_0254405 3300036401 Bacteria 1656
322 Ga0373937_0478882 3300036401 Bacteria 1182
323 Ga0316582_0020819 3300036647 Bacteria 3864
324 Ga0395900_0814271 3300037418 Bacteria 861
325 Ga0395905_0287921 3300037471 Bacteria 1529
326 Ga0316581_0004793 3300037588 Bacteria 3481
327 Ga0450897_036166 3300042128 Bacteria 572
328 Ga0451577_0094867 3300042876 Unclassified 2664
329 Ga0451577_1676020 3300042876 Bacteria 560
330 Ga0453683_0585936 3300044673 Unclassified 727
331 Ga0466965_0130400 3300044683 Bacteria 1303
332 Ga0466966_0222488 3300044684 Bacteria 1139
333 Ga0466961_0145275 3300044693 Bacteria 1483
334 Ga0466971_0025669 3300044719 Bacteria 2631
335 Ga0466968_0266167 3300044735 Bacteria 817
336 Ga0466968_0393391 3300044735 Bacteria 678
337 Ga0466957_0040153 3300044842 Bacteria 2826
338 Ga0466960_0006870 3300044901 Bacteria 4589
339 Ga0466959_0031417 3300045049 Bacteria 3928
340 Ga0451576_1771352 3300045051 Bacteria 639
341 Ga0466967_1786487 3300045976 Bacteria 612
342 Ga0495629_0073366 3300046459 Bacteria 2390
343 Ga0495582_0285287 3300046473 Bacteria 948
344 Ga0495605_0029015 3300046474 Bacteria 2852
345 Ga0495594_0090716 3300046499 Unclassified 1712
346 Ga0495583_0228919 3300046506 Bacteria 750
347 Ga0495608_0630071 3300046511 Bacteria 642
348 Ga0495610_0088163 3300046512 Bacteria 1411
349 Ga0495620_0088133 3300046515 Bacteria 1248
350 Ga0495628_0437154 3300046516 Bacteria 952
351 Ga0495630_0326271 3300046517 Bacteria 1174
352 Ga0495630_0708580 3300046517 Bacteria 770
353 Ga0495631_0054785 3300046518 Bacteria 1738
354 Ga0495632_0003106 3300046519 Bacteria 12035
355 Ga0495642_0424659 3300046528 Bacteria 587
356 Ga0495598_0015034 3300046537 Bacteria 1945
357 Ga0495609_0044876 3300046538 Bacteria 1982
358 Ga0495621_0015517 3300046539 Bacteria 2430
359 Ga0495597_0059365 3300046542 Bacteria 1670
360 Ga0495597_0187811 3300046542 Bacteria 832
361 Ga0495645_0087358 3300046543 Bacteria 2231
362 Ga0495668_0052296 3300046616 Bacteria 2260
363 Ga0495611_0067112 3300046648 Bacteria 1637
364 Ga0495625_0023869 3300046660 Bacteria 4665
365 Ga0495647_0393362 3300046681 Bacteria 636
366 Ga0495658_0000385 3300046683 Bacteria 24814
367 Ga0495658_0132765 3300046683 Bacteria 1517
368 Ga0495658_0470861 3300046683 Bacteria 803
369 Ga0495671_0180926 3300046692 Bacteria 1024
370 Ga0495649_0008052 3300046694 Bacteria 6366
371 Ga0495660_0043232 3300046810 Bacteria 2486
372 Ga0495581_0247038 3300047315 Bacteria 1043
373 Ga0495674_1426102 3300047319 Bacteria 515
374 Ga0495672_0183233 3300047320 Bacteria 1059
375 Ga0495687_001446 3300047443 Bacteria 21795
376 Ga0495626_0205376 3300048091 Bacteria 806
377 Ga0496100_0282514 3300048903 Bacteria 1238
378 Ga0496104_0025922 3300048907 Bacteria 5407
379 Ga0496106_0785255 3300048909 Bacteria 756
380 Ga0496107_0077713 3300048910 Bacteria 2418
381 Ga0496107_0485869 3300048910 Unclassified 916
382 Ga0496108_1418325 3300048911 Bacteria 580
383 Ga0496109_0853975 3300048912 Bacteria 848
384 Ga0496109_1337561 3300048912 Bacteria 652
385 Ga0496112_0139084 3300048915 Bacteria 2397
386 Ga0496113_0985216 3300048916 Bacteria 664
387 Ga0496114_0163829 3300048917 Bacteria 1935
388 Ga0496115_0194295 3300048918 Bacteria 1677
389 Ga0495678_188748 3300049459 Bacteria 642
390 Ga0501291_014467 3300049514 Bacteria 1181
391 Ga0501298_113555 3300049521 Bacteria 631
392 Ga0501300_000731 3300049523 Bacteria 4932
393 Ga0501032_0387269 3300049569 Bacteria 899
394 Ga0501033_0000565 3300049570 Bacteria 34468
