F448618

General Info

Members Datasets Scaffolds Average Seq Length
460 264 455 253

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0414421|Ga0495684_0414421_50_910
Length 286
Sequence MDQDEELVPGVSAEASHQLPPAEVVRPFGAAAVSLFRADDIAIRFGGIRAVDAVSFDVNEGEVFSIIGPNGAGKTTIFNLISRIYQPSSGRLYFQDRDITEIPAYRIAGLGIARTFQNIELFANATLLQNLLIGRHCHSTVGVLSQLVFLPAVRREELQHREKAEEVIAFLGLERYRDTLIANLPYGVRKVVELGRALCIEPKLLLLDEPSSGLNVEETEGMGFWIEDIKKDLGITVIMVEHDMNLVRMVSDRVMALNYGKVIALGTPDEVQNHPEVVRAYIGGEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221604 Nocardioides sp. Root190 Isolate Unclassified
3 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
4 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
5 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
6 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.22
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.26
Nodule 0.22
Rhizoplane 0.87
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2460877 2162886007 Bacteria 2264
2 Ga0065704_10071856 3300005289 Bacteria 9751
3 Ga0065704_10213959 3300005289 Bacteria 1098
4 Ga0065715_10107448 3300005293 Bacteria 2761
5 Ga0070676_10000918 3300005328 Bacteria 14587
6 Ga0070670_100002798 3300005331 Bacteria 14429
7 Ga0068869_100001909 3300005334 Bacteria 12529
8 Ga0068869_100021072 3300005334 Bacteria 4480
9 Ga0070666_10052674 3300005335 Bacteria 2743
10 Ga0070680_100000266 3300005336 Bacteria 34632
11 Ga0070680_100070977 3300005336 Bacteria 2861
12 Ga0070682_100000518 3300005337 Bacteria 24177
13 Ga0070660_100001036 3300005339 Bacteria 18682
14 Ga0070691_10243992 3300005341 Bacteria 961
15 Ga0070687_100124957 3300005343 Bacteria 1477
16 Ga0070661_100000703 3300005344 Bacteria 24523
17 Ga0070692_10000029 3300005345 Bacteria 27136
18 Ga0070669_100033343 3300005353 Bacteria 3724
19 Ga0070675_100199888 3300005354 Bacteria 1735
20 Ga0070659_100003576 3300005366 Bacteria 11064
21 Ga0070667_100304386 3300005367 Bacteria 1436
22 Ga0070709_10076733 3300005434 Bacteria 2171
23 Ga0070709_10137953 3300005434 Bacteria 1672
24 Ga0070714_100043666 3300005435 Bacteria 3792
25 Ga0070713_100022797 3300005436 Bacteria 4845
26 Ga0070713_100029565 3300005436 Bacteria 4341
27 Ga0070713_100054736 3300005436 Bacteria 3312
28 Ga0070713_100266995 3300005436 Bacteria 1566
29 Ga0070710_10009071 3300005437 Bacteria 4863
30 Ga0070701_10267761 3300005438 Bacteria 1038
31 Ga0070711_100048336 3300005439 Bacteria 2908
32 Ga0070705_100000602 3300005440 Bacteria 20833
33 Ga0070705_100059547 3300005440 Bacteria 2262
34 Ga0070700_100109628 3300005441 Bacteria 1833
35 Ga0070694_100000833 3300005444 Bacteria 17315
36 Ga0070694_100347246 3300005444 Bacteria 1148
37 Ga0070708_100019168 3300005445 Bacteria 5743
38 Ga0070708_100032641 3300005445 Bacteria 4518
39 Ga0070708_100084512 3300005445 Bacteria 2879
40 Ga0070708_100145312 3300005445 Bacteria 2202
41 Ga0070708_100176843 3300005445 Bacteria 1994
42 Ga0070708_100505675 3300005445 Bacteria 1140
43 Ga0070663_100000911 3300005455 Bacteria 16057
44 Ga0070662_100051947 3300005457 Bacteria 2962
45 Ga0070681_10023799 3300005458 Bacteria 6165
46 Ga0068867_100001309 3300005459 Bacteria 17226
47 Ga0068867_100201090 3300005459 Bacteria 1595
48 Ga0070706_100012087 3300005467 Bacteria 8012
49 Ga0070706_100080975 3300005467 Bacteria 3007
50 Ga0070707_100041886 3300005468 Bacteria 4383
51 Ga0070707_100128223 3300005468 Bacteria 2466
52 Ga0070707_100192565 3300005468 Bacteria 1988
53 Ga0070707_100454197 3300005468 Bacteria 1242
54 Ga0070698_100002225 3300005471 Bacteria 21473
55 Ga0070698_100058110 3300005471 Bacteria 3911
56 Ga0070699_100001487 3300005518 Bacteria 21471
57 Ga0070699_100175058 3300005518 Bacteria 1902
58 Ga0070699_100218605 3300005518 Bacteria 1698
59 Ga0070679_100002143 3300005530 Bacteria 17792
60 Ga0070679_100027768 3300005530 Bacteria 5574
61 Ga0070684_100678853 3300005535 Bacteria 960
62 Ga0070697_100087970 3300005536 Bacteria 2565
63 Ga0070697_100356689 3300005536 Bacteria 1264
64 Ga0068853_100000808 3300005539 Bacteria 21801
65 Ga0068853_100732986 3300005539 Bacteria 944
66 Ga0070672_100030387 3300005543 Bacteria 4058
67 Ga0070695_100006415 3300005545 Bacteria 6956
68 Ga0070695_100012294 3300005545 Bacteria 5133
69 Ga0070695_100204735 3300005545 Bacteria 1413
70 Ga0070696_100001094 3300005546 Bacteria 17529
71 Ga0070693_100000045 3300005547 Bacteria 47582
72 Ga0070693_100258260 3300005547 Bacteria 1158
73 Ga0070704_100000240 3300005549 Bacteria 23438
74 Ga0068855_100000462 3300005563 Bacteria 50016
75 Ga0070664_100002902 3300005564 Bacteria 13870
76 Ga0070664_100067786 3300005564 Bacteria 3050
77 Ga0068857_100008050 3300005577 Bacteria 9090
78 Ga0068857_100305180 3300005577 Bacteria 1468
79 Ga0068854_100007822 3300005578 Bacteria 6841
80 Ga0068856_100002716 3300005614 Bacteria 18136
81 Ga0068856_100171541 3300005614 Bacteria 2181
82 Ga0070702_100056816 3300005615 Bacteria 2262
83 Ga0068859_100002495 3300005617 Bacteria 18707
84 Ga0068859_100102443 3300005617 Bacteria 2920
85 Ga0068864_100001334 3300005618 Bacteria 20531
86 Ga0068861_100009309 3300005719 Bacteria 6778
87 Ga0068861_100077458 3300005719 Bacteria 2593
88 Ga0068870_10000934 3300005840 Bacteria 11459
89 Ga0068870_10171846 3300005840 Bacteria 1294
90 Ga0068863_100122956 3300005841 Bacteria 2476
91 Ga0068863_100282447 3300005841 Bacteria 1608
92 Ga0068858_100020465 3300005842 Bacteria 6185
93 Ga0068858_100401690 3300005842 Bacteria 1317
94 Ga0068862_100002748 3300005844 Bacteria 15437
95 Ga0068862_100158726 3300005844 Bacteria 2017
96 Ga0081455_10000074 3300005937 Bacteria 107319
97 Ga0081455_10022128 3300005937 Bacteria 5948
98 Ga0081538_10056629 3300005981 Bacteria 2294
99 Ga0081540_1005226 3300005983 Bacteria 9717
100 Ga0070717_10089316 3300006028 Bacteria 2599
101 Ga0070717_10107858 3300006028 Bacteria 2372
102 Ga0075365_10268910 3300006038 Bacteria 1199
103 Ga0075368_10040874 3300006042 Bacteria 1821
104 Ga0075368_10057408 3300006042 Bacteria 1554
105 Ga0075364_10017964 3300006051 Bacteria 4423
106 Ga0070716_100038839 3300006173 Bacteria 2638
107 Ga0070712_100001675 3300006175 Bacteria 13558
108 Ga0070712_100011814 3300006175 Bacteria 5548
109 Ga0075367_10032834 3300006178 Bacteria 2989
110 Ga0075367_10050194 3300006178 Bacteria 2462
111 Ga0075367_10213776 3300006178 Bacteria 1206
112 Ga0097621_100283101 3300006237 Bacteria 1460
113 Ga0097621_100303853 3300006237 Bacteria 1410
114 Ga0075428_100000509 3300006844 Bacteria 39431
115 Ga0075428_100013632 3300006844 Bacteria 9051
116 Ga0075428_100026860 3300006844 Bacteria 6374
117 Ga0075428_100098801 3300006844 Bacteria 3182
118 Ga0075428_100525299 3300006844 Bacteria 1266
