F448602

General Info

Members Datasets Scaffolds Average Seq Length
460 169 920 251

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000049|Ga0495583_0000049_124697_125551
Length 284
Sequence MLNLRKRMAHRRRPRRTRPDSSNHKKENRLGPMQSTNDFGLENWHDYEVGSRREIIALLRSIGEKNQLIRMLIHGEADVCVTSILDVDPDTNTLILDRSVNRDQNQRILAARRISYETTLDKIRILFASDAVTETEYDQRPALRIAVPATLVRLQRREFYRMATPVSNPVRAIIPLPEELGGGSAIFPLADISCGGIAMLDNKFMLGNTIGINYPGCRIDLPDIGTVMTTLQVRNSLDLTLLNNKANRRLGCHFIDISRANLAMVQRYITKLERERNARIAGLS

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
51 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
140 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
141 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
144 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
145 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
146 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
147 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
148 2643221638 Duganella sp. Root336D2 Isolate Unclassified
149 2643221645 Massilia sp. Root351 Isolate Unclassified
150 2738541280 Massilia sp. GV090 Isolate Unclassified
151 2738541297 Duganella sp. GV083 Isolate Unclassified
152 2738541300 Massilia sp. GV016 Isolate Unclassified
153 2738541357 Duganella sp. GV053 Isolate Unclassified
154 2738543003 Duganella sp. GV066 Isolate Unclassified
155 2738543018 Massilia sp. GV045 Isolate Unclassified
156 2738543026 Duganella sp. GV089 Isolate Unclassified
157 2738543029 Duganella sp. GV039 Isolate Unclassified
158 2738543030 Massilia sp. GV097 Isolate Unclassified
159 2821131069 Duganella sp. 1224 Isolate Unclassified
160 2842711865 Duganella sp. R-73148 Isolate Unclassified
161 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
162 2857553236 Duganella sp. R-74557 Isolate Unclassified
163 2857558681 Duganella sp. R-74565 Isolate Unclassified
164 2857564685 Duganella sp. R-74599 Isolate Unclassified
165 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
166 2904424332 Duganella sp. 1411 Isolate Rhizosphere
167 2919476304 Duganella sp. 3397 Isolate Unclassified
168 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
169 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 0
Isolates 5.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.39
Nodule 0.22
Rhizoplane 2.39
Rhizosphere 71.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0000049 3300046506 Bacteria 216069
2 JGI25154J39366_1001870 3300002738 Bacteria 6411
3 JGI25152J39213_1000661 3300002773 Bacteria 18007
4 JGI25152J39213_1009873 3300002773 Bacteria 2227
5 JGI25150J39212_1001342 3300002774 Bacteria 6998
6 JGI25150J39212_1017311 3300002774 Bacteria 1166
7 JGI25159J45721_1003969 3300002987 Bacteria 5045
8 JGI25159J45721_1007888 3300002987 Bacteria 2992
9 JGI25153J46596_10002108 3300003215 Bacteria 11647
10 JGI25153J46596_10059428 3300003215 Bacteria 1047
11 rootH2_10035623 3300003320 Bacteria 2436
12 rootL2_10068323 3300003322 Bacteria 2538
13 rootL2_10106234 3300003322 Bacteria 4932
14 JGI25160J50197_1006033 3300003354 Bacteria 4955
15 JGI25161J50226_1002114 3300003374 Bacteria 5346
16 JGI25161J50226_1002569 3300003374 Bacteria 4577
17 Ga0055529_1000185 3300003763 Bacteria 85584
18 Ga0055526_1002381 3300003771 Bacteria 12740
19 Ga0055526_1002451 3300003771 Bacteria 12541
20 Ga0055526_1015442 3300003771 Bacteria 3064
21 Ga0055537_1000072 3300003773 Bacteria 73276
22 Ga0055537_1014691 3300003773 Bacteria 1408
23 Ga0055537_1023860 3300003773 Bacteria 868
24 Ga0055524_1001485 3300003775 Bacteria 13375
25 Ga0055524_1009540 3300003775 Bacteria 3935
26 Ga0055524_1035287 3300003775 Bacteria 1366
27 Ga0055534_1000136 3300003784 Bacteria 55242
28 Ga0055534_1001319 3300003784 Bacteria 9980
29 Ga0055528_1000025 3300003790 Bacteria 130730
30 Ga0055528_1005148 3300003790 Bacteria 6152
31 Ga0055530_10032562 3300003791 Bacteria 1354
32 Ga0055543_1001185 3300004625 Bacteria 10992
33 Ga0055543_1005934 3300004625 Bacteria 3037
34 Ga0065165_1000094 3300005262 Bacteria 146099
35 Ga0065165_1007529 3300005262 Bacteria 5323
36 Ga0075363_100143584 3300006048 Bacteria 1345
37 Ga0079104_1028269 3300006946 Bacteria 1426
38 Ga0105244_10005704 3300009036 Bacteria 8218
39 Ga0105244_10009302 3300009036 Bacteria 6054
40 Ga0105248_10994999 3300009177 Bacteria 947
41 Ga0157371_10000001 3300013102 Bacteria 1162285
42 Ga0182008_10000671 3300014497 Bacteria 24825
43 Ga0182008_10017414 3300014497 Bacteria 3728
44 Ga0182006_1000075 3300015261 Bacteria 130239