395 Ga0501034_0000641 3300049571 Bacteria 54300
396 Ga0501034_0093094 3300049571 Bacteria 3010
397 Ga0501034_0173008 3300049571 Bacteria 2126
398 Ga0501042_0504105 3300049578 Bacteria 879
399 Ga0501043_0287146 3300049579 Bacteria 1260
400 Ga0501046_0652436 3300049580 Unclassified 744
401 Ga0501067_0015456 3300049583 Bacteria 4226
402 Ga0501068_0043891 3300049584 Bacteria 2690
403 Ga0501069_0916437 3300049585 Bacteria 533
404 Ga0501071_0001676 3300049587 Bacteria 12997
405 Ga0501071_0270049 3300049587 Bacteria 1286
406 Ga0501072_0002048 3300049588 Bacteria 14991
407 Ga0501072_0024636 3300049588 Bacteria 4684
408 Ga0501072_0112710 3300049588 Bacteria 2165
409 Ga0501073_0170098 3300049589 Bacteria 1508
410 Ga0501074_0032109 3300049590 Bacteria 3805
411 Ga0501074_0206226 3300049590 Bacteria 1401
412 Ga0501075_0043235 3300049591 Bacteria 3379
413 Ga0501077_0002804 3300049593 Bacteria 10456
414 Ga0501249_043842 3300049679 Bacteria 1018
415 Ga0501079_0000604 3300049741 Bacteria 23816
416 Ga0501080_0015536 3300049742 Bacteria 7020
417 Ga0501080_0365859 3300049742 Bacteria 1301
418 Ga0501080_0370346 3300049742 Bacteria 1292
419 Ga0501081_0223917 3300049743 Bacteria 1368
420 Ga0501081_0784888 3300049743 Bacteria 717
421 Ga0501267_000112 3300049764 Bacteria 5182
422 Ga0501272_068161 3300049769 Bacteria 517
423 nmdc:mga03683_155105_c1 3300050489 Unclassified 1035
424 nmdc:mga03683_3760_c2 3300050489 Bacteria 2804
425 nmdc:mga03n38_3563_c1 3300050490 Bacteria 5026
426 nmdc:mga0yw44_649312_c1 3300050492 Unclassified 717
427 nmdc:mga0k408_3106_c1 3300050493 Bacteria 8801
428 nmdc:mga0k408_737755_c1 3300050493 Bacteria 576
429 nmdc:mga06z11_113893_c1 3300050494 Bacteria 1501
430 nmdc:mga06z11_11937_c1 3300050494 Bacteria 2903
431 nmdc:mga07m45_1462_c1 3300050496 Bacteria 10840
432 nmdc:mga07m45_31227_c1 3300050496 Bacteria 2952
433 nmdc:mga05p37_1235464_c1 3300050507 Unclassified 768
434 nmdc:mga09592_224899_c1 3300050508 Unclassified 1626
435 nmdc:mga0qj67_113690_c1 3300050509 Bacteria 2186
436 nmdc:mga0qj67_1183511_c1 3300050509 Bacteria 595
437 nmdc:mga06r32_334030_c1 3300050510 Bacteria 1500
438 nmdc:mga08y16_1739212_c1 3300050511 Bacteria 578
439 nmdc:mga08y16_180307_c1 3300050511 Unclassified 2193
440 nmdc:mga08y16_1859_c1 3300050511 Bacteria 21453
441 nmdc:mga0rr50_116593_c1 3300050513 Bacteria 2120
442 nmdc:mga0a205_1537993_c1 3300050515 Bacteria 513
443 nmdc:mga0sz30_42222_c2 3300050516 Bacteria 989
444 nmdc:mga0sz30_6858_c1 3300050516 Bacteria 4251
445 Ga0500578_0464471 3300053086 Bacteria 718
446 Ga0500650_0247802 3300053098 Bacteria 800
447 Ga0500658_0002629 3300053134 Bacteria 6916
448 Ga0500568_0025639 3300053139 Bacteria 2484
449 Ga0500577_0392122 3300053142 Unclassified 607
450 Ga0501084_0023787 3300054114 Bacteria 5109
451 Ga0501082_0117575 3300060353 Bacteria 2303
452 Ga0466962_0003292 3300061719 Bacteria 7676
453 Ga0466962_0111224 3300061719 Bacteria 1319
454 Ga0530510_0366055 3300061734 Bacteria 1084
455 2643815737 2643221559 Bacteria 4424915
456 2643940758 2643221586 Bacteria 4446529
457 2644080195 2643221612 Bacteria 4361984
458 2644695791 2643221727 Bacteria 4415595
459 2904622589 2904615490 Bacteria 10047340
460 642597120 642555112 Bacteria 8676562
461 Ga0466969_0018161
462 rootH1_10170785
463 Ga0065715_10129151
464 Ga0070676_10207221
465 Ga0070677_10004666
466 Ga0068869_100061399
467 Ga0068869_100072884
468 Ga0068869_100296523
469 Ga0068869_100380109
470 Ga0070666_10004385
471 Ga0070666_10013781
472 Ga0070666_10785047
