F448618
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 264 | 455 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0414421|Ga0495684_0414421_50_910 |
| Length | 286 |
| Sequence | MDQDEELVPGVSAEASHQLPPAEVVRPFGAAAVSLFRADDIAIRFGGIRAVDAVSFDVNEGEVFSIIGPNGAGKTTIFNLISRIYQPSSGRLYFQDRDITEIPAYRIAGLGIARTFQNIELFANATLLQNLLIGRHCHSTVGVLSQLVFLPAVRREELQHREKAEEVIAFLGLERYRDTLIANLPYGVRKVVELGRALCIEPKLLLLDEPSSGLNVEETEGMGFWIEDIKKDLGITVIMVEHDMNLVRMVSDRVMALNYGKVIALGTPDEVQNHPEVVRAYIGGEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 3 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 4 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 5 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 6 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 151 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 171 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 194 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 195 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 196 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 197 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 198 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 199 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 200 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 260 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 263 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0.22 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.26 |
| Nodule | 0.22 |
| Rhizoplane | 0.87 |
| Rhizosphere | 93.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2460877 | 2162886007 | Bacteria | 2264 |
| 2 | Ga0065704_10071856 | 3300005289 | Bacteria | 9751 |
| 3 | Ga0065704_10213959 | 3300005289 | Bacteria | 1098 |
| 4 | Ga0065715_10107448 | 3300005293 | Bacteria | 2761 |
| 5 | Ga0070676_10000918 | 3300005328 | Bacteria | 14587 |
| 6 | Ga0070670_100002798 | 3300005331 | Bacteria | 14429 |
| 7 | Ga0068869_100001909 | 3300005334 | Bacteria | 12529 |
| 8 | Ga0068869_100021072 | 3300005334 | Bacteria | 4480 |
| 9 | Ga0070666_10052674 | 3300005335 | Bacteria | 2743 |
| 10 | Ga0070680_100000266 | 3300005336 | Bacteria | 34632 |
| 11 | Ga0070680_100070977 | 3300005336 | Bacteria | 2861 |
| 12 | Ga0070682_100000518 | 3300005337 | Bacteria | 24177 |
| 13 | Ga0070660_100001036 | 3300005339 | Bacteria | 18682 |
| 14 | Ga0070691_10243992 | 3300005341 | Bacteria | 961 |
| 15 | Ga0070687_100124957 | 3300005343 | Bacteria | 1477 |
| 16 | Ga0070661_100000703 | 3300005344 | Bacteria | 24523 |
| 17 | Ga0070692_10000029 | 3300005345 | Bacteria | 27136 |
| 18 | Ga0070669_100033343 | 3300005353 | Bacteria | 3724 |
| 19 | Ga0070675_100199888 | 3300005354 | Bacteria | 1735 |
| 20 | Ga0070659_100003576 | 3300005366 | Bacteria | 11064 |
| 21 | Ga0070667_100304386 | 3300005367 | Bacteria | 1436 |
| 22 | Ga0070709_10076733 | 3300005434 | Bacteria | 2171 |
| 23 | Ga0070709_10137953 | 3300005434 | Bacteria | 1672 |
| 24 | Ga0070714_100043666 | 3300005435 | Bacteria | 3792 |
| 25 | Ga0070713_100022797 | 3300005436 | Bacteria | 4845 |
| 26 | Ga0070713_100029565 | 3300005436 | Bacteria | 4341 |
| 27 | Ga0070713_100054736 | 3300005436 | Bacteria | 3312 |
| 28 | Ga0070713_100266995 | 3300005436 | Bacteria | 1566 |
| 29 | Ga0070710_10009071 | 3300005437 | Bacteria | 4863 |
| 30 | Ga0070701_10267761 | 3300005438 | Bacteria | 1038 |
| 31 | Ga0070711_100048336 | 3300005439 | Bacteria | 2908 |
| 32 | Ga0070705_100000602 | 3300005440 | Bacteria | 20833 |
| 33 | Ga0070705_100059547 | 3300005440 | Bacteria | 2262 |
| 34 | Ga0070700_100109628 | 3300005441 | Bacteria | 1833 |
| 35 | Ga0070694_100000833 | 3300005444 | Bacteria | 17315 |
| 36 | Ga0070694_100347246 | 3300005444 | Bacteria | 1148 |
| 37 | Ga0070708_100019168 | 3300005445 | Bacteria | 5743 |
| 38 | Ga0070708_100032641 | 3300005445 | Bacteria | 4518 |
| 39 | Ga0070708_100084512 | 3300005445 | Bacteria | 2879 |
| 40 | Ga0070708_100145312 | 3300005445 | Bacteria | 2202 |
| 41 | Ga0070708_100176843 | 3300005445 | Bacteria | 1994 |
| 42 | Ga0070708_100505675 | 3300005445 | Bacteria | 1140 |
| 43 | Ga0070663_100000911 | 3300005455 | Bacteria | 16057 |
| 44 | Ga0070662_100051947 | 3300005457 | Bacteria | 2962 |
| 45 | Ga0070681_10023799 | 3300005458 | Bacteria | 6165 |
| 46 | Ga0068867_100001309 | 3300005459 | Bacteria | 17226 |
| 47 | Ga0068867_100201090 | 3300005459 | Bacteria | 1595 |
| 48 | Ga0070706_100012087 | 3300005467 | Bacteria | 8012 |
| 49 | Ga0070706_100080975 | 3300005467 | Bacteria | 3007 |