119 Ga0075430_100001087 3300006846 Bacteria 21577
120 Ga0075430_100003590 3300006846 Bacteria 13001
121 Ga0075430_100022035 3300006846 Bacteria 5415
122 Ga0075430_100123259 3300006846 Bacteria 2160
123 Ga0075431_100001593 3300006847 Bacteria 21127
124 Ga0075431_100002162 3300006847 Bacteria 18799
125 Ga0075431_100006591 3300006847 Bacteria 11533
126 Ga0075431_100008769 3300006847 Bacteria 10133
127 Ga0075431_100008892 3300006847 Bacteria 10061
128 Ga0075431_100549282 3300006847 Bacteria 1143
129 Ga0075433_10002867 3300006852 Bacteria 13211
130 Ga0075433_10006931 3300006852 Bacteria 8979
131 Ga0075433_10009404 3300006852 Bacteria 7810
132 Ga0075433_10014523 3300006852 Bacteria 6438
133 Ga0075433_10024429 3300006852 Bacteria 5100
134 Ga0075433_10270788 3300006852 Bacteria 1505
135 Ga0075434_100025615 3300006871 Bacteria 5772
136 Ga0075434_100056781 3300006871 Bacteria 3891
137 Ga0075434_100208246 3300006871 Bacteria 1976
138 Ga0075429_100016643 3300006880 Bacteria 6368
139 Ga0075429_100032538 3300006880 Bacteria 4532
140 Ga0075429_100035877 3300006880 Bacteria 4312
141 Ga0075429_100067385 3300006880 Bacteria 3115
142 Ga0068865_100428835 3300006881 Bacteria 1089
143 Ga0075436_100046510 3300006914 Bacteria 2993
144 Ga0097620_100002495 3300006931 Bacteria 18707
145 Ga0097620_100102445 3300006931 Bacteria 2920
146 Ga0097620_100149385 3300006931 Bacteria 2412
147 Ga0075435_100001922 3300007076 Bacteria 13535
148 Ga0075435_100012226 3300007076 Bacteria 6349
149 Ga0099794_10001445 3300007265 Bacteria 8309
150 Ga0105240_10242374 3300009093 Bacteria 2089
151 Ga0105240_10250558 3300009093 Bacteria 2048
152 Ga0105240_10350754 3300009093 Bacteria 1674
153 Ga0105245_10020215 3300009098 Bacteria 5836
154 Ga0105245_10052690 3300009098 Bacteria 3649
155 Ga0105245_10812770 3300009098 Bacteria 973
156 Ga0114129_10008686 3300009147 Bacteria 14482
157 Ga0114129_10017939 3300009147 Bacteria 10076
158 Ga0114129_10036423 3300009147 Bacteria 6947
159 Ga0114129_10043638 3300009147 Bacteria 6309
160 Ga0114129_10094036 3300009147 Bacteria 4152
161 Ga0114129_10096583 3300009147 Bacteria 4091
162 Ga0114129_10269811 3300009147 Bacteria 2277
163 Ga0114129_10279334 3300009147 Bacteria 2232
164 Ga0114129_10283680 3300009147 Bacteria 2212
165 Ga0114129_10377051 3300009147 Bacteria 1874
166 Ga0105237_10036167 3300009545 Bacteria 4996
167 Ga0105238_10018342 3300009551 Bacteria 7122
168 Ga0105238_10536495 3300009551 Bacteria 1173
169 Ga0105246_10015068 3300011119 Bacteria 4873
170 Ga0105246_10156571 3300011119 Bacteria 1731
171 Ga0157373_10000379 3300013100 Bacteria 35641
172 Ga0157369_10062088 3300013105 Bacteria 4027
173 Ga0157374_10193562 3300013296 Bacteria 1989
174 Ga0157374_10292539 3300013296 Bacteria 1610
175 Ga0157372_10000135 3300013307 Bacteria 81209
176 Ga0163163_10114249 3300014325 Bacteria 2730
177 Ga0163163_10687182 3300014325 Bacteria 1087
178 Ga0157380_10182830 3300014326 Bacteria 1843
179 Ga0182008_10016024 3300014497 Bacteria 3902
180 Ga0157376_10479090 3300014969 Bacteria 1219
181 Ga0213876_10097826 3300021384 Bacteria 1555
182 Ga0213871_10008081 3300021441 Bacteria 2304
183 Ga0207653_10016807 3300025885 Bacteria 2300
184 Ga0207653_10028196 3300025885 Bacteria 1805
185 Ga0207692_10053494 3300025898 Bacteria 2057
186 Ga0207647_10046585 3300025904 Bacteria 2701
187 Ga0207699_10032695 3300025906 Bacteria 2933
188 Ga0207699_10257252 3300025906 Bacteria 1205
189 Ga0207645_10000075 3300025907 Bacteria 71333
190 Ga0207645_10300910 3300025907 Bacteria 1068
191 Ga0207643_10000146 3300025908 Bacteria 48070
192 Ga0207684_10001638 3300025910 Bacteria 23790
193 Ga0207684_10008109 3300025910 Bacteria 9364
194 Ga0207684_10029205 3300025910 Bacteria 4697
195 Ga0207684_10090431 3300025910 Bacteria 2608
196 Ga0207684_10313861 3300025910 Bacteria 1351
197 Ga0207707_10000135 3300025912 Bacteria 76964
198 Ga0207707_10213425 3300025912 Bacteria 1681
199 Ga0207707_10695795 3300025912 Bacteria 854
200 Ga0207671_10090230 3300025914 Bacteria 2308
201 Ga0207693_10006864 3300025915 Bacteria 9402
202 Ga0207693_10014327 3300025915 Bacteria 6379
203 Ga0207663_10092953 3300025916 Bacteria 2006
204 Ga0207663_10352981 3300025916 Bacteria 1114
205 Ga0207660_10002799 3300025917 Bacteria 11432
206 Ga0207660_10129708 3300025917 Bacteria 1918
207 Ga0207662_10039973 3300025918 Bacteria 2754
208 Ga0207657_10000037 3300025919 Bacteria 124230
209 Ga0207649_10029197 3300025920 Bacteria 3255
210 Ga0207652_10001525 3300025921 Bacteria 20432
211 Ga0207646_10001729 3300025922 Bacteria 26558
212 Ga0207646_10053456 3300025922 Bacteria 3613
213 Ga0207646_10177431 3300025922 Bacteria 1924
214 Ga0207646_10305953 3300025922 Bacteria 1436
215 Ga0207646_10416961 3300025922 Bacteria 1212
216 Ga0207681_10086853 3300025923 Bacteria 2224
217 Ga0207681_10432289 3300025923 Bacteria 1068
218 Ga0207687_10098741 3300025927 Bacteria 2144
219 Ga0207687_10149773 3300025927 Bacteria 1779
220 Ga0207700_10044370 3300025928 Bacteria 3272
221 Ga0207700_10055837 3300025928 Bacteria 2970
222 Ga0207700_10097002 3300025928 Bacteria 2342
223 Ga0207664_10121244 3300025929 Bacteria 2188
224 Ga0207709_10042272 3300025935 Bacteria 2740
225 Ga0207665_10000576 3300025939 Bacteria 24692
226 Ga0207691_10235348 3300025940 Bacteria 1585
227 Ga0207689_10000029 3300025942 Bacteria 100016
228 Ga0207689_10039823 3300025942 Bacteria 3890
229 Ga0207679_10002294 3300025945 Bacteria 11794
230 Ga0207679_10151364 3300025945 Bacteria 1889
231 Ga0207667_10000652 3300025949 Bacteria 45007
232 Ga0207658_10255809 3300025986 Bacteria 1490
233 Ga0207703_10053517 3300026035 Bacteria 3281
234 Ga0207703_10517025 3300026035 Bacteria 1122
235 Ga0207639_10004221 3300026041 Bacteria 9683
236 Ga0207678_10005618 3300026067 Bacteria 11215
237 Ga0207708_10101271 3300026075 Bacteria 2230
238 Ga0207708_10140164 3300026075 Bacteria 1896
239 Ga0207702_10007290 3300026078 Bacteria 9457
240 Ga0207702_10026562 3300026078 Bacteria 4807
241 Ga0207702_10131942 3300026078 Bacteria 2249
242 Ga0207702_10148617 3300026078 Bacteria 2129
243 Ga0207702_10395325 3300026078 Bacteria 1332
244 Ga0207641_10017579 3300026088 Bacteria 5854
245 Ga0207641_10117997 3300026088 Bacteria 2363
246 Ga0207641_10207381 3300026088 Bacteria 1811
247 Ga0207648_10000552 3300026089 Bacteria 41984
248 Ga0207648_10181539 3300026089 Bacteria 1863
249 Ga0207648_10755362 3300026089 Bacteria 903
250 Ga0207676_10152463 3300026095 Bacteria 1992
251 Ga0207674_10000306 3300026116 Bacteria 62216
252 Ga0207674_10173949 3300026116 Bacteria 2106
253 Ga0207674_10502401 3300026116 Bacteria 1171
254 Ga0207675_100010607 3300026118 Bacteria 8629