473 Ga0070680_100375561
474 Ga0068868_100004933
475 Ga0068868_100008290
476 Ga0068868_100011587
477 Ga0070689_100027465
478 Ga0070689_100140067
479 Ga0070689_100553996
480 Ga0070668_100003653
481 Ga0070668_100025295
482 Ga0070669_100187494
483 Ga0070669_100298271
484 Ga0070675_100008171
485 Ga0070675_100008971
486 Ga0070671_100002283
487 Ga0070674_100001737
488 Ga0070674_100042754
489 Ga0070673_100000414
490 Ga0070673_100024254
491 Ga0070673_100052622
492 Ga0070673_100075977
493 Ga0070688_100007290
494 Ga0070688_100734963
495 Ga0070659_101417061
496 Ga0070667_100004577
497 Ga0070667_100112213
498 Ga0070667_100268791
499 Ga0070667_101020152
500 Ga0070700_100473709
501 Ga0070700_100706468
502 Ga0070708_100355629
503 Ga0070663_100040669
504 Ga0070678_100034195
505 Ga0070678_100039661
506 Ga0070678_100326234
507 Ga0070662_100048909
508 Ga0068867_100004322
509 Ga0068867_100005598
510 Ga0070685_10077459
511 Ga0070685_10316219
512 Ga0068853_100005722
513 Ga0068853_100393387
514 Ga0068853_101317664
515 Ga0070672_100009932
516 Ga0070672_100218937
517 Ga0070695_100290450
518 Ga0070696_100309538
519 Ga0070665_100042494
520 Ga0070665_100060912
521 Ga0070665_100124742
522 Ga0070665_100341078
523 Ga0070704_100768538
524 Ga0070704_100898897
525 Ga0068857_100425098
526 Ga0070702_101155614
527 Ga0068852_100156332
528 Ga0068859_100025433
529 Ga0068859_100648383
530 Ga0068859_101042424
531 Ga0068864_100000046
532 Ga0068864_100003522
533 Ga0068864_100004730
534 Ga0068864_100143009
535 Ga0068861_100020784
536 Ga0068861_100031275
537 Ga0068861_100090966
538 Ga0068861_100152102
539 Ga0068861_100352945
540 Ga0068861_101272997
541 Ga0068851_10000963
542 Ga0068870_10029085
543 Ga0068870_10224121
544 Ga0068870_10337103
545 Ga0068863_100003538
546 Ga0068863_100014047
547 Ga0068863_101538988
548 Ga0068863_101577344
549 Ga0068858_100056047
550 Ga0068858_100057670
551 Ga0068858_100649057
552 Ga0068860_100002164
553 Ga0068860_100515606
554 Ga0068860_102570797
555 Ga0068862_100380708
556 Ga0075368_10327983
557 Ga0075363_100011486
558 Ga0075364_10322441
559 Ga0075362_10020687
560 Ga0075367_10003340
561 Ga0075367_10593146
562 Ga0075369_10013614
563 Ga0075369_10068668
564 Ga0075427_10041461
565 Ga0075366_10072882
566 Ga0075366_10101992
567 Ga0075366_10127633
568 Ga0075366_10246569
569 Ga0075366_10843438
570 Ga0075366_11074172
571 Ga0097621_100071436
572 Ga0097621_100258906
573 Ga0097621_100269370
574 Ga0097621_101868698
575 Ga0075370_10002789
576 Ga0075370_10027526
577 Ga0075370_10039911
578 Ga0075370_10074024
579 Ga0075370_10892543
580 Ga0068871_100110972
581 Ga0068871_100117282
582 Ga0068871_100300819
583 Ga0068871_100565308
584 Ga0075428_100000133
585 Ga0075428_100051798
586 Ga0075428_100114848
587 Ga0075428_100965143
588 Ga0075430_100141658
589 Ga0075430_101425893
590 Ga0075431_100244486
591 Ga0075429_101054404
592 Ga0068865_100101685
593 Ga0068865_100131619
594 Ga0068865_101085519
595 Ga0097620_100025432
596 Ga0097620_100155782
597 Ga0097620_100648525
598 Ga0097620_101042312
599 Ga0099826_10457401
600 Ga0105251_10158598
601 Ga0105240_10130469
602 Ga0105240_12173381
603 Ga0111539_10000654
604 Ga0111539_10322958
605 Ga0105245_10247432
606 Ga0105245_10339284
607 Ga0105245_11082615
608 Ga0105247_10021490
609 Ga0114129_11061071
610 Ga0105243_10024169
611 Ga0105243_10478819
612 Ga0105248_10003651
613 Ga0105248_10019374
614 Ga0105248_10078334
615 Ga0105248_10555988
616 Ga0105237_10057642
617 Ga0105249_10047847
618 Ga0105239_10040126