45 Ga0182006_1000163 3300015261 Bacteria 70369
46 Ga0182007_10000135 3300015262 Bacteria 51737
47 Ga0182007_10053926 3300015262 Bacteria 1323
48 Ga0182005_1000020 3300015265 Bacteria 278671
49 Ga0182005_1000106 3300015265 Bacteria 63464
50 Ga0163161_10122170 3300017792 Bacteria 1958
51 Ga0213872_10000002 3300021361 Bacteria 554092
52 Ga0213872_10001032 3300021361 Bacteria 19398
53 Ga0213872_10011587 3300021361 Bacteria 4168
54 Ga0213872_10113421 3300021361 Bacteria 1202
55 Ga0209436_102373 3300025208 Bacteria 5720
56 Ga0209436_102579 3300025208 Bacteria 5331
57 Ga0209437_109112 3300025233 Bacteria 1561
58 Ga0209437_110937 3300025233 Bacteria 1370
59 Ga0207425_1000001 3300025245 Bacteria 2525432
60 Ga0207425_1000153 3300025245 Bacteria 58689
61 Ga0207425_1001176 3300025245 Bacteria 11658
62 Ga0209646_1000028 3300025246 Bacteria 387986
63 Ga0209129_1000001 3300025258 Bacteria 1452436
64 Ga0209129_1005405 3300025258 Bacteria 4536
65 Ga0209565_1000009 3300025263 Bacteria 751701
66 Ga0209565_1000404 3300025263 Bacteria 36034
67 Ga0209565_1013552 3300025263 Bacteria 1904
68 Ga0209565_1017174 3300025263 Bacteria 1591
69 Ga0209565_1029395 3300025263 Bacteria 1079
70 Ga0209455_1000049 3300025272 Bacteria 374414
71 Ga0209673_1000036 3300025273 Bacteria 323162
72 Ga0209673_1003169 3300025273 Bacteria 10027
73 Ga0209130_1000455 3300025284 Bacteria 43009
74 Ga0209130_1001251 3300025284 Bacteria 17718
75 Ga0209130_1011148 3300025284 Bacteria 2422
76 Ga0209675_1000013 3300025291 Bacteria 448220
77 Ga0209675_1001097 3300025291 Bacteria 16631
78 Ga0209675_1003287 3300025291 Bacteria 7773
79 Ga0209025_1005178 3300025294 Bacteria 10777
80 Ga0209564_1000009 3300025295 Bacteria 950196
81 Ga0209564_1000045 3300025295 Bacteria 376549
82 Ga0209564_1000175 3300025295 Bacteria 153109
83 Ga0209564_1000515 3300025295 Bacteria 63379
84 Ga0209564_1001461 3300025295 Bacteria 23999
85 Ga0209564_1039077 3300025295 Bacteria 1309
86 Ga0209758_1000149 3300025297 Bacteria 163504
87 Ga0209758_1000230 3300025297 Bacteria 119426
88 Ga0209050_1000905 3300025298 Bacteria 39208
89 Ga0209050_1001360 3300025298 Bacteria 26768
90 Ga0209050_1002963 3300025298 Bacteria 13263
91 Ga0209256_1000005 3300025299 Bacteria 1315082
92 Ga0209256_1000358 3300025299 Bacteria 74650
93 Ga0209256_1000886 3300025299 Bacteria 36957
94 Ga0209256_1001613 3300025299 Bacteria 22014
95 Ga0209256_1002010 3300025299 Bacteria 18153
96 Ga0207426_1002658 3300025302 Bacteria 10981
97 Ga0207426_1007346 3300025302 Bacteria 4626
98 Ga0209051_1031627 3300025303 Bacteria 2032
99 Ga0209257_1000486 3300025304 Bacteria 71627
100 Ga0207655_1007880 3300025728 Bacteria 6845
101 Ga0207655_1013471 3300025728 Bacteria 4693
102 Ga0316180_1012425 3300030736 Bacteria 2986
103 Ga0316182_1091011 3300030745 Bacteria 947
104 Ga0307408_100000182 3300031548 Bacteria 69692
105 Ga0307408_100000837 3300031548 Bacteria 24309
106 Ga0307408_100046659 3300031548 Bacteria 3099
107 Ga0307408_100071523 3300031548 Bacteria 2565
108 Ga0307414_10051777 3300032004 Bacteria 2852
109 Ga0395899_0004489 3300037312 Bacteria 10874
110 Ga0395900_0016198 3300037418 Bacteria 7594
111 Ga0395900_0133109 3300037418 Bacteria 2547
112 Ga0395898_0265517 3300037466 Bacteria 1637
113 Ga0395905_0121898 3300037471 Bacteria 2451
114 Ga0395905_0300484 3300037471 Bacteria 1492
115 Ga0395901_0560124 3300038443 Bacteria 1157
116 Ga0436361_0140501 3300039447 Bacteria 9372
117 Ga0436361_0570400 3300039447 Bacteria 111725
118 Ga0436361_0592898 3300039447 Bacteria 2851
119 Ga0436361_0814020 3300039447 Bacteria 1130
120 Ga0436361_0950682 3300039447 Bacteria 10268
121 Ga0450897_002420 3300042128 Bacteria 1400
122 Ga0450906_010450 3300042145 Bacteria 1756
123 Ga0466966_0023507 3300044684 Bacteria 4034
124 Ga0466970_0038233 3300044765 Bacteria 2545
125 Ga0495617_000006 3300046452 Bacteria 398279
126 Ga0495617_000008 3300046452 Bacteria 340369
127 Ga0495627_000005 3300046453 Bacteria 630805
128 Ga0495627_000812 3300046453 Bacteria 22811
129 Ga0495627_003520 3300046453 Bacteria 6863
130 Ga0495603_0076006 3300046455 Bacteria 1971
131 Ga0495590_0000003 3300046457 Bacteria 478593
132 Ga0495590_0012678 3300046457 Bacteria 3122
133 Ga0495590_0114368 3300046457 Bacteria 964
134 Ga0495638_0000118 3300046460 Bacteria 127657
135 Ga0495638_0005053 3300046460 Bacteria 9893
136 Ga0495638_0053281 3300046460 Bacteria 2518
137 Ga0495638_0055441 3300046460 Bacteria 2461
138 Ga0495638_0088279 3300046460 Bacteria 1872