255 Ga0207675_100563574 3300026118 Bacteria 1139
256 Ga0209588_1000952 3300027671 Bacteria 7398
257 Ga0209813_10141234 3300027866 Bacteria 855
258 Ga0268265_10003670 3300028380 Bacteria 10947
259 Ga0268264_10038337 3300028381 Bacteria 3955
260 Ga0265337_1040913 3300028556 Bacteria 1335
261 Ga0265338_10009595 3300028800 Bacteria 11504
262 Ga0265338_10454592 3300028800 Bacteria 906
263 Ga0265760_10019952 3300031090 Bacteria 1933
264 Ga0265327_10000402 3300031251 Bacteria 80983
265 Ga0307408_100032995 3300031548 Bacteria 3614
266 Ga0316576_10011200 3300031727 Bacteria 5863
267 Ga0316576_10058556 3300031727 Bacteria 2819
268 Ga0316576_10431940 3300031727 Bacteria 974
269 Ga0316578_10077451 3300031728 Bacteria 1974
270 Ga0307407_10005606 3300031903 Bacteria 5469
271 Ga0307407_10063635 3300031903 Bacteria 2165
272 Ga0307412_10027190 3300031911 Bacteria 3564
273 Ga0307416_100184177 3300032002 Bacteria 1961
274 Ga0307416_100193529 3300032002 Bacteria 1921
275 Ga0373948_0005769 3300034817 Bacteria 2020
276 Ga0373934_0034242 3300035086 Bacteria 1996
277 Ga0373940_0057617 3300035088 Bacteria 1104
278 Ga0373949_0050283 3300035090 Bacteria 1048
279 Ga0373951_0008323 3300035091 Bacteria 2345
280 Ga0373923_0014012 3300035111 Bacteria 3003
281 Ga0373923_0020697 3300035111 Bacteria 2559
282 Ga0373936_0165209 3300035113 Bacteria 966
283 Ga0373939_0021188 3300035114 Bacteria 1776
284 Ga0373941_0004881 3300035115 Bacteria 3126
285 Ga0373953_0070551 3300035117 Bacteria 1441
286 Ga0373954_0094685 3300035118 Bacteria 1437
287 Ga0373957_0082232 3300035120 Bacteria 1273
288 Ga0373943_0071610 3300035170 Bacteria 1757
289 Ga0373946_0014654 3300035171 Bacteria 2959
290 Ga0373955_0174843 3300035172 Bacteria 1272
291 Ga0373961_0002358 3300035241 Bacteria 4928
292 Ga0373962_0008549 3300035242 Bacteria 2521
293 Ga0316574_0032975 3300035398 Bacteria 3151
294 Ga0373924_0009511 3300035410 Bacteria 3564
295 Ga0373924_0012767 3300035410 Bacteria 3144
296 Ga0373931_0095536 3300035691 Bacteria 1663
297 Ga0373927_0262925 3300035695 Bacteria 1135
298 Ga0373927_0329737 3300035695 Bacteria 1005
299 Ga0373933_0024850 3300035724 Bacteria 3432
300 Ga0373937_0044781 3300036401 Bacteria 4042
301 Ga0373937_0093621 3300036401 Bacteria 2786
302 Ga0316584_0012965 3300036712 Bacteria 5890
303 Ga0373925_0012187 3300037068 Bacteria 6224
304 Ga0373925_0039472 3300037068 Bacteria 3492
305 Ga0373925_0315682 3300037068 Bacteria 1264
306 Ga0395899_0102020 3300037312 Bacteria 2070
307 Ga0395898_0096393 3300037466 Bacteria 2842
308 Ga0395898_0658260 3300037466 Bacteria 990
309 Ga0395905_0053364 3300037471 Bacteria 3783
310 Ga0436364_0149728 3300037853 Bacteria 1616
311 Ga0436364_0700812 3300037853 Bacteria 1981
312 Ga0436364_1396155 3300037853 Bacteria 2614
313 Ga0395901_0300327 3300038443 Bacteria 1665
314 Ga0400483_162612 3300039062 Bacteria 31721
315 Ga0436360_0365160 3300039438 Bacteria 1229
316 Ga0436360_1043819 3300039438 Bacteria 2809
317 Ga0436360_1253789 3300039438 Bacteria 993
318 Ga0436361_1133418 3300039447 Bacteria 5427
319 Ga0436363_0063999 3300039450 Bacteria 1116
320 Ga0436363_1495745 3300039450 Bacteria 1021
321 Ga0436362_1042850 3300039453 Bacteria 893
322 Ga0439461_0003225 3300041410 Bacteria 2672
323 Ga0439465_0012666 3300041413 Bacteria 2638
324 Ga0439465_0014267 3300041413 Bacteria 2477
325 Ga0439448_0019399 3300042005 Bacteria 2093
326 Ga0439449_0008350 3300042007 Bacteria 3938
327 Ga0439450_006251 3300042008 Bacteria 2137
328 Ga0450889_005015 3300042144 Bacteria 1312
329 Ga0439446_0011487 3300042156 Bacteria 2404
330 Ga0439434_0005119 3300042435 Bacteria 3836
331 Ga0439444_0005857 3300042437 Bacteria 1837
332 Ga0439459_0003228 3300042438 Bacteria 2569
333 Ga0439464_0007480 3300042439 Bacteria 2856
334 Ga0439460_0000701 3300042461 Bacteria 7454
335 Ga0439460_0031146 3300042461 Bacteria 1520
336 Ga0451577_0092204 3300042876 Bacteria 2705
337 Ga0451577_0114693 3300042876 Bacteria 2412
338 Ga0451577_0329779 3300042876 Bacteria 1384
339 Ga0453683_0013899 3300044673 Bacteria 5237
340 Ga0453684_0061871 3300044712 Bacteria 4801
341 Ga0453684_0325764 3300044712 Bacteria 1738
342 Ga0453684_0715734 3300044712 Bacteria 1087
343 Ga0451576_0056116 3300045051 Bacteria 4120
344 Ga0451576_0219841 3300045051 Bacteria 1983
345 Ga0451576_0262034 3300045051 Bacteria 1807
346 Ga0466958_0091451 3300045836 Bacteria 1884
347 Ga0495592_0171809 3300046454 Bacteria 1484
348 Ga0495651_0237985 3300046462 Bacteria 1250
349 Ga0495651_0417970 3300046462 Bacteria 872
350 Ga0495650_0069753 3300046471 Bacteria 1382
351 Ga0495580_0034739 3300046472 Bacteria 3628
352 Ga0495664_0006389 3300046477 Bacteria 6512
353 Ga0495608_0002977 3300046511 Bacteria 12113
354 Ga0495608_0034326 3300046511 Bacteria 3425
355 Ga0495652_0169226 3300046529 Bacteria 1688
356 Ga0495640_0048271 3300046533 Bacteria 2943
357 Ga0495640_0113205 3300046533 Bacteria 1771
358 Ga0495587_0249254 3300046536 Bacteria 998
359 Ga0495597_0000028 3300046542 Bacteria 137215
360 Ga0495645_0000478 3300046543 Bacteria 27655
361 Ga0495667_0020698 3300046559 Bacteria 4439
362 Ga0495599_0035562 3300046678 Bacteria 3127
363 Ga0495600_0047741 3300046809 Bacteria 2793
364 Ga0495636_0134249 3300047318 Bacteria 1102
365 Ga0495674_0064825 3300047319 Bacteria 3175
366 Ga0495674_0073827 3300047319 Bacteria 2939
367 Ga0495675_0003932 3300047444 Bacteria 9001
368 Ga0495684_0029112 3300047471 Bacteria 4239
369 Ga0495684_0414421 3300047471 Bacteria 943
370 Ga0495602_0001497 3300048088 Bacteria 23263
371 Ga0495602_0127663 3300048088 Bacteria 2034
372 Ga0496102_0032773 3300048905 Bacteria 4669
373 Ga0496106_0544086 3300048909 Bacteria 932
374 Ga0496107_0301477 3300048910 Bacteria 1193
375 Ga0496112_0056779 3300048915 Bacteria 3854
376 Ga0496119_0018323 3300048922 Bacteria 5222
377 Ga0501038_0101381 3300049574 Bacteria 2397
378 Ga0501040_0075021 3300049576 Bacteria 2337
379 Ga0501042_0057796 3300049578 Bacteria 2768
380 Ga0501046_0210631 3300049580 Bacteria 1443
381 Ga0501048_0570376 3300049582 Bacteria 812
382 Ga0501068_0113202 3300049584 Bacteria 1688
383 Ga0501071_0071383 3300049587 Bacteria 2531
384 Ga0501071_0411543 3300049587 Bacteria 1033
385 Ga0501072_0041603 3300049588 Bacteria 3610
386 Ga0501072_0275505 3300049588 Bacteria 1338
387 Ga0501075_0022010 3300049591 Bacteria 4654
388 Ga0501075_0024071 3300049591 Bacteria 4459
389 Ga0501075_0250069 3300049591 Bacteria 1351
390 Ga0501075_0320901 3300049591 Bacteria 1180
391 Ga0501076_0006750 3300049592 Bacteria 8329
392 Ga0501077_0012001 3300049593 Bacteria 5422
393 Ga0501077_0037049 3300049593 Bacteria 3107