| 50 | Ga0070707_100041886 | 3300005468 | Bacteria | 4383 |
| 51 | Ga0070707_100128223 | 3300005468 | Bacteria | 2466 |
| 52 | Ga0070707_100192565 | 3300005468 | Bacteria | 1988 |
| 53 | Ga0070707_100454197 | 3300005468 | Bacteria | 1242 |
| 54 | Ga0070698_100002225 | 3300005471 | Bacteria | 21473 |
| 55 | Ga0070698_100058110 | 3300005471 | Bacteria | 3911 |
| 56 | Ga0070699_100001487 | 3300005518 | Bacteria | 21471 |
| 57 | Ga0070699_100175058 | 3300005518 | Bacteria | 1902 |
| 58 | Ga0070699_100218605 | 3300005518 | Bacteria | 1698 |
| 59 | Ga0070679_100002143 | 3300005530 | Bacteria | 17792 |
| 60 | Ga0070679_100027768 | 3300005530 | Bacteria | 5574 |
| 61 | Ga0070684_100678853 | 3300005535 | Bacteria | 960 |
| 62 | Ga0070697_100087970 | 3300005536 | Bacteria | 2565 |
| 63 | Ga0070697_100356689 | 3300005536 | Bacteria | 1264 |
| 64 | Ga0068853_100000808 | 3300005539 | Bacteria | 21801 |
| 65 | Ga0068853_100732986 | 3300005539 | Bacteria | 944 |
| 66 | Ga0070672_100030387 | 3300005543 | Bacteria | 4058 |
| 67 | Ga0070695_100006415 | 3300005545 | Bacteria | 6956 |
| 68 | Ga0070695_100012294 | 3300005545 | Bacteria | 5133 |
| 69 | Ga0070695_100204735 | 3300005545 | Bacteria | 1413 |
| 70 | Ga0070696_100001094 | 3300005546 | Bacteria | 17529 |
| 71 | Ga0070693_100000045 | 3300005547 | Bacteria | 47582 |
| 72 | Ga0070693_100258260 | 3300005547 | Bacteria | 1158 |
| 73 | Ga0070704_100000240 | 3300005549 | Bacteria | 23438 |
| 74 | Ga0068855_100000462 | 3300005563 | Bacteria | 50016 |
| 75 | Ga0070664_100002902 | 3300005564 | Bacteria | 13870 |
| 76 | Ga0070664_100067786 | 3300005564 | Bacteria | 3050 |
| 77 | Ga0068857_100008050 | 3300005577 | Bacteria | 9090 |
| 78 | Ga0068857_100305180 | 3300005577 | Bacteria | 1468 |
| 79 | Ga0068854_100007822 | 3300005578 | Bacteria | 6841 |
| 80 | Ga0068856_100002716 | 3300005614 | Bacteria | 18136 |
| 81 | Ga0068856_100171541 | 3300005614 | Bacteria | 2181 |
| 82 | Ga0070702_100056816 | 3300005615 | Bacteria | 2262 |
| 83 | Ga0068859_100002495 | 3300005617 | Bacteria | 18707 |
| 84 | Ga0068859_100102443 | 3300005617 | Bacteria | 2920 |
| 85 | Ga0068864_100001334 | 3300005618 | Bacteria | 20531 |
| 86 | Ga0068861_100009309 | 3300005719 | Bacteria | 6778 |
| 87 | Ga0068861_100077458 | 3300005719 | Bacteria | 2593 |
| 88 | Ga0068870_10000934 | 3300005840 | Bacteria | 11459 |
| 89 | Ga0068870_10171846 | 3300005840 | Bacteria | 1294 |
| 90 | Ga0068863_100122956 | 3300005841 | Bacteria | 2476 |
| 91 | Ga0068863_100282447 | 3300005841 | Bacteria | 1608 |
| 92 | Ga0068858_100020465 | 3300005842 | Bacteria | 6185 |
| 93 | Ga0068858_100401690 | 3300005842 | Bacteria | 1317 |
| 94 | Ga0068862_100002748 | 3300005844 | Bacteria | 15437 |
| 95 | Ga0068862_100158726 | 3300005844 | Bacteria | 2017 |
| 96 | Ga0081455_10000074 | 3300005937 | Bacteria | 107319 |
| 97 | Ga0081455_10022128 | 3300005937 | Bacteria | 5948 |
| 98 | Ga0081538_10056629 | 3300005981 | Bacteria | 2294 |
| 99 | Ga0081540_1005226 | 3300005983 | Bacteria | 9717 |
| 100 | Ga0070717_10089316 | 3300006028 | Bacteria | 2599 |
| 101 | Ga0070717_10107858 | 3300006028 | Bacteria | 2372 |
| 102 | Ga0075365_10268910 | 3300006038 | Bacteria | 1199 |
| 103 | Ga0075368_10040874 | 3300006042 | Bacteria | 1821 |
| 104 | Ga0075368_10057408 | 3300006042 | Bacteria | 1554 |
| 105 | Ga0075364_10017964 | 3300006051 | Bacteria | 4423 |
| 106 | Ga0070716_100038839 | 3300006173 | Bacteria | 2638 |
| 107 | Ga0070712_100001675 | 3300006175 | Bacteria | 13558 |
| 108 | Ga0070712_100011814 | 3300006175 | Bacteria | 5548 |
| 109 | Ga0075367_10032834 | 3300006178 | Bacteria | 2989 |
| 110 | Ga0075367_10050194 | 3300006178 | Bacteria | 2462 |
| 111 | Ga0075367_10213776 | 3300006178 | Bacteria | 1206 |
| 112 | Ga0097621_100283101 | 3300006237 | Bacteria | 1460 |
| 113 | Ga0097621_100303853 | 3300006237 | Bacteria | 1410 |
| 114 | Ga0075428_100000509 | 3300006844 | Bacteria | 39431 |
| 115 | Ga0075428_100013632 | 3300006844 | Bacteria | 9051 |
| 116 | Ga0075428_100026860 | 3300006844 | Bacteria | 6374 |
| 117 | Ga0075428_100098801 | 3300006844 | Bacteria | 3182 |
| 118 | Ga0075428_100525299 | 3300006844 | Bacteria | 1266 |
| 119 | Ga0075430_100001087 | 3300006846 | Bacteria | 21577 |
| 120 | Ga0075430_100003590 | 3300006846 | Bacteria | 13001 |
| 121 | Ga0075430_100022035 | 3300006846 | Bacteria | 5415 |
| 122 | Ga0075430_100123259 | 3300006846 | Bacteria | 2160 |
| 123 | Ga0075431_100001593 | 3300006847 | Bacteria | 21127 |