139 Ga0495638_0234916 3300046460 Bacteria 1018
140 Ga0495653_0000011 3300046463 Bacteria 272314
141 Ga0495650_0000195 3300046471 Bacteria 131338
142 Ga0495650_0000235 3300046471 Bacteria 111830
143 Ga0495650_0000544 3300046471 Bacteria 53879
144 Ga0495650_0001386 3300046471 Bacteria 23829
145 Ga0495650_0003130 3300046471 Bacteria 12388
146 Ga0495650_0014885 3300046471 Bacteria 4015
147 Ga0495650_0018048 3300046471 Bacteria 3519
148 Ga0495582_0062109 3300046473 Bacteria 2063
149 Ga0495605_0000003 3300046474 Bacteria 491502
150 Ga0495605_0000083 3300046474 Bacteria 124953
151 Ga0495605_0011701 3300046474 Bacteria 4883
152 Ga0495605_0233050 3300046474 Bacteria 792
153 Ga0495584_0000405 3300046491 Bacteria 29778
154 Ga0495584_0009076 3300046491 Bacteria 5136
155 Ga0495584_0013590 3300046491 Bacteria 4154
156 Ga0495584_0043189 3300046491 Bacteria 2275
157 Ga0495584_0209221 3300046491 Bacteria 991
158 Ga0495585_0001472 3300046492 Bacteria 18420
159 Ga0495585_0005802 3300046492 Bacteria 7742
160 Ga0495585_0032667 3300046492 Bacteria 2947
161 Ga0495585_0033106 3300046492 Bacteria 2927
162 Ga0495585_0065497 3300046492 Bacteria 1990
163 Ga0495594_0005224 3300046499 Bacteria 6674
164 Ga0495594_0022988 3300046499 Bacteria 3338
165 Ga0495594_0136271 3300046499 Bacteria 1391
166 Ga0495596_0000416 3300046500 Bacteria 27207
167 Ga0495596_0001393 3300046500 Bacteria 13892
168 Ga0495596_0013520 3300046500 Bacteria 3460
169 Ga0495596_0016593 3300046500 Bacteria 3056
170 Ga0495607_0002500 3300046501 Bacteria 14899
171 Ga0495607_0005199 3300046501 Bacteria 9372
172 Ga0495607_0006102 3300046501 Bacteria 8522
173 Ga0495607_0017198 3300046501 Bacteria 4650
174 Ga0495607_0023591 3300046501 Bacteria 3849
175 Ga0495607_0038911 3300046501 Bacteria 2844
176 Ga0495607_0074899 3300046501 Bacteria 1877
177 Ga0495607_0161858 3300046501 Bacteria 1136
178 Ga0495607_0207972 3300046501 Bacteria 964
179 Ga0495583_0000079 3300046506 Bacteria 169681
180 Ga0495583_0000413 3300046506 Bacteria 64881
181 Ga0495583_0001390 3300046506 Bacteria 24725
182 Ga0495583_0003794 3300046506 Bacteria 11226
183 Ga0495606_0000185 3300046507 Bacteria 109977
184 Ga0495606_0000284 3300046507 Bacteria 88119
185 Ga0495606_0000778 3300046507 Bacteria 48896
186 Ga0495606_0001400 3300046507 Bacteria 32506
187 Ga0495606_0002275 3300046507 Bacteria 22723
188 Ga0495606_0003570 3300046507 Bacteria 16401
189 Ga0495606_0007751 3300046507 Bacteria 9507
190 Ga0495606_0009398 3300046507 Bacteria 8278
191 Ga0495606_0017387 3300046507 Bacteria 5437
192 Ga0495606_0034218 3300046507 Bacteria 3490
193 Ga0495606_0042866 3300046507 Bacteria 3023
194 Ga0495606_0240421 3300046507 Bacteria 1010
195 Ga0495610_0000004 3300046512 Bacteria 1006135
196 Ga0495610_0001183 3300046512 Bacteria 23602
197 Ga0495610_0013298 3300046512 Bacteria 4897
198 Ga0495610_0013862 3300046512 Bacteria 4764
199 Ga0495610_0034312 3300046512 Bacteria 2614
200 Ga0495610_0040579 3300046512 Bacteria 2344
201 Ga0495610_0040883 3300046512 Bacteria 2332
202 Ga0495616_0005718 3300046513 Bacteria 7615
203 Ga0495616_0006668 3300046513 Bacteria 6968
204 Ga0495616_0011209 3300046513 Bacteria 5147
205 Ga0495616_0030073 3300046513 Bacteria 2859
206 Ga0495616_0043102 3300046513 Bacteria 2293
207 Ga0495616_0055997 3300046513 Bacteria 1949
208 Ga0495616_0080659 3300046513 Bacteria 1557
209 Ga0495616_0085623 3300046513 Bacteria 1500
210 Ga0495631_0002637 3300046518 Bacteria 10010
211 Ga0495631_0005364 3300046518 Bacteria 6722
212 Ga0495631_0023515 3300046518 Bacteria 2855
213 Ga0495631_0024982 3300046518 Bacteria 2754
214 Ga0495631_0041287 3300046518 Bacteria 2042
215 Ga0495632_0000467 3300046519 Bacteria 38367
216 Ga0495632_0028271 3300046519 Bacteria 2927
217 Ga0495637_0001383 3300046520 Bacteria 14514
218 Ga0495637_0006637 3300046520 Bacteria 5792
219 Ga0495643_0000505 3300046522 Bacteria 48848
220 Ga0495643_0000641 3300046522 Bacteria 41474
221 Ga0495643_0023490 3300046522 Bacteria 3505
222 Ga0495643_0073834 3300046522 Bacteria 1787
223 Ga0495644_0010715 3300046523 Bacteria 3531
224 Ga0495644_0013905 3300046523 Bacteria 3085
225 Ga0495644_0044325 3300046523 Bacteria 1673
226 Ga0495644_0047934 3300046523 Bacteria 1604
227 Ga0495648_0000070 3300046524 Bacteria 136680
228 Ga0495648_0001121 3300046524 Bacteria 27150
229 Ga0495648_0001870 3300046524 Bacteria 20129
230 Ga0495648_0006446 3300046524 Bacteria 9579
231 Ga0495648_0008109 3300046524 Bacteria 8299