394 Ga0501077_0174295 3300049593 Bacteria 1366
395 Ga0501079_0023873 3300049741 Bacteria 4691
396 Ga0501079_0026176 3300049741 Bacteria 4472
397 Ga0501080_0632796 3300049742 Bacteria 948
398 Ga0501081_0061560 3300049743 Bacteria 2602
399 Ga0501081_0145302 3300049743 Bacteria 1701
400 Ga0501081_0265888 3300049743 Bacteria 1254
401 nmdc:mga00v17_29366_c1 3300050491 Bacteria 3227
402 nmdc:mga0yw44_238611_c1 3300050492 Bacteria 1208
403 nmdc:mga06z11_5116_c1 3300050494 Bacteria 3120
404 nmdc:mga04h51_164617_c1 3300050495 Bacteria 855
405 nmdc:mga07m45_9291_c1 3300050496 Bacteria 5092
406 nmdc:mga05p37_128788_c1 3300050507 Bacteria 3107
407 nmdc:mga05p37_15169_c1 3300050507 Bacteria 9252
408 nmdc:mga05p37_175237_c1 3300050507 Bacteria 2613
409 nmdc:mga05p37_23681_c1 3300050507 Bacteria 7454
410 nmdc:mga05p37_70724_c1 3300050507 Bacteria 4292
411 nmdc:mga05p37_92760_c1 3300050507 Bacteria 3721
412 nmdc:mga05p37_99353_c1 3300050507 Bacteria 3584
413 nmdc:mga09592_14974_c1 3300050508 Bacteria 6335
414 nmdc:mga09592_31534_c1 3300050508 Bacteria 4417
415 nmdc:mga09592_61627_c1 3300050508 Bacteria 3173
416 nmdc:mga0qj67_100476_c1 3300050509 Bacteria 2332
417 nmdc:mga0qj67_12889_c1 3300050509 Bacteria 6308
418 nmdc:mga0qj67_235915_c1 3300050509 Bacteria 1484
419 nmdc:mga0qj67_2387_c1 3300050509 Bacteria 13380
420 nmdc:mga0qj67_39409_c1 3300050509 Bacteria 3710
421 nmdc:mga06r32_17872_c1 3300050510 Bacteria 6482
422 nmdc:mga06r32_33942_c1 3300050510 Bacteria 4809
423 nmdc:mga06r32_348225_c1 3300050510 Bacteria 1466
424 nmdc:mga06r32_428636_c1 3300050510 Bacteria 1303
425 nmdc:mga06r32_468909_c1 3300050510 Bacteria 1238
426 nmdc:mga06r32_538263_c1 3300050510 Bacteria 1143
427 nmdc:mga06r32_693_c1 3300050510 Bacteria 29366
428 nmdc:mga0n895_16764_c1 3300050512 Bacteria 6733
429 nmdc:mga0n895_467341_c1 3300050512 Bacteria 1273
430 nmdc:mga0n895_472094_c1 3300050512 Bacteria 1265
431 nmdc:mga0n895_53578_c1 3300050512 Bacteria 3964
432 nmdc:mga0n895_87294_c1 3300050512 Bacteria 3117
433 nmdc:mga0rr50_326363_c1 3300050513 Bacteria 1288
434 nmdc:mga0rr50_405060_c1 3300050513 Bacteria 1153
435 nmdc:mga08x19_167955_c1 3300050514 Bacteria 1493
436 nmdc:mga0a205_128_c1 3300050515 Bacteria 46647
437 nmdc:mga0a205_182443_c1 3300050515 Bacteria 1993
438 nmdc:mga0a205_305428_c1 3300050515 Bacteria 1464
439 nmdc:mga0a205_35617_c1 3300050515 Bacteria 4779
440 Ga0495601_0008121 3300053077 Bacteria 6189
441 Ga0495601_0212150 3300053077 Bacteria 1265
442 Ga0495612_0004257 3300053078 Bacteria 5943
443 Ga0500608_006441 3300053122 Bacteria 4779
444 Ga0500568_0054740 3300053139 Bacteria 1559
445 Ga0501084_0004982 3300054114 Bacteria 10865
446 Ga0501084_0028822 3300054114 Bacteria 4642
447 Ga0501084_0069294 3300054114 Bacteria 2953
448 Ga0501084_0152895 3300054114 Bacteria 1945
449 Ga0590074_027060 3300059423 Bacteria 1004
450 Ga0501082_0112031 3300060353 Bacteria 2362
451 Ga0501082_0277302 3300060353 Bacteria 1459
452 Ga0501082_0474801 3300060353 Bacteria 1093
453 Ga0530510_0025883 3300061734 Bacteria 4197
454 Ga0530510_0042453 3300061734 Bacteria 3286
455 Ga0530510_0078164 3300061734 Bacteria 2405

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100067786 Ga0070664_1000677862 225
2 3300005577 Ga0068857_100305180 Ga0068857_1003051802 225
3 3300025945 Ga0207679_10151364 Ga0207679_101513642 225
4 3300046529 Ga0495652_0169226 Ga0495652_0169226_968_1678 234
5 3300041410 Ga0439461_0003225 Ga0439461_0003225_553_1341 235
6 3300041413 Ga0439465_0012666 Ga0439465_0012666_986_1774 235
7 3300042156 Ga0439446_0011487 Ga0439446_0011487_528_1316 235
8 3300042435 Ga0439434_0005119 Ga0439434_0005119_986_1774 235
9 3300031911 Ga0307412_10027190 Ga0307412_100271902 236
10 3300059423 Ga0590074_027060 Ga0590074_027060_14_817 242
11 iso_pu_bacteria 2858688981 2858691720 246
12 3300037466 Ga0395898_0096393 Ga0395898_0096393_280_1026 248
13 iso_pu_bacteria 2885409591 2885414358 248
14 iso_pu_bacteria 2996310559 2996312421 248
15 3300005468 Ga0070707_100454197 Ga0070707_1004541972 251
16 3300005518 Ga0070699_100218605 Ga0070699_1002186052 251
17 3300006844 Ga0075428_100525299 Ga0075428_1005252992 251
18 3300025910 Ga0207684_10313861 Ga0207684_103138612 251
19 3300025922 Ga0207646_10416961 Ga0207646_104169611 251
20 3300050510 nmdc:mga06r32_348225_c1 nmdc:mga06r32_348225_c1_515_1384 251
21 2162886007 SwRhRL2b_contig_2460877 SwRhRL2b_0725.00002240 252
22 3300005289 Ga0065704_10071856 Ga0065704_100718565 252
23 3300005289 Ga0065704_10213959 Ga0065704_102139591 252
24 3300005293 Ga0065715_10107448 Ga0065715_101074483 252
25 3300005328 Ga0070676_10000918 Ga0070676_100009186 252
26 3300005331 Ga0070670_100002798 Ga0070670_10000279811 252
27 3300005334 Ga0068869_100001909 Ga0068869_1000019098 252
28 3300005334 Ga0068869_100021072 Ga0068869_1000210722 252
29 3300005335 Ga0070666_10052674 Ga0070666_100526741 252
30 3300005336 Ga0070680_100000266 Ga0070680_10000026631 252
31 3300005336 Ga0070680_100070977 Ga0070680_1000709772 252
32 3300005337 Ga0070682_100000518 Ga0070682_10000051821 252
33 3300005339 Ga0070660_100001036 Ga0070660_10000103617 252
34 3300005341 Ga0070691_10243992 Ga0070691_102439921 252
35 3300005343 Ga0070687_100124957 Ga0070687_1001249571 252
36 3300005344 Ga0070661_100000703 Ga0070661_10000070316 252
37 3300005345 Ga0070692_10000029 Ga0070692_1000002911 252
38 3300005353 Ga0070669_100033343 Ga0070669_1000333434 252
39 3300005354 Ga0070675_100199888 Ga0070675_1001998882 252
40 3300005366 Ga0070659_100003576 Ga0070659_1000035764 252
41 3300005367 Ga0070667_100304386 Ga0070667_1003043862 252
42 3300005434 Ga0070709_10076733 Ga0070709_100767333 252
43 3300005434 Ga0070709_10137953 Ga0070709_101379532 252
44 3300005435 Ga0070714_100043666 Ga0070714_1000436662 252
45 3300005436 Ga0070713_100022797 Ga0070713_1000227974 252
46 3300005436 Ga0070713_100029565 Ga0070713_1000295651 252
47 3300005436 Ga0070713_100054736 Ga0070713_1000547362 252
48 3300005436 Ga0070713_100266995 Ga0070713_1002669951 252
49 3300005437 Ga0070710_10009071 Ga0070710_100090714 252
50 3300005438 Ga0070701_10267761 Ga0070701_102677612 252
51 3300005439 Ga0070711_100048336 Ga0070711_1000483362 252
52 3300005440 Ga0070705_100000602 Ga0070705_1000006024 252
53 3300005440 Ga0070705_100059547 Ga0070705_1000595472 252
54 3300005441 Ga0070700_100109628 Ga0070700_1001096282 252
55 3300005444 Ga0070694_100000833 Ga0070694_10000083316 252
56 3300005444 Ga0070694_100347246 Ga0070694_1003472462 252
57 3300005445 Ga0070708_100019168 Ga0070708_1000191682 252
58 3300005445 Ga0070708_100032641 Ga0070708_1000326412 252
59 3300005445 Ga0070708_100084512 Ga0070708_1000845122 252