| 124 | Ga0075431_100002162 | 3300006847 | Bacteria | 18799 |
| 125 | Ga0075431_100006591 | 3300006847 | Bacteria | 11533 |
| 126 | Ga0075431_100008769 | 3300006847 | Bacteria | 10133 |
| 127 | Ga0075431_100008892 | 3300006847 | Bacteria | 10061 |
| 128 | Ga0075431_100549282 | 3300006847 | Bacteria | 1143 |
| 129 | Ga0075433_10002867 | 3300006852 | Bacteria | 13211 |
| 130 | Ga0075433_10006931 | 3300006852 | Bacteria | 8979 |
| 131 | Ga0075433_10009404 | 3300006852 | Bacteria | 7810 |
| 132 | Ga0075433_10014523 | 3300006852 | Bacteria | 6438 |
| 133 | Ga0075433_10024429 | 3300006852 | Bacteria | 5100 |
| 134 | Ga0075433_10270788 | 3300006852 | Bacteria | 1505 |
| 135 | Ga0075434_100025615 | 3300006871 | Bacteria | 5772 |
| 136 | Ga0075434_100056781 | 3300006871 | Bacteria | 3891 |
| 137 | Ga0075434_100208246 | 3300006871 | Bacteria | 1976 |
| 138 | Ga0075429_100016643 | 3300006880 | Bacteria | 6368 |
| 139 | Ga0075429_100032538 | 3300006880 | Bacteria | 4532 |
| 140 | Ga0075429_100035877 | 3300006880 | Bacteria | 4312 |
| 141 | Ga0075429_100067385 | 3300006880 | Bacteria | 3115 |
| 142 | Ga0068865_100428835 | 3300006881 | Bacteria | 1089 |
| 143 | Ga0075436_100046510 | 3300006914 | Bacteria | 2993 |
| 144 | Ga0097620_100002495 | 3300006931 | Bacteria | 18707 |
| 145 | Ga0097620_100102445 | 3300006931 | Bacteria | 2920 |
| 146 | Ga0097620_100149385 | 3300006931 | Bacteria | 2412 |
| 147 | Ga0075435_100001922 | 3300007076 | Bacteria | 13535 |
| 148 | Ga0075435_100012226 | 3300007076 | Bacteria | 6349 |
| 149 | Ga0099794_10001445 | 3300007265 | Bacteria | 8309 |
| 150 | Ga0105240_10242374 | 3300009093 | Bacteria | 2089 |
| 151 | Ga0105240_10250558 | 3300009093 | Bacteria | 2048 |
| 152 | Ga0105240_10350754 | 3300009093 | Bacteria | 1674 |
| 153 | Ga0105245_10020215 | 3300009098 | Bacteria | 5836 |
| 154 | Ga0105245_10052690 | 3300009098 | Bacteria | 3649 |
| 155 | Ga0105245_10812770 | 3300009098 | Bacteria | 973 |
| 156 | Ga0114129_10008686 | 3300009147 | Bacteria | 14482 |
| 157 | Ga0114129_10017939 | 3300009147 | Bacteria | 10076 |
| 158 | Ga0114129_10036423 | 3300009147 | Bacteria | 6947 |
| 159 | Ga0114129_10043638 | 3300009147 | Bacteria | 6309 |
| 160 | Ga0114129_10094036 | 3300009147 | Bacteria | 4152 |
| 161 | Ga0114129_10096583 | 3300009147 | Bacteria | 4091 |
| 162 | Ga0114129_10269811 | 3300009147 | Bacteria | 2277 |
| 163 | Ga0114129_10279334 | 3300009147 | Bacteria | 2232 |
| 164 | Ga0114129_10283680 | 3300009147 | Bacteria | 2212 |
| 165 | Ga0114129_10377051 | 3300009147 | Bacteria | 1874 |
| 166 | Ga0105237_10036167 | 3300009545 | Bacteria | 4996 |
| 167 | Ga0105238_10018342 | 3300009551 | Bacteria | 7122 |
| 168 | Ga0105238_10536495 | 3300009551 | Bacteria | 1173 |
| 169 | Ga0105246_10015068 | 3300011119 | Bacteria | 4873 |
| 170 | Ga0105246_10156571 | 3300011119 | Bacteria | 1731 |
| 171 | Ga0157373_10000379 | 3300013100 | Bacteria | 35641 |
| 172 | Ga0157369_10062088 | 3300013105 | Bacteria | 4027 |
| 173 | Ga0157374_10193562 | 3300013296 | Bacteria | 1989 |
| 174 | Ga0157374_10292539 | 3300013296 | Bacteria | 1610 |
| 175 | Ga0157372_10000135 | 3300013307 | Bacteria | 81209 |
| 176 | Ga0163163_10114249 | 3300014325 | Bacteria | 2730 |
| 177 | Ga0163163_10687182 | 3300014325 | Bacteria | 1087 |
| 178 | Ga0157380_10182830 | 3300014326 | Bacteria | 1843 |
| 179 | Ga0182008_10016024 | 3300014497 | Bacteria | 3902 |
| 180 | Ga0157376_10479090 | 3300014969 | Bacteria | 1219 |
| 181 | Ga0213876_10097826 | 3300021384 | Bacteria | 1555 |
| 182 | Ga0213871_10008081 | 3300021441 | Bacteria | 2304 |
| 183 | Ga0207653_10016807 | 3300025885 | Bacteria | 2300 |
| 184 | Ga0207653_10028196 | 3300025885 | Bacteria | 1805 |
| 185 | Ga0207692_10053494 | 3300025898 | Bacteria | 2057 |
| 186 | Ga0207647_10046585 | 3300025904 | Bacteria | 2701 |
| 187 | Ga0207699_10032695 | 3300025906 | Bacteria | 2933 |
| 188 | Ga0207699_10257252 | 3300025906 | Bacteria | 1205 |
| 189 | Ga0207645_10000075 | 3300025907 | Bacteria | 71333 |
| 190 | Ga0207645_10300910 | 3300025907 | Bacteria | 1068 |
| 191 | Ga0207643_10000146 | 3300025908 | Bacteria | 48070 |
| 192 | Ga0207684_10001638 | 3300025910 | Bacteria | 23790 |
| 193 | Ga0207684_10008109 | 3300025910 | Bacteria | 9364 |
| 194 | Ga0207684_10029205 | 3300025910 | Bacteria | 4697 |
| 195 | Ga0207684_10090431 | 3300025910 | Bacteria | 2608 |
| 196 | Ga0207684_10313861 | 3300025910 | Bacteria | 1351 |