232 Ga0495648_0087728 3300046524 Bacteria 1751
233 Ga0495648_0092122 3300046524 Bacteria 1693
234 Ga0495663_0054185 3300046525 Bacteria 1248
235 Ga0495663_0089047 3300046525 Bacteria 1004
236 Ga0495666_0000706 3300046526 Bacteria 15182
237 Ga0495666_0072497 3300046526 Bacteria 1635
238 Ga0495642_0000733 3300046528 Bacteria 16294
239 Ga0495642_0000971 3300046528 Bacteria 13344
240 Ga0495642_0004916 3300046528 Bacteria 5154
241 Ga0495642_0009751 3300046528 Bacteria 3677
242 Ga0495642_0023796 3300046528 Bacteria 2419
243 Ga0495642_0194960 3300046528 Bacteria 882
244 Ga0495654_0000035 3300046530 Bacteria 192768
245 Ga0495654_0009865 3300046530 Bacteria 5218
246 Ga0495654_0017523 3300046530 Bacteria 3765
247 Ga0495609_0000587 3300046538 Bacteria 28562
248 Ga0495609_0001640 3300046538 Bacteria 14580
249 Ga0495609_0007738 3300046538 Bacteria 5326
250 Ga0495609_0036132 3300046538 Bacteria 2232
251 Ga0495597_0000206 3300046542 Bacteria 53783
252 Ga0495597_0005143 3300046542 Bacteria 6976
253 Ga0495597_0005840 3300046542 Bacteria 6437
254 Ga0495597_0073419 3300046542 Bacteria 1470
255 Ga0495597_0077282 3300046542 Bacteria 1427
256 Ga0495622_0000004 3300046557 Bacteria 258984
257 Ga0495622_0000256 3300046557 Bacteria 40845
258 Ga0495622_0017387 3300046557 Bacteria 3347
259 Ga0495622_0026299 3300046557 Bacteria 2718
260 Ga0495622_0145729 3300046557 Bacteria 1073
261 Ga0495622_0152151 3300046557 Bacteria 1046
262 Ga0495622_0184748 3300046557 Bacteria 934
263 Ga0495633_0001442 3300046558 Bacteria 18481
264 Ga0495633_0001704 3300046558 Bacteria 16484
265 Ga0495633_0002584 3300046558 Bacteria 12672
266 Ga0495633_0003081 3300046558 Bacteria 11341
267 Ga0495633_0007532 3300046558 Bacteria 6252
268 Ga0495633_0015988 3300046558 Bacteria 3882
269 Ga0495633_0027461 3300046558 Bacteria 2782
270 Ga0495633_0048831 3300046558 Bacteria 1997
271 Ga0495633_0060017 3300046558 Bacteria 1782
272 Ga0495656_0000569 3300046615 Bacteria 12008
273 Ga0495656_0023931 3300046615 Bacteria 2407
274 Ga0495668_0000094 3300046616 Bacteria 141412
275 Ga0495668_0000168 3300046616 Bacteria 97230
276 Ga0495668_0000683 3300046616 Bacteria 40836
277 Ga0495668_0000883 3300046616 Bacteria 33776
278 Ga0495668_0001068 3300046616 Bacteria 28928
279 Ga0495668_0004229 3300046616 Bacteria 10332
280 Ga0495668_0009082 3300046616 Bacteria 6134
281 Ga0495668_0119623 3300046616 Bacteria 1440
282 Ga0495668_0276189 3300046616 Bacteria 920
283 Ga0495611_0003487 3300046648 Bacteria 6925
284 Ga0495611_0007717 3300046648 Bacteria 4569
285 Ga0495611_0035152 3300046648 Bacteria 2218
286 Ga0495611_0057265 3300046648 Bacteria 1766
287 Ga0495625_0000562 3300046660 Bacteria 54473
288 Ga0495625_0000916 3300046660 Bacteria 39677
289 Ga0495625_0023597 3300046660 Bacteria 4696
290 Ga0495625_0029741 3300046660 Bacteria 4082
291 Ga0495625_0055463 3300046660 Bacteria 2826
292 Ga0495625_0066033 3300046660 Bacteria 2549
293 Ga0495625_0069553 3300046660 Bacteria 2473
294 Ga0495625_0070597 3300046660 Bacteria 2452
295 Ga0495625_0255974 3300046660 Bacteria 1135
296 Ga0495659_0000031 3300046664 Bacteria 65868
297 Ga0495659_0002372 3300046664 Bacteria 6083
298 Ga0495659_0003774 3300046664 Bacteria 4814
299 Ga0495661_0000846 3300046665 Bacteria 28530
300 Ga0495661_0001460 3300046665 Bacteria 19792
301 Ga0495661_0020499 3300046665 Bacteria 4314
302 Ga0495661_0027784 3300046665 Bacteria 3629
303 Ga0495661_0042886 3300046665 Bacteria 2785
304 Ga0495661_0087771 3300046665 Bacteria 1777
305 Ga0495661_0135095 3300046665 Bacteria 1347
306 Ga0495661_0246164 3300046665 Bacteria 914
307 Ga0495588_0000067 3300046674 Bacteria 238958
308 Ga0495588_0007598 3300046674 Bacteria 4944
309 Ga0495588_0114231 3300046674 Bacteria 1423
310 Ga0495669_0000177 3300046684 Bacteria 40130
311 Ga0495669_0005745 3300046684 Bacteria 5173
312 Ga0495613_0033010 3300046689 Bacteria 3847
313 Ga0495670_0000189 3300046691 Bacteria 27218
314 Ga0495670_0006240 3300046691 Bacteria 5848
315 Ga0495670_0015563 3300046691 Bacteria 3737
316 Ga0495670_0059557 3300046691 Bacteria 1917
317 Ga0495670_0085759 3300046691 Bacteria 1607
318 Ga0495670_0105868 3300046691 Bacteria 1452
319 Ga0495671_0000001 3300046692 Bacteria 1169494
320 Ga0495671_0000345 3300046692 Bacteria 38587
321 Ga0495671_0001079 3300046692 Bacteria 18889
322 Ga0495671_0004940 3300046692 Bacteria 7866
323 Ga0495671_0005962 3300046692 Bacteria 7081
324 Ga0495671_0018328 3300046692 Bacteria 3717