60 3300005445 Ga0070708_100145312 Ga0070708_1001453122 252
61 3300005445 Ga0070708_100176843 Ga0070708_1001768433 252
62 3300005445 Ga0070708_100505675 Ga0070708_1005056751 252
63 3300005455 Ga0070663_100000911 Ga0070663_1000009112 252
64 3300005457 Ga0070662_100051947 Ga0070662_1000519473 252
65 3300005458 Ga0070681_10023799 Ga0070681_100237995 252
66 3300005459 Ga0068867_100001309 Ga0068867_1000013094 252
67 3300005459 Ga0068867_100201090 Ga0068867_1002010902 252
68 3300005467 Ga0070706_100012087 Ga0070706_1000120873 252
69 3300005467 Ga0070706_100080975 Ga0070706_1000809753 252
70 3300005468 Ga0070707_100041886 Ga0070707_1000418864 252
71 3300005468 Ga0070707_100128223 Ga0070707_1001282232 252
72 3300005468 Ga0070707_100192565 Ga0070707_1001925652 252
73 3300005471 Ga0070698_100002225 Ga0070698_1000022256 252
74 3300005471 Ga0070698_100058110 Ga0070698_1000581103 252
75 3300005518 Ga0070699_100001487 Ga0070699_1000014874 252
76 3300005518 Ga0070699_100175058 Ga0070699_1001750582 252
77 3300005530 Ga0070679_100002143 Ga0070679_1000021434 252
78 3300005530 Ga0070679_100027768 Ga0070679_1000277684 252
79 3300005535 Ga0070684_100678853 Ga0070684_1006788531 252
80 3300005536 Ga0070697_100087970 Ga0070697_1000879702 252
81 3300005536 Ga0070697_100356689 Ga0070697_1003566892 252
82 3300005539 Ga0068853_100000808 Ga0068853_10000080818 252
83 3300005539 Ga0068853_100732986 Ga0068853_1007329861 252
84 3300005543 Ga0070672_100030387 Ga0070672_1000303873 252
85 3300005545 Ga0070695_100006415 Ga0070695_1000064153 252
86 3300005545 Ga0070695_100012294 Ga0070695_1000122942 252
87 3300005545 Ga0070695_100204735 Ga0070695_1002047352 252
88 3300005546 Ga0070696_100001094 Ga0070696_1000010944 252
89 3300005547 Ga0070693_100000045 Ga0070693_10000004539 252
90 3300005547 Ga0070693_100258260 Ga0070693_1002582602 252
91 3300005549 Ga0070704_100000240 Ga0070704_10000024012 252
92 3300005563 Ga0068855_100000462 Ga0068855_10000046232 252
93 3300005564 Ga0070664_100002902 Ga0070664_1000029025 252
94 3300005577 Ga0068857_100008050 Ga0068857_1000080506 252
95 3300005578 Ga0068854_100007822 Ga0068854_1000078224 252
96 3300005614 Ga0068856_100002716 Ga0068856_1000027166 252
97 3300005614 Ga0068856_100171541 Ga0068856_1001715412 252
98 3300005615 Ga0070702_100056816 Ga0070702_1000568162 252
99 3300005617 Ga0068859_100002495 Ga0068859_1000024954 252
100 3300005617 Ga0068859_100102443 Ga0068859_1001024433 252
101 3300005618 Ga0068864_100001334 Ga0068864_1000013344 252
102 3300005719 Ga0068861_100009309 Ga0068861_1000093093 252
103 3300005719 Ga0068861_100077458 Ga0068861_1000774583 252
104 3300005840 Ga0068870_10000934 Ga0068870_100009348 252
105 3300005840 Ga0068870_10171846 Ga0068870_101718462 252
106 3300005841 Ga0068863_100122956 Ga0068863_1001229563 252
107 3300005841 Ga0068863_100282447 Ga0068863_1002824472 252
108 3300005842 Ga0068858_100020465 Ga0068858_1000204654 252
109 3300005842 Ga0068858_100401690 Ga0068858_1004016902 252
110 3300005844 Ga0068862_100002748 Ga0068862_1000027484 252
111 3300005844 Ga0068862_100158726 Ga0068862_1001587262 252
112 3300005937 Ga0081455_10000074 Ga0081455_1000007466 252
113 3300005937 Ga0081455_10022128 Ga0081455_100221282 252
114 3300005981 Ga0081538_10056629 Ga0081538_100566292 252
115 3300005983 Ga0081540_1005226 Ga0081540_10052266 252
116 3300006028 Ga0070717_10089316 Ga0070717_100893162 252
117 3300006028 Ga0070717_10107858 Ga0070717_101078583 252
118 3300006038 Ga0075365_10268910 Ga0075365_102689102 252
119 3300006042 Ga0075368_10040874 Ga0075368_100408742 252
120 3300006042 Ga0075368_10057408 Ga0075368_100574082 252
121 3300006051 Ga0075364_10017964 Ga0075364_100179642 252
122 3300006173 Ga0070716_100038839 Ga0070716_1000388392 252
123 3300006175 Ga0070712_100001675 Ga0070712_1000016755 252
124 3300006175 Ga0070712_100011814 Ga0070712_1000118143 252
125 3300006178 Ga0075367_10032834 Ga0075367_100328343 252
126 3300006178 Ga0075367_10050194 Ga0075367_100501943 252
127 3300006178 Ga0075367_10213776 Ga0075367_102137762 252
128 3300006237 Ga0097621_100283101 Ga0097621_1002831012 252
129 3300006237 Ga0097621_100303853 Ga0097621_1003038532 252
130 3300006844 Ga0075428_100000509 Ga0075428_1000005098 252
131 3300006844 Ga0075428_100013632 Ga0075428_1000136322 252
132 3300006844 Ga0075428_100026860 Ga0075428_1000268603 252
133 3300006844 Ga0075428_100098801 Ga0075428_1000988012 252
134 3300006846 Ga0075430_100001087 Ga0075430_1000010871 252
135 3300006846 Ga0075430_100003590 Ga0075430_10000359011 252
136 3300006846 Ga0075430_100022035 Ga0075430_1000220354 252
137 3300006846 Ga0075430_100123259 Ga0075430_1001232592 252
138 3300006847 Ga0075431_100001593 Ga0075431_1000015939 252
139 3300006847 Ga0075431_100002162 Ga0075431_10000216219 252
140 3300006847 Ga0075431_100006591 Ga0075431_1000065913 252
141 3300006847 Ga0075431_100008769 Ga0075431_1000087693 252
142 3300006847 Ga0075431_100008892 Ga0075431_1000088929 252
143 3300006847 Ga0075431_100549282 Ga0075431_1005492822 252
144 3300006852 Ga0075433_10002867 Ga0075433_100028678 252
145 3300006852 Ga0075433_10006931 Ga0075433_100069316 252
146 3300006852 Ga0075433_10009404 Ga0075433_100094043 252
147 3300006852 Ga0075433_10014523 Ga0075433_100145236 252
148 3300006852 Ga0075433_10024429 Ga0075433_100244293 252
149 3300006852 Ga0075433_10270788 Ga0075433_102707882 252
150 3300006871 Ga0075434_100025615 Ga0075434_1000256152 252
151 3300006871 Ga0075434_100056781 Ga0075434_1000567814 252
152 3300006871 Ga0075434_100208246 Ga0075434_1002082462 252
153 3300006880 Ga0075429_100016643 Ga0075429_1000166435 252
154 3300006880 Ga0075429_100032538 Ga0075429_1000325385 252
155 3300006880 Ga0075429_100035877 Ga0075429_1000358774 252
156 3300006880 Ga0075429_100067385 Ga0075429_1000673852 252
157 3300006881 Ga0068865_100428835 Ga0068865_1004288352 252
158 3300006914 Ga0075436_100046510 Ga0075436_1000465102 252
159 3300006931 Ga0097620_100002495 Ga0097620_10000249514 252
160 3300006931 Ga0097620_100102445 Ga0097620_1001024453 252
161 3300006931 Ga0097620_100149385 Ga0097620_1001493852 252
162 3300007076 Ga0075435_100001922 Ga0075435_10000192212 252
163 3300007076 Ga0075435_100012226 Ga0075435_1000122262 252
164 3300007265 Ga0099794_10001445 Ga0099794_100014455 252
165 3300009093 Ga0105240_10242374 Ga0105240_102423742 252
166 3300009093 Ga0105240_10250558 Ga0105240_102505582 252
167 3300009093 Ga0105240_10350754 Ga0105240_103507541 252
168 3300009098 Ga0105245_10020215 Ga0105245_100202153 252
169 3300009098 Ga0105245_10052690 Ga0105245_100526903 252
170 3300009098 Ga0105245_10812770 Ga0105245_108127701 252