619 Ga0105239_11167124
620 Ga0157374_10015238
621 Ga0157374_10034007
622 Ga0157378_10024746
623 Ga0157378_10072118
624 Ga0157378_10519654
625 Ga0163162_10060010
626 Ga0163162_10068114
627 Ga0157375_10000991
628 Ga0157375_10382621
629 Ga0157375_10501963
630 Ga0163163_10029012
631 Ga0163163_10479608
632 Ga0157380_10036291
633 Ga0157380_10177359
634 Ga0157380_10271386
635 Ga0157380_10308298
636 Ga0157380_10665009
637 Ga0157380_11052233
638 Ga0157377_10555550
639 Ga0157379_10004507
640 Ga0157376_10050766
641 Ga0183360_10001
642 Ga0163161_10087328
643 Ga0163161_10224674
644 Ga0209565_1002300
645 Ga0207697_10006798
646 Ga0207697_10030017
647 Ga0207656_10002949
648 Ga0207682_10001173
649 Ga0207682_10025400
650 Ga0207710_10010257
651 Ga0207680_10002438
652 Ga0207645_10001033
653 Ga0207645_10091588
654 Ga0207645_10094272
655 Ga0207643_10081182
656 Ga0207643_10213078
657 Ga0207654_10661615
658 Ga0207695_10167703
659 Ga0207671_10018695
660 Ga0207660_10866612
661 Ga0207662_10556988
662 Ga0207681_10173270
663 Ga0207681_10246218
664 Ga0207681_10329552
665 Ga0207694_10775699
666 Ga0207650_10174178
667 Ga0207650_11483572
668 Ga0207659_10003127
669 Ga0207659_10167779
670 Ga0207687_10189273
671 Ga0207687_10401813
672 Ga0207700_10389005
673 Ga0207644_10008533
674 Ga0207690_11129996
675 Ga0207706_10140717
676 Ga0207670_10458748
677 Ga0207670_10573266
678 Ga0207669_10001098
679 Ga0207669_10017530
680 Ga0207704_10001647
681 Ga0207704_10016422
682 Ga0207691_10000006
683 Ga0207691_10001055
684 Ga0207691_10002769
685 Ga0207691_10230191
686 Ga0207711_10171912
687 Ga0207711_10176985
688 Ga0207711_10306614
689 Ga0207711_10353491
690 Ga0207689_10001598
691 Ga0207689_10055677
692 Ga0207689_10247606
693 Ga0207689_10294111
694 Ga0207689_10383675
695 Ga0207689_10910751
696 Ga0207689_11770871
697 Ga0207651_10074667
698 Ga0207651_10093255
699 Ga0207651_10137611
700 Ga0207668_10005508
701 Ga0207640_10203493
702 Ga0207640_10328064
703 Ga0207658_10046027
704 Ga0207658_10263501
705 Ga0207658_10411556
706 Ga0207677_10000069
707 Ga0207677_10023297
708 Ga0207703_10012059
709 Ga0207703_10364321
710 Ga0207703_10402062
711 Ga0207703_10531454
712 Ga0207639_10005406
713 Ga0207639_10143158
714 Ga0207639_10343845
715 Ga0207708_10069939
716 Ga0207641_10001705
717 Ga0207641_10024731
718 Ga0207641_10800363
719 Ga0207641_11242138
720 Ga0207648_10003315
721 Ga0207648_10121092
722 Ga0207648_10125362
723 Ga0207676_10000008
724 Ga0207676_10002144
725 Ga0207676_10021291
726 Ga0207676_10541961
727 Ga0207676_12544277
728 Ga0207674_10054186
729 Ga0207674_10088969
730 Ga0207675_100001670
731 Ga0207675_100104972
732 Ga0207675_100124979
733 Ga0207675_100148786
734 Ga0207675_100158126
735 Ga0207675_102351720
736 Ga0207683_10000250
737 Ga0207683_10000853
738 Ga0207683_10057077
739 Ga0207698_10003568
740 Ga0209282_1375077
741 Ga0207428_10089355
742 Ga0207428_10299392
743 Ga0268266_10060333
744 Ga0268266_10202235
745 Ga0268266_10853862
746 Ga0268265_10230416
747 Ga0268264_10879234
748 Ga0268264_12507292
749 Ga0307517_10101294
750 Ga0307517_10117953
751 Ga0307517_10164912
752 Ga0307513_10117936
753 Ga0307513_10217539
754 Ga0307513_10352818
755 Ga0307408_100188519
756 Ga0316575_10019694
757 Ga0316579_10316602
758 Ga0316578_10484401
759 Ga0307516_10022871
760 Ga0307516_10777577
761 Ga0316577_10256301
762 Ga0307413_11034812
763 Ga0307409_100466734
764 Ga0307409_101964980
765 Ga0307416_102055419
766 Ga0307416_102369666
767 Ga0307414_10983780
768 Ga0307411_10717821