325 Ga0495671_0044153 3300046692 Bacteria 2235
326 Ga0495671_0056435 3300046692 Bacteria 1944
327 Ga0495671_0075434 3300046692 Bacteria 1654
328 Ga0495649_0012036 3300046694 Bacteria 5050
329 Ga0495649_0016824 3300046694 Bacteria 4140
330 Ga0495589_0009512 3300046794 Bacteria 5051
331 Ga0495589_0047093 3300046794 Bacteria 2137
332 Ga0495589_0191854 3300046794 Bacteria 966
333 Ga0495660_0000777 3300046810 Bacteria 23916
334 Ga0495660_0000981 3300046810 Bacteria 20849
335 Ga0495660_0001658 3300046810 Bacteria 14919
336 Ga0495660_0001897 3300046810 Bacteria 13688
337 Ga0495660_0022010 3300046810 Bacteria 3644
338 Ga0495660_0024690 3300046810 Bacteria 3423
339 Ga0495660_0034245 3300046810 Bacteria 2843
340 Ga0495660_0070813 3300046810 Bacteria 1850
341 Ga0495660_0092437 3300046810 Bacteria 1570
342 Ga0495660_0215572 3300046810 Bacteria 908
343 Ga0495581_0018587 3300047315 Bacteria 4036
344 Ga0495604_0105132 3300047317 Bacteria 2067
345 Ga0495636_0000282 3300047318 Bacteria 19836
346 Ga0495636_0002672 3300047318 Bacteria 6883
347 Ga0495636_0003565 3300047318 Bacteria 6033
348 Ga0495636_0018707 3300047318 Bacteria 2780
349 Ga0495636_0021170 3300047318 Bacteria 2624
350 Ga0495674_0014385 3300047319 Bacteria 7408
351 Ga0495672_0000050 3300047320 Bacteria 240336
352 Ga0495672_0000580 3300047320 Bacteria 41398
353 Ga0495672_0000697 3300047320 Bacteria 37194
354 Ga0495672_0032892 3300047320 Bacteria 3218
355 Ga0495676_0000037 3300047321 Bacteria 115856
356 Ga0495676_0082800 3300047321 Bacteria 2427
357 Ga0495683_0077143 3300047323 Bacteria 1629
358 Ga0495687_000116 3300047443 Bacteria 122687
359 Ga0495687_000235 3300047443 Bacteria 76976
360 Ga0495687_001054 3300047443 Bacteria 27272
361 Ga0495687_006696 3300047443 Bacteria 6989
362 Ga0495677_0002854 3300047445 Bacteria 6732
363 Ga0495677_0006607 3300047445 Bacteria 4376
364 Ga0495677_0006919 3300047445 Bacteria 4263
365 Ga0495677_0009718 3300047445 Bacteria 3545
366 Ga0495677_0012991 3300047445 Bacteria 3031
367 Ga0495677_0047104 3300047445 Bacteria 1582
368 Ga0495677_0077855 3300047445 Bacteria 1241
369 Ga0495677_0119584 3300047445 Bacteria 1004
370 Ga0495679_001512 3300047446 Bacteria 13140
371 Ga0495679_009189 3300047446 Bacteria 3973
372 Ga0495679_063955 3300047446 Bacteria 1073
373 Ga0495685_000279 3300047447 Bacteria 17084
374 Ga0495685_000448 3300047447 Bacteria 12939
375 Ga0495685_022010 3300047447 Bacteria 2193
376 Ga0495685_028178 3300047447 Bacteria 1932
377 Ga0495673_0000006 3300047469 Bacteria 908691
378 Ga0495673_0000014 3300047469 Bacteria 599202
379 Ga0495673_0000090 3300047469 Bacteria 188187
380 Ga0495673_0064778 3300047469 Bacteria 1553
381 Ga0495681_0000751 3300047470 Bacteria 24951
382 Ga0495681_0002699 3300047470 Bacteria 12571
383 Ga0495681_0005034 3300047470 Bacteria 8906
384 Ga0495681_0055061 3300047470 Bacteria 1856
385 Ga0495681_0081878 3300047470 Bacteria 1439
386 Ga0495686_0000225 3300047472 Bacteria 104121
387 Ga0495686_0007014 3300047472 Bacteria 8512
388 Ga0495686_0075637 3300047472 Bacteria 2064
389 Ga0495686_0105732 3300047472 Bacteria 1693
390 Ga0495686_0168137 3300047472 Bacteria 1277
391 Ga0495626_0015512 3300048091 Bacteria 3896
392 Ga0495626_0026554 3300048091 Bacteria 2821
393 Ga0496102_0000193 3300048905 Bacteria 83162
394 Ga0496102_0001901 3300048905 Bacteria 18007
395 Ga0496102_0009463 3300048905 Bacteria 8374
396 Ga0496102_0425971 3300048905 Bacteria 1246
397 Ga0496103_0010282 3300048906 Bacteria 5534
398 Ga0496103_0015489 3300048906 Bacteria 4538
399 Ga0496103_0057082 3300048906 Bacteria 2424
400 Ga0496103_0059574 3300048906 Bacteria 2372
401 Ga0496107_0196545 3300048910 Bacteria 1499
402 Ga0496111_0071420 3300048914 Bacteria 2527
403 Ga0496116_0031090 3300048919 Bacteria 3828
404 Ga0496116_0035403 3300048919 Bacteria 3507
405 Ga0496116_0052449 3300048919 Bacteria 2702
406 Ga0496117_0000001 3300048920 Bacteria 2526244
407 Ga0496118_0000008 3300048921 Bacteria 644537
408 Ga0496121_0055386 3300048924 Bacteria 3304
409 Ga0496121_0062197 3300048924 Bacteria 3059
410 Ga0496121_0112894 3300048924 Bacteria 2069
411 Ga0496121_0139132 3300048924 Bacteria 1804
412 Ga0496122_0001150 3300048925 Bacteria 45372
413 Ga0496122_0189421 3300048925 Bacteria 1216
414 Ga0496123_0001851 3300048926 Bacteria 27757
415 Ga0496123_0003204 3300048926 Bacteria 18664
416 Ga0496124_0091180 3300048927 Bacteria 2484
417 Ga0496125_0181421 3300048928 Bacteria 1402
418 Ga0496125_0316421 3300048928 Bacteria 948