171 3300009147 Ga0114129_10008686 Ga0114129_100086866 252
172 3300009147 Ga0114129_10017939 Ga0114129_100179393 252
173 3300009147 Ga0114129_10036423 Ga0114129_100364233 252
174 3300009147 Ga0114129_10043638 Ga0114129_100436384 252
175 3300009147 Ga0114129_10094036 Ga0114129_100940363 252
176 3300009147 Ga0114129_10096583 Ga0114129_100965832 252
177 3300009147 Ga0114129_10269811 Ga0114129_102698113 252
178 3300009147 Ga0114129_10279334 Ga0114129_102793342 252
179 3300009147 Ga0114129_10283680 Ga0114129_102836802 252
180 3300009147 Ga0114129_10377051 Ga0114129_103770512 252
181 3300009545 Ga0105237_10036167 Ga0105237_100361672 252
182 3300009551 Ga0105238_10018342 Ga0105238_100183423 252
183 3300009551 Ga0105238_10536495 Ga0105238_105364952 252
184 3300011119 Ga0105246_10015068 Ga0105246_100150685 252
185 3300011119 Ga0105246_10156571 Ga0105246_101565712 252
186 3300013100 Ga0157373_10000379 Ga0157373_1000037916 252
187 3300013105 Ga0157369_10062088 Ga0157369_100620883 252
188 3300013296 Ga0157374_10193562 Ga0157374_101935623 252
189 3300013296 Ga0157374_10292539 Ga0157374_102925392 252
190 3300013307 Ga0157372_10000135 Ga0157372_1000013521 252
191 3300014325 Ga0163163_10114249 Ga0163163_101142493 252
192 3300014325 Ga0163163_10687182 Ga0163163_106871822 252
193 3300014326 Ga0157380_10182830 Ga0157380_101828302 252
194 3300014497 Ga0182008_10016024 Ga0182008_100160244 252
195 3300014969 Ga0157376_10479090 Ga0157376_104790902 252
196 3300021384 Ga0213876_10097826 Ga0213876_100978262 252
197 3300021441 Ga0213871_10008081 Ga0213871_100080813 252
198 3300025885 Ga0207653_10016807 Ga0207653_100168072 252
199 3300025885 Ga0207653_10028196 Ga0207653_100281962 252
200 3300025898 Ga0207692_10053494 Ga0207692_100534942 252
201 3300025904 Ga0207647_10046585 Ga0207647_100465853 252
202 3300025906 Ga0207699_10032695 Ga0207699_100326953 252
203 3300025906 Ga0207699_10257252 Ga0207699_102572522 252
204 3300025907 Ga0207645_10000075 Ga0207645_100000753 252
205 3300025907 Ga0207645_10300910 Ga0207645_103009102 252
206 3300025908 Ga0207643_10000146 Ga0207643_100001464 252
207 3300025910 Ga0207684_10001638 Ga0207684_1000163810 252
208 3300025910 Ga0207684_10008109 Ga0207684_100081094 252
209 3300025910 Ga0207684_10029205 Ga0207684_100292054 252
210 3300025910 Ga0207684_10090431 Ga0207684_100904313 252
211 3300025912 Ga0207707_10000135 Ga0207707_1000013517 252
212 3300025912 Ga0207707_10213425 Ga0207707_102134251 252
213 3300025912 Ga0207707_10695795 Ga0207707_106957951 252
214 3300025914 Ga0207671_10090230 Ga0207671_100902302 252
215 3300025915 Ga0207693_10006864 Ga0207693_100068644 252
216 3300025915 Ga0207693_10014327 Ga0207693_100143274 252
217 3300025916 Ga0207663_10092953 Ga0207663_100929532 252
218 3300025916 Ga0207663_10352981 Ga0207663_103529811 252
219 3300025917 Ga0207660_10002799 Ga0207660_100027994 252
220 3300025917 Ga0207660_10129708 Ga0207660_101297082 252
221 3300025918 Ga0207662_10039973 Ga0207662_100399732 252
222 3300025919 Ga0207657_10000037 Ga0207657_1000003773 252
223 3300025920 Ga0207649_10029197 Ga0207649_100291974 252
224 3300025921 Ga0207652_10001525 Ga0207652_100015257 252
225 3300025922 Ga0207646_10001729 Ga0207646_1000172918 252
226 3300025922 Ga0207646_10053456 Ga0207646_100534562 252
227 3300025922 Ga0207646_10177431 Ga0207646_101774312 252
228 3300025922 Ga0207646_10305953 Ga0207646_103059531 252
229 3300025923 Ga0207681_10086853 Ga0207681_100868532 252
230 3300025923 Ga0207681_10432289 Ga0207681_104322892 252
231 3300025927 Ga0207687_10098741 Ga0207687_100987412 252
232 3300025927 Ga0207687_10149773 Ga0207687_101497732 252
233 3300025928 Ga0207700_10044370 Ga0207700_100443703 252
234 3300025928 Ga0207700_10055837 Ga0207700_100558371 252
235 3300025928 Ga0207700_10097002 Ga0207700_100970022 252
236 3300025929 Ga0207664_10121244 Ga0207664_101212442 252
237 3300025935 Ga0207709_10042272 Ga0207709_100422723 252
238 3300025939 Ga0207665_10000576 Ga0207665_100005764 252
239 3300025940 Ga0207691_10235348 Ga0207691_102353482 252
240 3300025942 Ga0207689_10000029 Ga0207689_1000002947 252
241 3300025942 Ga0207689_10039823 Ga0207689_100398233 252
242 3300025945 Ga0207679_10002294 Ga0207679_100022944 252
243 3300025949 Ga0207667_10000652 Ga0207667_1000065215 252
244 3300025986 Ga0207658_10255809 Ga0207658_102558091 252
245 3300026035 Ga0207703_10053517 Ga0207703_100535173 252
246 3300026035 Ga0207703_10517025 Ga0207703_105170252 252
247 3300026041 Ga0207639_10004221 Ga0207639_100042216 252
248 3300026067 Ga0207678_10005618 Ga0207678_100056184 252
249 3300026075 Ga0207708_10101271 Ga0207708_101012712 252
250 3300026075 Ga0207708_10140164 Ga0207708_101401642 252
251 3300026078 Ga0207702_10007290 Ga0207702_100072904 252
252 3300026078 Ga0207702_10026562 Ga0207702_100265622 252
253 3300026078 Ga0207702_10131942 Ga0207702_101319422 252
254 3300026078 Ga0207702_10148617 Ga0207702_101486173 252
255 3300026078 Ga0207702_10395325 Ga0207702_103953252 252
256 3300026088 Ga0207641_10017579 Ga0207641_100175795 252
257 3300026088 Ga0207641_10117997 Ga0207641_101179972 252
258 3300026088 Ga0207641_10207381 Ga0207641_102073812 252
259 3300026089 Ga0207648_10000552 Ga0207648_1000055210 252
260 3300026089 Ga0207648_10181539 Ga0207648_101815392 252
261 3300026089 Ga0207648_10755362 Ga0207648_107553621 252
262 3300026095 Ga0207676_10152463 Ga0207676_101524632 252
263 3300026116 Ga0207674_10000306 Ga0207674_1000030632 252
264 3300026116 Ga0207674_10173949 Ga0207674_101739492 252
265 3300026116 Ga0207674_10502401 Ga0207674_105024012 252
266 3300026118 Ga0207675_100010607 Ga0207675_1000106074 252
267 3300026118 Ga0207675_100563574 Ga0207675_1005635742 252
268 3300027671 Ga0209588_1000952 Ga0209588_10009525 252
269 3300027866 Ga0209813_10141234 Ga0209813_101412341 252
270 3300028380 Ga0268265_10003670 Ga0268265_1000367011 252
271 3300028381 Ga0268264_10038337 Ga0268264_100383372 252
272 3300028556 Ga0265337_1040913 Ga0265337_10409132 252
273 3300028800 Ga0265338_10009595 Ga0265338_100095954 252
274 3300028800 Ga0265338_10454592 Ga0265338_104545921 252
275 3300031090 Ga0265760_10019952 Ga0265760_100199521 252
276 3300031251 Ga0265327_10000402 Ga0265327_1000040229 252
277 3300031548 Ga0307408_100032995 Ga0307408_1000329951 252
278 3300031727 Ga0316576_10011200 Ga0316576_100112003 252
279 3300031727 Ga0316576_10058556 Ga0316576_100585563 252
280 3300031727 Ga0316576_10431940 Ga0316576_104319401 252
281 3300031728 Ga0316578_10077451 Ga0316578_100774511 252
282 3300031903 Ga0307407_10005606 Ga0307407_100056065 252
283 3300031903 Ga0307407_10063635 Ga0307407_100636352 252
284 3300032002 Ga0307416_100184177 Ga0307416_1001841772 252