769 Ga0307415_100965271
770 Ga0307510_10218187
771 Ga0373948_0008567
772 Ga0373950_0003111
773 Ga0373940_0018466
774 Ga0373951_0010198
775 Ga0373939_0000090
776 Ga0373945_0323885
777 Ga0373960_0001231
778 Ga0373946_0527707
779 Ga0373961_0063068
780 Ga0373931_0000516
781 Ga0373937_0254405
782 Ga0373937_0478882
783 Ga0316582_0020819
784 Ga0395900_0814271
785 Ga0395905_0287921
786 Ga0316581_0004793
787 Ga0450897_036166
788 Ga0451577_0094867
789 Ga0451577_1676020
790 Ga0453683_0585936
791 Ga0466965_0130400
792 Ga0466966_0222488
793 Ga0466961_0145275
794 Ga0466971_0025669
795 Ga0466968_0266167
796 Ga0466968_0393391
797 Ga0466957_0040153
798 Ga0466960_0006870
799 Ga0466959_0031417
800 Ga0451576_1771352
801 Ga0466967_1786487
802 Ga0495629_0073366
803 Ga0495582_0285287
804 Ga0495605_0029015
805 Ga0495594_0090716
806 Ga0495583_0228919
807 Ga0495608_0630071
808 Ga0495610_0088163
809 Ga0495620_0088133
810 Ga0495628_0437154
811 Ga0495630_0326271
812 Ga0495630_0708580
813 Ga0495631_0054785
814 Ga0495632_0003106
815 Ga0495642_0424659
816 Ga0495598_0015034
817 Ga0495609_0044876
818 Ga0495621_0015517
819 Ga0495597_0059365
820 Ga0495597_0187811
821 Ga0495645_0087358
822 Ga0495668_0052296
823 Ga0495611_0067112
824 Ga0495625_0023869
825 Ga0495647_0393362
826 Ga0495658_0000385
827 Ga0495658_0132765
828 Ga0495658_0470861
829 Ga0495671_0180926
830 Ga0495649_0008052
831 Ga0495660_0043232
832 Ga0495581_0247038
833 Ga0495674_1426102
834 Ga0495672_0183233
835 Ga0495687_001446
836 Ga0495626_0205376
837 Ga0496100_0282514
838 Ga0496104_0025922
839 Ga0496106_0785255
840 Ga0496107_0077713
841 Ga0496107_0485869
842 Ga0496108_1418325
843 Ga0496109_0853975
844 Ga0496109_1337561
845 Ga0496112_0139084
846 Ga0496113_0985216
847 Ga0496114_0163829
848 Ga0496115_0194295
849 Ga0495678_188748
850 Ga0501291_014467
851 Ga0501298_113555
852 Ga0501300_000731
853 Ga0501032_0387269
854 Ga0501033_0000565
855 Ga0501034_0000641
856 Ga0501034_0093094
857 Ga0501034_0173008
858 Ga0501042_0504105
859 Ga0501043_0287146
860 Ga0501046_0652436
861 Ga0501067_0015456
862 Ga0501068_0043891
863 Ga0501069_0916437
864 Ga0501071_0001676
865 Ga0501071_0270049
866 Ga0501072_0002048
867 Ga0501072_0024636
868 Ga0501072_0112710
869 Ga0501073_0170098
870 Ga0501074_0032109
871 Ga0501074_0206226
872 Ga0501075_0043235
873 Ga0501077_0002804
874 Ga0501249_043842
875 Ga0501079_0000604
876 Ga0501080_0015536
877 Ga0501080_0365859
878 Ga0501080_0370346
879 Ga0501081_0223917
880 Ga0501081_0784888
881 Ga0501267_000112
882 Ga0501272_068161
883 nmdc:mga03683_155105_c1
884 nmdc:mga03683_3760_c2
885 nmdc:mga03n38_3563_c1
886 nmdc:mga0yw44_649312_c1
887 nmdc:mga0k408_3106_c1
888 nmdc:mga0k408_737755_c1
889 nmdc:mga06z11_113893_c1
890 nmdc:mga06z11_11937_c1
891 nmdc:mga07m45_1462_c1
892 nmdc:mga07m45_31227_c1
893 nmdc:mga05p37_1235464_c1
894 nmdc:mga09592_224899_c1
895 nmdc:mga0qj67_113690_c1
896 nmdc:mga0qj67_1183511_c1
897 nmdc:mga06r32_334030_c1
898 nmdc:mga08y16_1739212_c1
899 nmdc:mga08y16_180307_c1
900 nmdc:mga08y16_1859_c1
901 nmdc:mga0rr50_116593_c1
902 nmdc:mga0a205_1537993_c1
903 nmdc:mga0sz30_42222_c2
904 nmdc:mga0sz30_6858_c1
905 Ga0500578_0464471
906 Ga0500650_0247802
907 Ga0500658_0002629
908 Ga0500568_0025639
909 Ga0500577_0392122
910 Ga0501084_0023787
911 Ga0501082_0117575
912 Ga0466962_0003292
913 Ga0466962_0111224
914 Ga0530510_0366055
915 2643815737
916 2643940758
917 2644080195
918 2644695791
919 2904622589
920 642597120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