419 Ga0496126_0249200 3300048929 Bacteria 1481
420 Ga0495678_000016 3300049459 Bacteria 303426
421 Ga0495678_003082 3300049459 Bacteria 10574
422 Ga0495678_003398 3300049459 Bacteria 9897
423 Ga0495678_007840 3300049459 Bacteria 5486
424 Ga0495682_0000848 3300049460 Bacteria 19101
425 Ga0495682_0006016 3300049460 Bacteria 4955
426 Ga0495682_0007817 3300049460 Bacteria 4235
427 Ga0495682_0057527 3300049460 Bacteria 1407
428 Ga0495682_0098105 3300049460 Bacteria 1051
429 Ga0501222_017969 3300049662 Bacteria 939
430 Ga0501269_000499 3300049766 Bacteria 8110
431 Ga0501279_006588 3300049775 Bacteria 1535
432 nmdc:mga03n38_238355_c1 3300050490 Bacteria 956
433 Ga0500594_0024695 3300053118 Bacteria 1533
434 Ga0500618_000371 3300053125 Bacteria 31102
435 Ga0500586_014815 3300053145 Bacteria 2330
436 Ga0500586_020371 3300053145 Bacteria 2077
437 2601670867 2600255292 Bacteria 6300551
438 2643788232 2643221554 Bacteria 6603920
439 2644213834 2643221638 Bacteria 6579467
440 2644253961 2643221645 Bacteria 7207331
441 2738742079 2738541280 Bacteria 6630198
442 2738825029 2738541297 Bacteria 6549566
443 2738844532 2738541300 Bacteria 6675882
444 2739148826 2738541357 Bacteria 6549408
445 2739190745 2738543003 Bacteria 6549560
446 2739276042 2738543018 Bacteria 6718814
447 2739317222 2738543026 Bacteria 6549408
448 2739335463 2738543029 Bacteria 6549249
449 2739345434 2738543030 Bacteria 6719714
450 2821133636 2821131069 Bacteria 6108407
451 2842717311 2842711865 Bacteria 7155354
452 2857547639 2857547612 Bacteria 6179999
453 2857553746 2857553236 Bacteria 6166726
454 2857564660 2857558681 Bacteria 6617694
455 2857565423 2857564685 Bacteria 6290584
456 2885082248 2885080285 Bacteria 6355622
457 2904430477 2904424332 Bacteria 7633521
458 2919480370 2919476304 Bacteria 5888696
459 2932412251 2932410948 Bacteria 6312192
460 2932419766 2932416698 Bacteria 6315112
461 Ga0495583_0000049
462 JGI25154J39366_1001870
463 JGI25152J39213_1000661
464 JGI25152J39213_1009873
465 JGI25150J39212_1001342
466 JGI25150J39212_1017311
467 JGI25159J45721_1003969
468 JGI25159J45721_1007888
469 JGI25153J46596_10002108
470 JGI25153J46596_10059428
471 rootH2_10035623
472 rootL2_10068323
473 rootL2_10106234
474 JGI25160J50197_1006033
475 JGI25161J50226_1002114
476 JGI25161J50226_1002569
477 Ga0055529_1000185
478 Ga0055526_1002381
479 Ga0055526_1002451
480 Ga0055526_1015442
481 Ga0055537_1000072
482 Ga0055537_1014691
483 Ga0055537_1023860
484 Ga0055524_1001485
485 Ga0055524_1009540
486 Ga0055524_1035287
487 Ga0055534_1000136
488 Ga0055534_1001319
489 Ga0055528_1000025
490 Ga0055528_1005148
491 Ga0055530_10032562
492 Ga0055543_1001185
493 Ga0055543_1005934
494 Ga0065165_1000094
495 Ga0065165_1007529
496 Ga0075363_100143584
497 Ga0079104_1028269
498 Ga0105244_10005704
499 Ga0105244_10009302
500 Ga0105248_10994999
501 Ga0157371_10000001
502 Ga0182008_10000671
503 Ga0182008_10017414
504 Ga0182006_1000075
505 Ga0182006_1000163
506 Ga0182007_10000135
507 Ga0182007_10053926
508 Ga0182005_1000020
509 Ga0182005_1000106
510 Ga0163161_10122170
511 Ga0213872_10000002
512 Ga0213872_10001032
513 Ga0213872_10011587
514 Ga0213872_10113421
515 Ga0209436_102373
516 Ga0209436_102579
517 Ga0209437_109112
518 Ga0209437_110937
519 Ga0207425_1000001
520 Ga0207425_1000153
521 Ga0207425_1001176
522 Ga0209646_1000028
523 Ga0209129_1000001
524 Ga0209129_1005405
525 Ga0209565_1000009
526 Ga0209565_1000404
527 Ga0209565_1013552
528 Ga0209565_1017174
529 Ga0209565_1029395
530 Ga0209455_1000049
531 Ga0209673_1000036
532 Ga0209673_1003169
533 Ga0209130_1000455
534 Ga0209130_1001251
535 Ga0209130_1011148
536 Ga0209675_1000013
537 Ga0209675_1001097
538 Ga0209675_1003287
539 Ga0209025_1005178
540 Ga0209564_1000009
541 Ga0209564_1000045
542 Ga0209564_1000175
543 Ga0209564_1000515
544 Ga0209564_1001461
545 Ga0209564_1039077
546 Ga0209758_1000149
547 Ga0209758_1000230
548 Ga0209050_1000905
549 Ga0209050_1001360
550 Ga0209050_1002963
551 Ga0209256_1000005
552 Ga0209256_1000358
553 Ga0209256_1000886
554 Ga0209256_1001613
555 Ga0209256_1002010
556 Ga0207426_1002658
557 Ga0207426_1007346
558 Ga0209051_1031627
559 Ga0209257_1000486
560 Ga0207655_1007880
561 Ga0207655_1013471
562 Ga0316180_1012425
563 Ga0316182_1091011
564 Ga0307408_100000182
565 Ga0307408_100000837
566 Ga0307408_100046659
567 Ga0307408_100071523
568 Ga0307414_10051777
569 Ga0395899_0004489
570 Ga0395900_0016198
571 Ga0395900_0133109
572 Ga0395898_0265517
573 Ga0395905_0121898