285 3300032002 Ga0307416_100193529 Ga0307416_1001935293 252
286 3300034817 Ga0373948_0005769 Ga0373948_0005769_949_1707 252
287 3300035086 Ga0373934_0034242 Ga0373934_0034242_1092_1856 252
288 3300035088 Ga0373940_0057617 Ga0373940_0057617_266_1027 252
289 3300035090 Ga0373949_0050283 Ga0373949_0050283_237_995 252
290 3300035091 Ga0373951_0008323 Ga0373951_0008323_421_1179 252
291 3300035111 Ga0373923_0014012 Ga0373923_0014012_429_1193 252
292 3300035111 Ga0373923_0020697 Ga0373923_0020697_1105_1869 252
293 3300035113 Ga0373936_0165209 Ga0373936_0165209_111_875 252
294 3300035114 Ga0373939_0021188 Ga0373939_0021188_727_1485 252
295 3300035115 Ga0373941_0004881 Ga0373941_0004881_416_1174 252
296 3300035117 Ga0373953_0070551 Ga0373953_0070551_256_1020 252
297 3300035118 Ga0373954_0094685 Ga0373954_0094685_28_792 252
298 3300035120 Ga0373957_0082232 Ga0373957_0082232_156_920 252
299 3300035170 Ga0373943_0071610 Ga0373943_0071610_484_1248 252
300 3300035171 Ga0373946_0014654 Ga0373946_0014654_64_828 252
301 3300035172 Ga0373955_0174843 Ga0373955_0174843_102_866 252
302 3300035241 Ga0373961_0002358 Ga0373961_0002358_1639_2397 252
303 3300035242 Ga0373962_0008549 Ga0373962_0008549_1260_2018 252
304 3300035398 Ga0316574_0032975 Ga0316574_0032975_73_864 252
305 3300035410 Ga0373924_0009511 Ga0373924_0009511_275_1039 252
306 3300035410 Ga0373924_0012767 Ga0373924_0012767_1915_2679 252
307 3300035691 Ga0373931_0095536 Ga0373931_0095536_295_1053 252
308 3300035695 Ga0373927_0262925 Ga0373927_0262925_290_1054 252
309 3300035695 Ga0373927_0329737 Ga0373927_0329737_35_799 252
310 3300035724 Ga0373933_0024850 Ga0373933_0024850_1995_2759 252
311 3300036401 Ga0373937_0044781 Ga0373937_0044781_1247_2011 252
312 3300036401 Ga0373937_0093621 Ga0373937_0093621_1020_1784 252
313 3300036712 Ga0316584_0012965 Ga0316584_0012965_1781_2572 252
314 3300037068 Ga0373925_0012187 Ga0373925_0012187_4662_5426 252
315 3300037068 Ga0373925_0039472 Ga0373925_0039472_129_893 252
316 3300037068 Ga0373925_0315682 Ga0373925_0315682_131_895 252
317 3300037312 Ga0395899_0102020 Ga0395899_0102020_259_1017 252
318 3300037466 Ga0395898_0658260 Ga0395898_0658260_214_972 252
319 3300037471 Ga0395905_0053364 Ga0395905_0053364_2004_2762 252
320 3300037853 Ga0436364_0149728 Ga0436364_0149728_193_960 252
321 3300037853 Ga0436364_0700812 Ga0436364_0700812_449_1213 252
322 3300037853 Ga0436364_1396155 Ga0436364_1396155_1835_2599 252
323 3300038443 Ga0395901_0300327 Ga0395901_0300327_103_861 252
324 3300039062 Ga0400483_162612 Ga0400483_162612_18989_19762 252
325 3300039438 Ga0436360_0365160 Ga0436360_0365160_158_916 252
326 3300039438 Ga0436360_1043819 Ga0436360_1043819_1432_2199 252
327 3300039438 Ga0436360_1253789 Ga0436360_1253789_78_842 252
328 3300039447 Ga0436361_1133418 Ga0436361_1133418_2146_2922 252
329 3300039450 Ga0436363_0063999 Ga0436363_0063999_17_784 252
330 3300039450 Ga0436363_1495745 Ga0436363_1495745_226_990 252
331 3300039453 Ga0436362_1042850 Ga0436362_1042850_54_821 252
332 3300041413 Ga0439465_0014267 Ga0439465_0014267_22_786 252
333 3300042005 Ga0439448_0019399 Ga0439448_0019399_69_827 252
334 3300042007 Ga0439449_0008350 Ga0439449_0008350_1175_1978 252
335 3300042008 Ga0439450_006251 Ga0439450_006251_1150_1908 252
336 3300042144 Ga0450889_005015 Ga0450889_005015_64_822 252
337 3300042437 Ga0439444_0005857 Ga0439444_0005857_418_1176 252
338 3300042438 Ga0439459_0003228 Ga0439459_0003228_138_896 252
339 3300042439 Ga0439464_0007480 Ga0439464_0007480_1707_2465 252
340 3300042461 Ga0439460_0000701 Ga0439460_0000701_2898_3656 252
341 3300042461 Ga0439460_0031146 Ga0439460_0031146_134_892 252
342 3300042876 Ga0451577_0092204 Ga0451577_0092204_1920_2681 252
343 3300042876 Ga0451577_0114693 Ga0451577_0114693_443_1201 252
344 3300042876 Ga0451577_0329779 Ga0451577_0329779_58_837 252
345 3300044673 Ga0453683_0013899 Ga0453683_0013899_3896_4654 252
346 3300044712 Ga0453684_0061871 Ga0453684_0061871_3155_3913 252
347 3300044712 Ga0453684_0325764 Ga0453684_0325764_125_904 252
348 3300044712 Ga0453684_0715734 Ga0453684_0715734_30_824 252
349 3300045051 Ga0451576_0056116 Ga0451576_0056116_1287_2045 252
350 3300045051 Ga0451576_0219841 Ga0451576_0219841_543_1301 252
351 3300045051 Ga0451576_0262034 Ga0451576_0262034_271_1029 252
352 3300045836 Ga0466958_0091451 Ga0466958_0091451_994_1758 252
353 3300046454 Ga0495592_0171809 Ga0495592_0171809_536_1300 252
354 3300046462 Ga0495651_0237985 Ga0495651_0237985_158_922 252
355 3300046462 Ga0495651_0417970 Ga0495651_0417970_98_862 252
356 3300046471 Ga0495650_0069753 Ga0495650_0069753_466_1230 252
357 3300046472 Ga0495580_0034739 Ga0495580_0034739_2010_2768 252
358 3300046477 Ga0495664_0006389 Ga0495664_0006389_3057_3821 252
359 3300046511 Ga0495608_0002977 Ga0495608_0002977_10419_11183 252
360 3300046511 Ga0495608_0034326 Ga0495608_0034326_1536_2300 252
361 3300046533 Ga0495640_0048271 Ga0495640_0048271_180_956 252
362 3300046533 Ga0495640_0113205 Ga0495640_0113205_76_840 252
363 3300046536 Ga0495587_0249254 Ga0495587_0249254_129_893 252
364 3300046542 Ga0495597_0000028 Ga0495597_0000028_84162_84941 252
365 3300046543 Ga0495645_0000478 Ga0495645_0000478_25789_26553 252
366 3300046559 Ga0495667_0020698 Ga0495667_0020698_1980_2744 252
367 3300046678 Ga0495599_0035562 Ga0495599_0035562_2041_2805 252
368 3300046809 Ga0495600_0047741 Ga0495600_0047741_1109_1873 252
369 3300047318 Ga0495636_0134249 Ga0495636_0134249_184_942 252
370 3300047319 Ga0495674_0064825 Ga0495674_0064825_1997_2761 252
371 3300047319 Ga0495674_0073827 Ga0495674_0073827_1924_2754 252
372 3300047444 Ga0495675_0003932 Ga0495675_0003932_2677_3441 252
373 3300047471 Ga0495684_0029112 Ga0495684_0029112_583_1359 252
374 3300047471 Ga0495684_0414421 Ga0495684_0414421_50_910 252
375 3300048088 Ga0495602_0001497 Ga0495602_0001497_9308_10072 252
376 3300048088 Ga0495602_0127663 Ga0495602_0127663_1005_1775 252
377 3300048905 Ga0496102_0032773 Ga0496102_0032773_1790_2548 252
378 3300048909 Ga0496106_0544086 Ga0496106_0544086_34_792 252
379 3300048910 Ga0496107_0301477 Ga0496107_0301477_381_1139 252
380 3300048915 Ga0496112_0056779 Ga0496112_0056779_593_1351 252
381 3300048922 Ga0496119_0018323 Ga0496119_0018323_4053_4823 252
382 3300049574 Ga0501038_0101381 Ga0501038_0101381_1331_2089 252
383 3300049576 Ga0501040_0075021 Ga0501040_0075021_302_1060 252
384 3300049578 Ga0501042_0057796 Ga0501042_0057796_441_1199 252
385 3300049580 Ga0501046_0210631 Ga0501046_0210631_346_1104 252
386 3300049582 Ga0501048_0570376 Ga0501048_0570376_10_768 252
387 3300049584 Ga0501068_0113202 Ga0501068_0113202_731_1489 252