| 197 | Ga0207707_10000135 | 3300025912 | Bacteria | 76964 |
| 198 | Ga0207707_10213425 | 3300025912 | Bacteria | 1681 |
| 199 | Ga0207707_10695795 | 3300025912 | Bacteria | 854 |
| 200 | Ga0207671_10090230 | 3300025914 | Bacteria | 2308 |
| 201 | Ga0207693_10006864 | 3300025915 | Bacteria | 9402 |
| 202 | Ga0207693_10014327 | 3300025915 | Bacteria | 6379 |
| 203 | Ga0207663_10092953 | 3300025916 | Bacteria | 2006 |
| 204 | Ga0207663_10352981 | 3300025916 | Bacteria | 1114 |
| 205 | Ga0207660_10002799 | 3300025917 | Bacteria | 11432 |
| 206 | Ga0207660_10129708 | 3300025917 | Bacteria | 1918 |
| 207 | Ga0207662_10039973 | 3300025918 | Bacteria | 2754 |
| 208 | Ga0207657_10000037 | 3300025919 | Bacteria | 124230 |
| 209 | Ga0207649_10029197 | 3300025920 | Bacteria | 3255 |
| 210 | Ga0207652_10001525 | 3300025921 | Bacteria | 20432 |
| 211 | Ga0207646_10001729 | 3300025922 | Bacteria | 26558 |
| 212 | Ga0207646_10053456 | 3300025922 | Bacteria | 3613 |
| 213 | Ga0207646_10177431 | 3300025922 | Bacteria | 1924 |
| 214 | Ga0207646_10305953 | 3300025922 | Bacteria | 1436 |
| 215 | Ga0207646_10416961 | 3300025922 | Bacteria | 1212 |
| 216 | Ga0207681_10086853 | 3300025923 | Bacteria | 2224 |
| 217 | Ga0207681_10432289 | 3300025923 | Bacteria | 1068 |
| 218 | Ga0207687_10098741 | 3300025927 | Bacteria | 2144 |
| 219 | Ga0207687_10149773 | 3300025927 | Bacteria | 1779 |
| 220 | Ga0207700_10044370 | 3300025928 | Bacteria | 3272 |
| 221 | Ga0207700_10055837 | 3300025928 | Bacteria | 2970 |
| 222 | Ga0207700_10097002 | 3300025928 | Bacteria | 2342 |
| 223 | Ga0207664_10121244 | 3300025929 | Bacteria | 2188 |
| 224 | Ga0207709_10042272 | 3300025935 | Bacteria | 2740 |
| 225 | Ga0207665_10000576 | 3300025939 | Bacteria | 24692 |
| 226 | Ga0207691_10235348 | 3300025940 | Bacteria | 1585 |
| 227 | Ga0207689_10000029 | 3300025942 | Bacteria | 100016 |
| 228 | Ga0207689_10039823 | 3300025942 | Bacteria | 3890 |
| 229 | Ga0207679_10002294 | 3300025945 | Bacteria | 11794 |
| 230 | Ga0207679_10151364 | 3300025945 | Bacteria | 1889 |
| 231 | Ga0207667_10000652 | 3300025949 | Bacteria | 45007 |
| 232 | Ga0207658_10255809 | 3300025986 | Bacteria | 1490 |
| 233 | Ga0207703_10053517 | 3300026035 | Bacteria | 3281 |
| 234 | Ga0207703_10517025 | 3300026035 | Bacteria | 1122 |
| 235 | Ga0207639_10004221 | 3300026041 | Bacteria | 9683 |
| 236 | Ga0207678_10005618 | 3300026067 | Bacteria | 11215 |
| 237 | Ga0207708_10101271 | 3300026075 | Bacteria | 2230 |
| 238 | Ga0207708_10140164 | 3300026075 | Bacteria | 1896 |
| 239 | Ga0207702_10007290 | 3300026078 | Bacteria | 9457 |
| 240 | Ga0207702_10026562 | 3300026078 | Bacteria | 4807 |
| 241 | Ga0207702_10131942 | 3300026078 | Bacteria | 2249 |
| 242 | Ga0207702_10148617 | 3300026078 | Bacteria | 2129 |
| 243 | Ga0207702_10395325 | 3300026078 | Bacteria | 1332 |
| 244 | Ga0207641_10017579 | 3300026088 | Bacteria | 5854 |
| 245 | Ga0207641_10117997 | 3300026088 | Bacteria | 2363 |
| 246 | Ga0207641_10207381 | 3300026088 | Bacteria | 1811 |
| 247 | Ga0207648_10000552 | 3300026089 | Bacteria | 41984 |
| 248 | Ga0207648_10181539 | 3300026089 | Bacteria | 1863 |
| 249 | Ga0207648_10755362 | 3300026089 | Bacteria | 903 |
| 250 | Ga0207676_10152463 | 3300026095 | Bacteria | 1992 |
| 251 | Ga0207674_10000306 | 3300026116 | Bacteria | 62216 |
| 252 | Ga0207674_10173949 | 3300026116 | Bacteria | 2106 |
| 253 | Ga0207674_10502401 | 3300026116 | Bacteria | 1171 |
| 254 | Ga0207675_100010607 | 3300026118 | Bacteria | 8629 |
| 255 | Ga0207675_100563574 | 3300026118 | Bacteria | 1139 |
| 256 | Ga0209588_1000952 | 3300027671 | Bacteria | 7398 |
| 257 | Ga0209813_10141234 | 3300027866 | Bacteria | 855 |
| 258 | Ga0268265_10003670 | 3300028380 | Bacteria | 10947 |
| 259 | Ga0268264_10038337 | 3300028381 | Bacteria | 3955 |
| 260 | Ga0265337_1040913 | 3300028556 | Bacteria | 1335 |
| 261 | Ga0265338_10009595 | 3300028800 | Bacteria | 11504 |
| 262 | Ga0265338_10454592 | 3300028800 | Bacteria | 906 |
| 263 | Ga0265760_10019952 | 3300031090 | Bacteria | 1933 |
| 264 | Ga0265327_10000402 | 3300031251 | Bacteria | 80983 |
| 265 | Ga0307408_100032995 | 3300031548 | Bacteria | 3614 |
| 266 | Ga0316576_10011200 | 3300031727 | Bacteria | 5863 |
| 267 | Ga0316576_10058556 | 3300031727 | Bacteria | 2819 |
| 268 | Ga0316576_10431940 | 3300031727 | Bacteria | 974 |
| 269 | Ga0316578_10077451 | 3300031728 | Bacteria | 1974 |
| 270 | Ga0307407_10005606 | 3300031903 | Bacteria | 5469 |
| 271 | Ga0307407_10063635 | 3300031903 | Bacteria | 2165 |