574 Ga0395905_0300484
575 Ga0395901_0560124
576 Ga0436361_0140501
577 Ga0436361_0570400
578 Ga0436361_0592898
579 Ga0436361_0814020
580 Ga0436361_0950682
581 Ga0450897_002420
582 Ga0450906_010450
583 Ga0466966_0023507
584 Ga0466970_0038233
585 Ga0495617_000006
586 Ga0495617_000008
587 Ga0495627_000005
588 Ga0495627_000812
589 Ga0495627_003520
590 Ga0495603_0076006
591 Ga0495590_0000003
592 Ga0495590_0012678
593 Ga0495590_0114368
594 Ga0495638_0000118
595 Ga0495638_0005053
596 Ga0495638_0053281
597 Ga0495638_0055441
598 Ga0495638_0088279
599 Ga0495638_0234916
600 Ga0495653_0000011
601 Ga0495650_0000195
602 Ga0495650_0000235
603 Ga0495650_0000544
604 Ga0495650_0001386
605 Ga0495650_0003130
606 Ga0495650_0014885
607 Ga0495650_0018048
608 Ga0495582_0062109
609 Ga0495605_0000003
610 Ga0495605_0000083
611 Ga0495605_0011701
612 Ga0495605_0233050
613 Ga0495584_0000405
614 Ga0495584_0009076
615 Ga0495584_0013590
616 Ga0495584_0043189
617 Ga0495584_0209221
618 Ga0495585_0001472
619 Ga0495585_0005802
620 Ga0495585_0032667
621 Ga0495585_0033106
622 Ga0495585_0065497
623 Ga0495594_0005224
624 Ga0495594_0022988
625 Ga0495594_0136271
626 Ga0495596_0000416
627 Ga0495596_0001393
628 Ga0495596_0013520
629 Ga0495596_0016593
630 Ga0495607_0002500
631 Ga0495607_0005199
632 Ga0495607_0006102
633 Ga0495607_0017198
634 Ga0495607_0023591
635 Ga0495607_0038911
636 Ga0495607_0074899
637 Ga0495607_0161858
638 Ga0495607_0207972
639 Ga0495583_0000079
640 Ga0495583_0000413
641 Ga0495583_0001390
642 Ga0495583_0003794
643 Ga0495606_0000185
644 Ga0495606_0000284
645 Ga0495606_0000778
646 Ga0495606_0001400
647 Ga0495606_0002275
648 Ga0495606_0003570
649 Ga0495606_0007751
650 Ga0495606_0009398
651 Ga0495606_0017387
652 Ga0495606_0034218
653 Ga0495606_0042866
654 Ga0495606_0240421
655 Ga0495610_0000004
656 Ga0495610_0001183
657 Ga0495610_0013298
658 Ga0495610_0013862
659 Ga0495610_0034312
660 Ga0495610_0040579
661 Ga0495610_0040883
662 Ga0495616_0005718
663 Ga0495616_0006668
664 Ga0495616_0011209
665 Ga0495616_0030073
666 Ga0495616_0043102
667 Ga0495616_0055997
668 Ga0495616_0080659
669 Ga0495616_0085623
670 Ga0495631_0002637
671 Ga0495631_0005364
672 Ga0495631_0023515
673 Ga0495631_0024982
674 Ga0495631_0041287
675 Ga0495632_0000467
676 Ga0495632_0028271
677 Ga0495637_0001383
678 Ga0495637_0006637
679 Ga0495643_0000505
680 Ga0495643_0000641
681 Ga0495643_0023490
682 Ga0495643_0073834
683 Ga0495644_0010715
684 Ga0495644_0013905
685 Ga0495644_0044325
686 Ga0495644_0047934
687 Ga0495648_0000070
688 Ga0495648_0001121
689 Ga0495648_0001870
690 Ga0495648_0006446
691 Ga0495648_0008109
692 Ga0495648_0087728
693 Ga0495648_0092122
694 Ga0495663_0054185
695 Ga0495663_0089047
696 Ga0495666_0000706
697 Ga0495666_0072497
698 Ga0495642_0000733
699 Ga0495642_0000971
700 Ga0495642_0004916
701 Ga0495642_0009751
702 Ga0495642_0023796
703 Ga0495642_0194960
704 Ga0495654_0000035
705 Ga0495654_0009865
706 Ga0495654_0017523
707 Ga0495609_0000587
708 Ga0495609_0001640
709 Ga0495609_0007738
710 Ga0495609_0036132
711 Ga0495597_0000206
712 Ga0495597_0005143
713 Ga0495597_0005840
714 Ga0495597_0073419
715 Ga0495597_0077282
716 Ga0495622_0000004
717 Ga0495622_0000256
718 Ga0495622_0017387
719 Ga0495622_0026299
720 Ga0495622_0145729
721 Ga0495622_0152151
722 Ga0495622_0184748
723 Ga0495633_0001442
724 Ga0495633_0001704
725 Ga0495633_0002584
726 Ga0495633_0003081
727 Ga0495633_0007532
728 Ga0495633_0015988
729 Ga0495633_0027461
730 Ga0495633_0048831
731 Ga0495633_0060017
732 Ga0495656_0000569
733 Ga0495656_0023931
734 Ga0495668_0000094
735 Ga0495668_0000168
736 Ga0495668_0000683
737 Ga0495668_0000883
738 Ga0495668_0001068
739 Ga0495668_0004229
740 Ga0495668_0009082
741 Ga0495668_0119623
742 Ga0495668_0276189
743 Ga0495611_0003487
744 Ga0495611_0007717
745 Ga0495611_0035152
746 Ga0495611_0057265
747 Ga0495625_0000562
748 Ga0495625_0000916
749 Ga0495625_0023597
750 Ga0495625_0029741
751 Ga0495625_0055463
752 Ga0495625_0066033
753 Ga0495625_0069553
754 Ga0495625_0070597
755 Ga0495625_0255974
756 Ga0495659_0000031
757 Ga0495659_0002372
758 Ga0495659_0003774
759 Ga0495661_0000846
760 Ga0495661_0001460
761 Ga0495661_0020499
762 Ga0495661_0027784
763 Ga0495661_0042886
764 Ga0495661_0087771
765 Ga0495661_0135095
766 Ga0495661_0246164
767 Ga0495588_0000067
768 Ga0495588_0007598
769 Ga0495588_0114231
770 Ga0495669_0000177
771 Ga0495669_0005745
772 Ga0495613_0033010
773 Ga0495670_0000189
774 Ga0495670_0006240
775 Ga0495670_0015563