388 3300049587 Ga0501071_0071383 Ga0501071_0071383_1202_1960 252
389 3300049587 Ga0501071_0411543 Ga0501071_0411543_250_1008 252
390 3300049588 Ga0501072_0041603 Ga0501072_0041603_1173_1931 252
391 3300049588 Ga0501072_0275505 Ga0501072_0275505_132_890 252
392 3300049591 Ga0501075_0022010 Ga0501075_0022010_2329_3087 252
393 3300049591 Ga0501075_0024071 Ga0501075_0024071_1457_2215 252
394 3300049591 Ga0501075_0250069 Ga0501075_0250069_139_897 252
395 3300049591 Ga0501075_0320901 Ga0501075_0320901_175_933 252
396 3300049592 Ga0501076_0006750 Ga0501076_0006750_6683_7441 252
397 3300049593 Ga0501077_0012001 Ga0501077_0012001_2419_3177 252
398 3300049593 Ga0501077_0037049 Ga0501077_0037049_1998_2756 252
399 3300049593 Ga0501077_0174295 Ga0501077_0174295_445_1203 252
400 3300049741 Ga0501079_0023873 Ga0501079_0023873_3790_4548 252
401 3300049741 Ga0501079_0026176 Ga0501079_0026176_364_1122 252
402 3300049742 Ga0501080_0632796 Ga0501080_0632796_168_926 252
403 3300049743 Ga0501081_0061560 Ga0501081_0061560_346_1104 252
404 3300049743 Ga0501081_0145302 Ga0501081_0145302_481_1239 252
405 3300049743 Ga0501081_0265888 Ga0501081_0265888_481_1239 252
406 3300050491 nmdc:mga00v17_29366_c1 nmdc:mga00v17_29366_c1_1843_2607 252
407 3300050492 nmdc:mga0yw44_238611_c1 nmdc:mga0yw44_238611_c1_289_1053 252
408 3300050494 nmdc:mga06z11_5116_c1 nmdc:mga06z11_5116_c1_1640_2404 252
409 3300050495 nmdc:mga04h51_164617_c1 nmdc:mga04h51_164617_c1_56_820 252
410 3300050496 nmdc:mga07m45_9291_c1 nmdc:mga07m45_9291_c1_1041_1805 252
411 3300050507 nmdc:mga05p37_128788_c1 nmdc:mga05p37_128788_c1_849_1607 252
412 3300050507 nmdc:mga05p37_15169_c1 nmdc:mga05p37_15169_c1_8109_8867 252
413 3300050507 nmdc:mga05p37_175237_c1 nmdc:mga05p37_175237_c1_1703_2461 252
414 3300050507 nmdc:mga05p37_23681_c1 nmdc:mga05p37_23681_c1_3048_3806 252
415 3300050507 nmdc:mga05p37_70724_c1 nmdc:mga05p37_70724_c1_589_1359 252
416 3300050507 nmdc:mga05p37_92760_c1 nmdc:mga05p37_92760_c1_1238_1996 252
417 3300050507 nmdc:mga05p37_99353_c1 nmdc:mga05p37_99353_c1_503_1261 252
418 3300050508 nmdc:mga09592_14974_c1 nmdc:mga09592_14974_c1_3641_4399 252
419 3300050508 nmdc:mga09592_31534_c1 nmdc:mga09592_31534_c1_189_959 252
420 3300050508 nmdc:mga09592_61627_c1 nmdc:mga09592_61627_c1_1462_2220 252
421 3300050509 nmdc:mga0qj67_100476_c1 nmdc:mga0qj67_100476_c1_664_1443 252
422 3300050509 nmdc:mga0qj67_12889_c1 nmdc:mga0qj67_12889_c1_4890_5669 252
423 3300050509 nmdc:mga0qj67_235915_c1 nmdc:mga0qj67_235915_c1_187_945 252
424 3300050509 nmdc:mga0qj67_2387_c1 nmdc:mga0qj67_2387_c1_11783_12541 252
425 3300050509 nmdc:mga0qj67_39409_c1 nmdc:mga0qj67_39409_c1_1380_2138 252
426 3300050510 nmdc:mga06r32_17872_c1 nmdc:mga06r32_17872_c1_3478_4236 252
427 3300050510 nmdc:mga06r32_33942_c1 nmdc:mga06r32_33942_c1_157_915 252
428 3300050510 nmdc:mga06r32_428636_c1 nmdc:mga06r32_428636_c1_506_1264 252
429 3300050510 nmdc:mga06r32_468909_c1 nmdc:mga06r32_468909_c1_52_822 252
430 3300050510 nmdc:mga06r32_538263_c1 nmdc:mga06r32_538263_c1_255_1022 252
431 3300050510 nmdc:mga06r32_693_c1 nmdc:mga06r32_693_c1_19960_20718 252
432 3300050512 nmdc:mga0n895_16764_c1 nmdc:mga0n895_16764_c1_4363_5121 252
433 3300050512 nmdc:mga0n895_467341_c1 nmdc:mga0n895_467341_c1_155_913 252
434 3300050512 nmdc:mga0n895_472094_c1 nmdc:mga0n895_472094_c1_336_1094 252
435 3300050512 nmdc:mga0n895_53578_c1 nmdc:mga0n895_53578_c1_997_1755 252
436 3300050512 nmdc:mga0n895_87294_c1 nmdc:mga0n895_87294_c1_2297_3055 252
437 3300050513 nmdc:mga0rr50_326363_c1 nmdc:mga0rr50_326363_c1_468_1226 252
438 3300050513 nmdc:mga0rr50_405060_c1 nmdc:mga0rr50_405060_c1_272_1030 252
439 3300050514 nmdc:mga08x19_167955_c1 nmdc:mga08x19_167955_c1_320_1078 252
440 3300050515 nmdc:mga0a205_128_c1 nmdc:mga0a205_128_c1_27015_27773 252
441 3300050515 nmdc:mga0a205_182443_c1 nmdc:mga0a205_182443_c1_849_1607 252
442 3300050515 nmdc:mga0a205_305428_c1 nmdc:mga0a205_305428_c1_450_1208 252
443 3300050515 nmdc:mga0a205_35617_c1 nmdc:mga0a205_35617_c1_2967_3725 252
444 3300053077 Ga0495601_0008121 Ga0495601_0008121_4847_5611 252
445 3300053077 Ga0495601_0212150 Ga0495601_0212150_61_825 252
446 3300053078 Ga0495612_0004257 Ga0495612_0004257_2279_3043 252
447 3300053122 Ga0500608_006441 Ga0500608_006441_2576_3334 252
448 3300053139 Ga0500568_0054740 Ga0500568_0054740_28_792 252
449 3300054114 Ga0501084_0004982 Ga0501084_0004982_2071_2829 252
450 3300054114 Ga0501084_0028822 Ga0501084_0028822_717_1475 252
451 3300054114 Ga0501084_0069294 Ga0501084_0069294_183_941 252
452 3300054114 Ga0501084_0152895 Ga0501084_0152895_466_1224 252
453 3300060353 Ga0501082_0112031 Ga0501082_0112031_190_948 252
454 3300060353 Ga0501082_0277302 Ga0501082_0277302_467_1225 252
455 3300060353 Ga0501082_0474801 Ga0501082_0474801_276_1034 252
456 3300061734 Ga0530510_0025883 Ga0530510_0025883_541_1299 252
457 3300061734 Ga0530510_0042453 Ga0530510_0042453_2471_3229 252
458 3300061734 Ga0530510_0078164 Ga0530510_0078164_1023_1781 252
459 iso_pu_bacteria 2643221604 2644032992 252
460 iso_pu_bacteria 2894023352 2894025410 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

212

0.98

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

261

286

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9241 4 245
4jbw-assembly1.cif.gz_A crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9214 4 239
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9202 1 240
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9174 1 240
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9142 4 239
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9637 3 252 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9562 3 252 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 2 236 3.40.50.300
af_P07821_3_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9342 2 249 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9332 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0WPJ1-F1-model_v4 High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG 0.9726 1 252 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9723 5 251 GO:0005524
GO:0005886
GO:0016887
AF-A0A7C3YY79-F1-model_v4 ABC transporter ATP-binding protein 0.9706 1 251 GO:0005524
GO:0005886
GO:0016887
AF-A0A1F9DPH1-F1-model_v4 ABC transporter domain-containing protein 0.9692 2 252 GO:0005524
GO:0005886
GO:0016887
AF-A0A3C0WPJ1-F1-model_v4 High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG 0.9689 1 252 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Feature Viewer

pLDDT pTM Quality
89.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map