| 272 | Ga0307412_10027190 | 3300031911 | Bacteria | 3564 |
| 273 | Ga0307416_100184177 | 3300032002 | Bacteria | 1961 |
| 274 | Ga0307416_100193529 | 3300032002 | Bacteria | 1921 |
| 275 | Ga0373948_0005769 | 3300034817 | Bacteria | 2020 |
| 276 | Ga0373934_0034242 | 3300035086 | Bacteria | 1996 |
| 277 | Ga0373940_0057617 | 3300035088 | Bacteria | 1104 |
| 278 | Ga0373949_0050283 | 3300035090 | Bacteria | 1048 |
| 279 | Ga0373951_0008323 | 3300035091 | Bacteria | 2345 |
| 280 | Ga0373923_0014012 | 3300035111 | Bacteria | 3003 |
| 281 | Ga0373923_0020697 | 3300035111 | Bacteria | 2559 |
| 282 | Ga0373936_0165209 | 3300035113 | Bacteria | 966 |
| 283 | Ga0373939_0021188 | 3300035114 | Bacteria | 1776 |
| 284 | Ga0373941_0004881 | 3300035115 | Bacteria | 3126 |
| 285 | Ga0373953_0070551 | 3300035117 | Bacteria | 1441 |
| 286 | Ga0373954_0094685 | 3300035118 | Bacteria | 1437 |
| 287 | Ga0373957_0082232 | 3300035120 | Bacteria | 1273 |
| 288 | Ga0373943_0071610 | 3300035170 | Bacteria | 1757 |
| 289 | Ga0373946_0014654 | 3300035171 | Bacteria | 2959 |
| 290 | Ga0373955_0174843 | 3300035172 | Bacteria | 1272 |
| 291 | Ga0373961_0002358 | 3300035241 | Bacteria | 4928 |
| 292 | Ga0373962_0008549 | 3300035242 | Bacteria | 2521 |
| 293 | Ga0316574_0032975 | 3300035398 | Bacteria | 3151 |
| 294 | Ga0373924_0009511 | 3300035410 | Bacteria | 3564 |
| 295 | Ga0373924_0012767 | 3300035410 | Bacteria | 3144 |
| 296 | Ga0373931_0095536 | 3300035691 | Bacteria | 1663 |
| 297 | Ga0373927_0262925 | 3300035695 | Bacteria | 1135 |
| 298 | Ga0373927_0329737 | 3300035695 | Bacteria | 1005 |
| 299 | Ga0373933_0024850 | 3300035724 | Bacteria | 3432 |
| 300 | Ga0373937_0044781 | 3300036401 | Bacteria | 4042 |
| 301 | Ga0373937_0093621 | 3300036401 | Bacteria | 2786 |
| 302 | Ga0316584_0012965 | 3300036712 | Bacteria | 5890 |
| 303 | Ga0373925_0012187 | 3300037068 | Bacteria | 6224 |
| 304 | Ga0373925_0039472 | 3300037068 | Bacteria | 3492 |
| 305 | Ga0373925_0315682 | 3300037068 | Bacteria | 1264 |
| 306 | Ga0395899_0102020 | 3300037312 | Bacteria | 2070 |
| 307 | Ga0395898_0096393 | 3300037466 | Bacteria | 2842 |
| 308 | Ga0395898_0658260 | 3300037466 | Bacteria | 990 |
| 309 | Ga0395905_0053364 | 3300037471 | Bacteria | 3783 |
| 310 | Ga0436364_0149728 | 3300037853 | Bacteria | 1616 |
| 311 | Ga0436364_0700812 | 3300037853 | Bacteria | 1981 |
| 312 | Ga0436364_1396155 | 3300037853 | Bacteria | 2614 |
| 313 | Ga0395901_0300327 | 3300038443 | Bacteria | 1665 |
| 314 | Ga0400483_162612 | 3300039062 | Bacteria | 31721 |
| 315 | Ga0436360_0365160 | 3300039438 | Bacteria | 1229 |
| 316 | Ga0436360_1043819 | 3300039438 | Bacteria | 2809 |
| 317 | Ga0436360_1253789 | 3300039438 | Bacteria | 993 |
| 318 | Ga0436361_1133418 | 3300039447 | Bacteria | 5427 |
| 319 | Ga0436363_0063999 | 3300039450 | Bacteria | 1116 |
| 320 | Ga0436363_1495745 | 3300039450 | Bacteria | 1021 |
| 321 | Ga0436362_1042850 | 3300039453 | Bacteria | 893 |
| 322 | Ga0439461_0003225 | 3300041410 | Bacteria | 2672 |
| 323 | Ga0439465_0012666 | 3300041413 | Bacteria | 2638 |
| 324 | Ga0439465_0014267 | 3300041413 | Bacteria | 2477 |
| 325 | Ga0439448_0019399 | 3300042005 | Bacteria | 2093 |
| 326 | Ga0439449_0008350 | 3300042007 | Bacteria | 3938 |
| 327 | Ga0439450_006251 | 3300042008 | Bacteria | 2137 |
| 328 | Ga0450889_005015 | 3300042144 | Bacteria | 1312 |
| 329 | Ga0439446_0011487 | 3300042156 | Bacteria | 2404 |
| 330 | Ga0439434_0005119 | 3300042435 | Bacteria | 3836 |
| 331 | Ga0439444_0005857 | 3300042437 | Bacteria | 1837 |
| 332 | Ga0439459_0003228 | 3300042438 | Bacteria | 2569 |
| 333 | Ga0439464_0007480 | 3300042439 | Bacteria | 2856 |
| 334 | Ga0439460_0000701 | 3300042461 | Bacteria | 7454 |
| 335 | Ga0439460_0031146 | 3300042461 | Bacteria | 1520 |
| 336 | Ga0451577_0092204 | 3300042876 | Bacteria | 2705 |
| 337 | Ga0451577_0114693 | 3300042876 | Bacteria | 2412 |
| 338 | Ga0451577_0329779 | 3300042876 | Bacteria | 1384 |
| 339 | Ga0453683_0013899 | 3300044673 | Bacteria | 5237 |
| 340 | Ga0453684_0061871 | 3300044712 | Bacteria | 4801 |
| 341 | Ga0453684_0325764 | 3300044712 | Bacteria | 1738 |
| 342 | Ga0453684_0715734 | 3300044712 | Bacteria | 1087 |
| 343 | Ga0451576_0056116 | 3300045051 | Bacteria | 4120 |
| 344 | Ga0451576_0219841 | 3300045051 | Bacteria | 1983 |
| 345 | Ga0451576_0262034 | 3300045051 | Bacteria | 1807 |
| 346 | Ga0466958_0091451 | 3300045836 | Bacteria | 1884 |