776 Ga0495670_0059557
777 Ga0495670_0085759
778 Ga0495670_0105868
779 Ga0495671_0000001
780 Ga0495671_0000345
781 Ga0495671_0001079
782 Ga0495671_0004940
783 Ga0495671_0005962
784 Ga0495671_0018328
785 Ga0495671_0044153
786 Ga0495671_0056435
787 Ga0495671_0075434
788 Ga0495649_0012036
789 Ga0495649_0016824
790 Ga0495589_0009512
791 Ga0495589_0047093
792 Ga0495589_0191854
793 Ga0495660_0000777
794 Ga0495660_0000981
795 Ga0495660_0001658
796 Ga0495660_0001897
797 Ga0495660_0022010
798 Ga0495660_0024690
799 Ga0495660_0034245
800 Ga0495660_0070813
801 Ga0495660_0092437
802 Ga0495660_0215572
803 Ga0495581_0018587
804 Ga0495604_0105132
805 Ga0495636_0000282
806 Ga0495636_0002672
807 Ga0495636_0003565
808 Ga0495636_0018707
809 Ga0495636_0021170
810 Ga0495674_0014385
811 Ga0495672_0000050
812 Ga0495672_0000580
813 Ga0495672_0000697
814 Ga0495672_0032892
815 Ga0495676_0000037
816 Ga0495676_0082800
817 Ga0495683_0077143
818 Ga0495687_000116
819 Ga0495687_000235
820 Ga0495687_001054
821 Ga0495687_006696
822 Ga0495677_0002854
823 Ga0495677_0006607
824 Ga0495677_0006919
825 Ga0495677_0009718
826 Ga0495677_0012991
827 Ga0495677_0047104
828 Ga0495677_0077855
829 Ga0495677_0119584
830 Ga0495679_001512
831 Ga0495679_009189
832 Ga0495679_063955
833 Ga0495685_000279
834 Ga0495685_000448
835 Ga0495685_022010
836 Ga0495685_028178
837 Ga0495673_0000006
838 Ga0495673_0000014
839 Ga0495673_0000090
840 Ga0495673_0064778
841 Ga0495681_0000751
842 Ga0495681_0002699
843 Ga0495681_0005034
844 Ga0495681_0055061
845 Ga0495681_0081878
846 Ga0495686_0000225
847 Ga0495686_0007014
848 Ga0495686_0075637
849 Ga0495686_0105732
850 Ga0495686_0168137
851 Ga0495626_0015512
852 Ga0495626_0026554
853 Ga0496102_0000193
854 Ga0496102_0001901
855 Ga0496102_0009463
856 Ga0496102_0425971
857 Ga0496103_0010282
858 Ga0496103_0015489
859 Ga0496103_0057082
860 Ga0496103_0059574
861 Ga0496107_0196545
862 Ga0496111_0071420
863 Ga0496116_0031090
864 Ga0496116_0035403
865 Ga0496116_0052449
866 Ga0496117_0000001
867 Ga0496118_0000008
868 Ga0496121_0055386
869 Ga0496121_0062197
870 Ga0496121_0112894
871 Ga0496121_0139132
872 Ga0496122_0001150
873 Ga0496122_0189421
874 Ga0496123_0001851
875 Ga0496123_0003204
876 Ga0496124_0091180
877 Ga0496125_0181421
878 Ga0496125_0316421
879 Ga0496126_0249200
880 Ga0495678_000016
881 Ga0495678_003082
882 Ga0495678_003398
883 Ga0495678_007840
884 Ga0495682_0000848
885 Ga0495682_0006016
886 Ga0495682_0007817
887 Ga0495682_0057527
888 Ga0495682_0098105
889 Ga0501222_017969
890 Ga0501269_000499
891 Ga0501279_006588
892 nmdc:mga03n38_238355_c1
893 Ga0500594_0024695
894 Ga0500618_000371
895 Ga0500586_014815
896 Ga0500586_020371
897 2601670867
898 2643788232
899 2644213834
900 2644253961
901 2738742079
902 2738825029
903 2738844532
904 2739148826
905 2739190745
906 2739276042
907 2739317222
908 2739335463
909 2739345434
910 2821133636
911 2842717311
912 2857547639
913 2857553746
914 2857564660
915 2857565423
916 2885082248
917 2904430477
918 2919480370
919 2932412251
920 2932419766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07317

PilZN

Flagellar regulator YcgR, PilZN domain

47

153

0.98

PF07238

PilZ

PilZ domain

155

271

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.943 16 122
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.8778 16 122
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7557 124 242
4xrn-assembly2.cif.gz_B pilz domain with c-di-gmp of a protein from pseudomonas aeruginosa 0.7411 124 238
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7368 124 242
ID Description Score Start End Superfamily
af_P76010_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9585 16 124 2.30.110.10
af_P76010_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9327 16 124 2.30.110.10
2gjgA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9288 17 124 2.30.110.10
2gjgA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9048 17 124 2.30.110.10
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8041 126 248 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A1A8XNK4-F1-model_v4 Flagellar brake protein YcgR 0.9344 54 126 GO:0009288
AF-A0A831A3C9-F1-model_v4 Type III secretion system flagellar brake protein YcgR PilZN domain-containing protein 0.9143 28 117
AF-A0A4V1TEX5-F1-model_v4 deleted 0.9071 155 252
AF-A0A3B8YF11-F1-model_v4 deleted 0.9035 18 114
AF-A0A133XHN5-F1-model_v4 PilZ domain-containing protein 0.9025 156 252 GO:0035438

Map