3

125

0.97

PF04343

DUF488

Domain of unknown function DUF488

4

121

0.88

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

2

131

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dv5-assembly1.cif.gz_B crystal structure of leu65 to ala mutant of diphthine synthase 0.6489 84 128
2p6k-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.6185 81 128
2pcg-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5993 76 128
2emr-assembly1.cif.gz_B mutant l65m structure of ph0725 from pyrococcus horikoshii ot3 0.5983 76 128
2e8h-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5979 76 128
ID Description Score Start End Superfamily
4gamM02 Mainly Alpha;Up-down Bundle;Monooxygenase;Methane monooxygenase, gamma chain, domain 2 0.7157 53 81 1.20.1280.30
af_Q9P6N4_361_771_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.567 54 93 1.25.40.10
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5476 52 92 1.25.40.10
af_E1B6W2_4_608_1.20.1280.170 Mainly Alpha;Up-down Bundle;Monooxygenase;Exocyst complex component Exo70 0.5454 53 95 1.20.1280.170
af_K7L3G9_6_154_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5438 50 94 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9993 1 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9992 1 128
AF-A0A375J012-F1-model_v4 DUF488 domain-containing protein 0.9984 1 128
AF-Q2IDM1-F1-model_v4 DUF488 domain-containing protein 0.9958 1 128
AF-A0A2T6CNJ7-F1-model_v4 DUF488 domain-containing protein 0.9944 1 127

Map