| 347 | Ga0495592_0171809 | 3300046454 | Bacteria | 1484 |
| 348 | Ga0495651_0237985 | 3300046462 | Bacteria | 1250 |
| 349 | Ga0495651_0417970 | 3300046462 | Bacteria | 872 |
| 350 | Ga0495650_0069753 | 3300046471 | Bacteria | 1382 |
| 351 | Ga0495580_0034739 | 3300046472 | Bacteria | 3628 |
| 352 | Ga0495664_0006389 | 3300046477 | Bacteria | 6512 |
| 353 | Ga0495608_0002977 | 3300046511 | Bacteria | 12113 |
| 354 | Ga0495608_0034326 | 3300046511 | Bacteria | 3425 |
| 355 | Ga0495652_0169226 | 3300046529 | Bacteria | 1688 |
| 356 | Ga0495640_0048271 | 3300046533 | Bacteria | 2943 |
| 357 | Ga0495640_0113205 | 3300046533 | Bacteria | 1771 |
| 358 | Ga0495587_0249254 | 3300046536 | Bacteria | 998 |
| 359 | Ga0495597_0000028 | 3300046542 | Bacteria | 137215 |
| 360 | Ga0495645_0000478 | 3300046543 | Bacteria | 27655 |
| 361 | Ga0495667_0020698 | 3300046559 | Bacteria | 4439 |
| 362 | Ga0495599_0035562 | 3300046678 | Bacteria | 3127 |
| 363 | Ga0495600_0047741 | 3300046809 | Bacteria | 2793 |
| 364 | Ga0495636_0134249 | 3300047318 | Bacteria | 1102 |
| 365 | Ga0495674_0064825 | 3300047319 | Bacteria | 3175 |
| 366 | Ga0495674_0073827 | 3300047319 | Bacteria | 2939 |
| 367 | Ga0495675_0003932 | 3300047444 | Bacteria | 9001 |
| 368 | Ga0495684_0029112 | 3300047471 | Bacteria | 4239 |
| 369 | Ga0495684_0414421 | 3300047471 | Bacteria | 943 |
| 370 | Ga0495602_0001497 | 3300048088 | Bacteria | 23263 |
| 371 | Ga0495602_0127663 | 3300048088 | Bacteria | 2034 |
| 372 | Ga0496102_0032773 | 3300048905 | Bacteria | 4669 |
| 373 | Ga0496106_0544086 | 3300048909 | Bacteria | 932 |
| 374 | Ga0496107_0301477 | 3300048910 | Bacteria | 1193 |
| 375 | Ga0496112_0056779 | 3300048915 | Bacteria | 3854 |
| 376 | Ga0496119_0018323 | 3300048922 | Bacteria | 5222 |
| 377 | Ga0501038_0101381 | 3300049574 | Bacteria | 2397 |
| 378 | Ga0501040_0075021 | 3300049576 | Bacteria | 2337 |
| 379 | Ga0501042_0057796 | 3300049578 | Bacteria | 2768 |
| 380 | Ga0501046_0210631 | 3300049580 | Bacteria | 1443 |
| 381 | Ga0501048_0570376 | 3300049582 | Bacteria | 812 |
| 382 | Ga0501068_0113202 | 3300049584 | Bacteria | 1688 |
| 383 | Ga0501071_0071383 | 3300049587 | Bacteria | 2531 |
| 384 | Ga0501071_0411543 | 3300049587 | Bacteria | 1033 |
| 385 | Ga0501072_0041603 | 3300049588 | Bacteria | 3610 |
| 386 | Ga0501072_0275505 | 3300049588 | Bacteria | 1338 |
| 387 | Ga0501075_0022010 | 3300049591 | Bacteria | 4654 |
| 388 | Ga0501075_0024071 | 3300049591 | Bacteria | 4459 |
| 389 | Ga0501075_0250069 | 3300049591 | Bacteria | 1351 |
| 390 | Ga0501075_0320901 | 3300049591 | Bacteria | 1180 |
| 391 | Ga0501076_0006750 | 3300049592 | Bacteria | 8329 |
| 392 | Ga0501077_0012001 | 3300049593 | Bacteria | 5422 |
| 393 | Ga0501077_0037049 | 3300049593 | Bacteria | 3107 |
| 394 | Ga0501077_0174295 | 3300049593 | Bacteria | 1366 |
| 395 | Ga0501079_0023873 | 3300049741 | Bacteria | 4691 |
| 396 | Ga0501079_0026176 | 3300049741 | Bacteria | 4472 |
| 397 | Ga0501080_0632796 | 3300049742 | Bacteria | 948 |
| 398 | Ga0501081_0061560 | 3300049743 | Bacteria | 2602 |
| 399 | Ga0501081_0145302 | 3300049743 | Bacteria | 1701 |
| 400 | Ga0501081_0265888 | 3300049743 | Bacteria | 1254 |
| 401 | nmdc:mga00v17_29366_c1 | 3300050491 | Bacteria | 3227 |
| 402 | nmdc:mga0yw44_238611_c1 | 3300050492 | Bacteria | 1208 |
| 403 | nmdc:mga06z11_5116_c1 | 3300050494 | Bacteria | 3120 |
| 404 | nmdc:mga04h51_164617_c1 | 3300050495 | Bacteria | 855 |
| 405 | nmdc:mga07m45_9291_c1 | 3300050496 | Bacteria | 5092 |
| 406 | nmdc:mga05p37_128788_c1 | 3300050507 | Bacteria | 3107 |
| 407 | nmdc:mga05p37_15169_c1 | 3300050507 | Bacteria | 9252 |
| 408 | nmdc:mga05p37_175237_c1 | 3300050507 | Bacteria | 2613 |
| 409 | nmdc:mga05p37_23681_c1 | 3300050507 | Bacteria | 7454 |
| 410 | nmdc:mga05p37_70724_c1 | 3300050507 | Bacteria | 4292 |
| 411 | nmdc:mga05p37_92760_c1 | 3300050507 | Bacteria | 3721 |
| 412 | nmdc:mga05p37_99353_c1 | 3300050507 | Bacteria | 3584 |
| 413 | nmdc:mga09592_14974_c1 | 3300050508 | Bacteria | 6335 |
| 414 | nmdc:mga09592_31534_c1 | 3300050508 | Bacteria | 4417 |
| 415 | nmdc:mga09592_61627_c1 | 3300050508 | Bacteria | 3173 |
| 416 | nmdc:mga0qj67_100476_c1 | 3300050509 | Bacteria | 2332 |
| 417 | nmdc:mga0qj67_12889_c1 | 3300050509 | Bacteria | 6308 |
| 418 | nmdc:mga0qj67_235915_c1 | 3300050509 | Bacteria | 1484 |
| 419 | nmdc:mga0qj67_2387_c1 | 3300050509 | Bacteria | 13380 |
| 420 | nmdc:mga0qj67_39409_c1 | 3300050509 | Bacteria | 3710 |
| 421 | nmdc:mga06r32_17872_c1 | 3300050510 | Bacteria | 6482 |
| 422 | nmdc:mga06r32_33942_c1 | 3300050510 | Bacteria | 4809 |
| 423 | nmdc:mga06r32_348225_c1 | 3300050510 | Bacteria | 1466 |
| 424 | nmdc:mga06r32_428636_c1 | 3300050510 | Bacteria | 1303 |
| 425 | nmdc:mga06r32_468909_c1 | 3300050510 | Bacteria | 1238 |
| 426 | nmdc:mga06r32_538263_c1 | 3300050510 | Bacteria | 1143 |
| 427 | nmdc:mga06r32_693_c1 | 3300050510 | Bacteria | 29366 |
| 428 | nmdc:mga0n895_16764_c1 | 3300050512 | Bacteria | 6733 |
| 429 | nmdc:mga0n895_467341_c1 | 3300050512 | Bacteria | 1273 |
| 430 | nmdc:mga0n895_472094_c1 | 3300050512 | Bacteria | 1265 |
| 431 | nmdc:mga0n895_53578_c1 | 3300050512 | Bacteria | 3964 |
| 432 | nmdc:mga0n895_87294_c1 | 3300050512 | Bacteria | 3117 |
| 433 | nmdc:mga0rr50_326363_c1 | 3300050513 | Bacteria | 1288 |
| 434 | nmdc:mga0rr50_405060_c1 | 3300050513 | Bacteria | 1153 |
| 435 | nmdc:mga08x19_167955_c1 | 3300050514 | Bacteria | 1493 |
| 436 | nmdc:mga0a205_128_c1 | 3300050515 | Bacteria | 46647 |
| 437 | nmdc:mga0a205_182443_c1 | 3300050515 | Bacteria | 1993 |
| 438 | nmdc:mga0a205_305428_c1 | 3300050515 | Bacteria | 1464 |
| 439 | nmdc:mga0a205_35617_c1 | 3300050515 | Bacteria | 4779 |
| 440 | Ga0495601_0008121 | 3300053077 | Bacteria | 6189 |
| 441 | Ga0495601_0212150 | 3300053077 | Bacteria | 1265 |
| 442 | Ga0495612_0004257 | 3300053078 | Bacteria | 5943 |
| 443 | Ga0500608_006441 | 3300053122 | Bacteria | 4779 |
| 444 | Ga0500568_0054740 | 3300053139 | Bacteria | 1559 |
| 445 | Ga0501084_0004982 | 3300054114 | Bacteria | 10865 |
| 446 | Ga0501084_0028822 | 3300054114 | Bacteria | 4642 |
| 447 | Ga0501084_0069294 | 3300054114 | Bacteria | 2953 |
| 448 | Ga0501084_0152895 | 3300054114 | Bacteria | 1945 |
| 449 | Ga0590074_027060 | 3300059423 | Bacteria | 1004 |
| 450 | Ga0501082_0112031 | 3300060353 | Bacteria | 2362 |
| 451 | Ga0501082_0277302 | 3300060353 | Bacteria | 1459 |
| 452 | Ga0501082_0474801 | 3300060353 | Bacteria | 1093 |
| 453 | Ga0530510_0025883 | 3300061734 | Bacteria | 4197 |
| 454 | Ga0530510_0042453 | 3300061734 | Bacteria | 3286 |
| 455 | Ga0530510_0078164 | 3300061734 | Bacteria | 2405 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_100067786 | Ga0070664_1000677862 | 225 |
| 2 | 3300005577 | Ga0068857_100305180 | Ga0068857_1003051802 | 225 |
| 3 | 3300025945 | Ga0207679_10151364 | Ga0207679_101513642 | 225 |
| 4 | 3300046529 | Ga0495652_0169226 | Ga0495652_0169226_968_1678 | 234 |
| 5 | 3300041410 | Ga0439461_0003225 | Ga0439461_0003225_553_1341 | 235 |
| 6 | 3300041413 | Ga0439465_0012666 | Ga0439465_0012666_986_1774 | 235 |
| 7 | 3300042156 | Ga0439446_0011487 | Ga0439446_0011487_528_1316 | 235 |
| 8 | 3300042435 | Ga0439434_0005119 | Ga0439434_0005119_986_1774 | 235 |
| 9 | 3300031911 | Ga0307412_10027190 | Ga0307412_100271902 | 236 |
| 10 | 3300059423 | Ga0590074_027060 | Ga0590074_027060_14_817 | 242 |
| 11 | iso_pu_bacteria | 2858688981 | 2858691720 | 246 |
| 12 | 3300037466 | Ga0395898_0096393 | Ga0395898_0096393_280_1026 | 248 |
| 13 | iso_pu_bacteria | 2885409591 | 2885414358 | 248 |
| 14 | iso_pu_bacteria | 2996310559 | 2996312421 | 248 |
| 15 | 3300005468 | Ga0070707_100454197 | Ga0070707_1004541972 | 251 |
| 16 | 3300005518 | Ga0070699_100218605 | Ga0070699_1002186052 | 251 |
| 17 | 3300006844 | Ga0075428_100525299 | Ga0075428_1005252992 | 251 |
| 18 | 3300025910 | Ga0207684_10313861 | Ga0207684_103138612 | 251 |
| 19 | 3300025922 | Ga0207646_10416961 | Ga0207646_104169611 | 251 |
| 20 | 3300050510 | nmdc:mga06r32_348225_c1 | nmdc:mga06r32_348225_c1_515_1384 | 251 |
| 21 | 2162886007 | SwRhRL2b_contig_2460877 | SwRhRL2b_0725.00002240 | 252 |
| 22 | 3300005289 | Ga0065704_10071856 | Ga0065704_100718565 | 252 |
| 23 | 3300005289 | Ga0065704_10213959 | Ga0065704_102139591 | 252 |
| 24 | 3300005293 | Ga0065715_10107448 | Ga0065715_101074483 | 252 |
| 25 | 3300005328 | Ga0070676_10000918 | Ga0070676_100009186 | 252 |
| 26 | 3300005331 | Ga0070670_100002798 | Ga0070670_10000279811 | 252 |
| 27 | 3300005334 | Ga0068869_100001909 | Ga0068869_1000019098 | 252 |
| 28 | 3300005334 | Ga0068869_100021072 | Ga0068869_1000210722 | 252 |
| 29 | 3300005335 | Ga0070666_10052674 | Ga0070666_100526741 | 252 |
| 30 | 3300005336 | Ga0070680_100000266 | Ga0070680_10000026631 | 252 |
| 31 | 3300005336 | Ga0070680_100070977 | Ga0070680_1000709772 | 252 |
| 32 | 3300005337 | Ga0070682_100000518 | Ga0070682_10000051821 | 252 |
| 33 | 3300005339 | Ga0070660_100001036 | Ga0070660_10000103617 | 252 |
| 34 | 3300005341 | Ga0070691_10243992 | Ga0070691_102439921 | 252 |
| 35 | 3300005343 | Ga0070687_100124957 | Ga0070687_1001249571 | 252 |
| 36 | 3300005344 | Ga0070661_100000703 | Ga0070661_10000070316 | 252 |
| 37 | 3300005345 | Ga0070692_10000029 | Ga0070692_1000002911 | 252 |
| 38 | 3300005353 | Ga0070669_100033343 | Ga0070669_1000333434 | 252 |
| 39 | 3300005354 | Ga0070675_100199888 | Ga0070675_1001998882 | 252 |
| 40 | 3300005366 | Ga0070659_100003576 | Ga0070659_1000035764 | 252 |
| 41 | 3300005367 | Ga0070667_100304386 | Ga0070667_1003043862 | 252 |
| 42 | 3300005434 | Ga0070709_10076733 | Ga0070709_100767333 | 252 |
| 43 | 3300005434 | Ga0070709_10137953 | Ga0070709_101379532 | 252 |
| 44 | 3300005435 | Ga0070714_100043666 | Ga0070714_1000436662 | 252 |
| 45 | 3300005436 | Ga0070713_100022797 | Ga0070713_1000227974 | 252 |
| 46 | 3300005436 | Ga0070713_100029565 | Ga0070713_1000295651 | 252 |
| 47 | 3300005436 | Ga0070713_100054736 | Ga0070713_1000547362 | 252 |
| 48 | 3300005436 | Ga0070713_100266995 | Ga0070713_1002669951 | 252 |
| 49 | 3300005437 | Ga0070710_10009071 | Ga0070710_100090714 | 252 |
| 50 | 3300005438 | Ga0070701_10267761 | Ga0070701_102677612 | 252 |
| 51 | 3300005439 | Ga0070711_100048336 | Ga0070711_1000483362 | 252 |
| 52 | 3300005440 | Ga0070705_100000602 | Ga0070705_1000006024 | 252 |
| 53 | 3300005440 | Ga0070705_100059547 | Ga0070705_1000595472 | 252 |
| 54 | 3300005441 | Ga0070700_100109628 | Ga0070700_1001096282 | 252 |
| 55 | 3300005444 | Ga0070694_100000833 | Ga0070694_10000083316 | 252 |
| 56 | 3300005444 | Ga0070694_100347246 | Ga0070694_1003472462 | 252 |
| 57 | 3300005445 | Ga0070708_100019168 | Ga0070708_1000191682 | 252 |
| 58 | 3300005445 | Ga0070708_100032641 | Ga0070708_1000326412 | 252 |
| 59 | 3300005445 | Ga0070708_100084512 | Ga0070708_1000845122 | 252 |
| 60 | 3300005445 | Ga0070708_100145312 | Ga0070708_1001453122 | 252 |
| 61 | 3300005445 | Ga0070708_100176843 | Ga0070708_1001768433 | 252 |
| 62 | 3300005445 | Ga0070708_100505675 | Ga0070708_1005056751 | 252 |
| 63 | 3300005455 | Ga0070663_100000911 | Ga0070663_1000009112 | 252 |
| 64 | 3300005457 | Ga0070662_100051947 | Ga0070662_1000519473 | 252 |
| 65 | 3300005458 | Ga0070681_10023799 | Ga0070681_100237995 | 252 |
| 66 | 3300005459 | Ga0068867_100001309 | Ga0068867_1000013094 | 252 |
| 67 | 3300005459 | Ga0068867_100201090 | Ga0068867_1002010902 | 252 |
| 68 | 3300005467 | Ga0070706_100012087 | Ga0070706_1000120873 | 252 |
| 69 | 3300005467 | Ga0070706_100080975 | Ga0070706_1000809753 | 252 |
| 70 | 3300005468 | Ga0070707_100041886 | Ga0070707_1000418864 | 252 |
| 71 | 3300005468 | Ga0070707_100128223 | Ga0070707_1001282232 | 252 |
| 72 | 3300005468 | Ga0070707_100192565 | Ga0070707_1001925652 | 252 |
| 73 | 3300005471 | Ga0070698_100002225 | Ga0070698_1000022256 | 252 |
| 74 | 3300005471 | Ga0070698_100058110 | Ga0070698_1000581103 | 252 |
| 75 | 3300005518 | Ga0070699_100001487 | Ga0070699_1000014874 | 252 |
| 76 | 3300005518 | Ga0070699_100175058 | Ga0070699_1001750582 | 252 |
| 77 | 3300005530 | Ga0070679_100002143 | Ga0070679_1000021434 | 252 |
| 78 | 3300005530 | Ga0070679_100027768 | Ga0070679_1000277684 | 252 |
| 79 | 3300005535 | Ga0070684_100678853 | Ga0070684_1006788531 | 252 |
| 80 | 3300005536 | Ga0070697_100087970 | Ga0070697_1000879702 | 252 |
| 81 | 3300005536 | Ga0070697_100356689 | Ga0070697_1003566892 | 252 |
| 82 | 3300005539 | Ga0068853_100000808 | Ga0068853_10000080818 | 252 |
| 83 | 3300005539 | Ga0068853_100732986 | Ga0068853_1007329861 | 252 |
| 84 | 3300005543 | Ga0070672_100030387 | Ga0070672_1000303873 | 252 |
| 85 | 3300005545 | Ga0070695_100006415 | Ga0070695_1000064153 | 252 |
| 86 | 3300005545 | Ga0070695_100012294 | Ga0070695_1000122942 | 252 |
| 87 | 3300005545 | Ga0070695_100204735 | Ga0070695_1002047352 | 252 |
| 88 | 3300005546 | Ga0070696_100001094 | Ga0070696_1000010944 | 252 |
| 89 | 3300005547 | Ga0070693_100000045 | Ga0070693_10000004539 | 252 |
| 90 | 3300005547 | Ga0070693_100258260 | Ga0070693_1002582602 | 252 |
| 91 | 3300005549 | Ga0070704_100000240 | Ga0070704_10000024012 | 252 |
| 92 | 3300005563 | Ga0068855_100000462 | Ga0068855_10000046232 | 252 |
| 93 | 3300005564 | Ga0070664_100002902 | Ga0070664_1000029025 | 252 |
| 94 | 3300005577 | Ga0068857_100008050 | Ga0068857_1000080506 | 252 |
| 95 | 3300005578 | Ga0068854_100007822 | Ga0068854_1000078224 | 252 |
| 96 | 3300005614 | Ga0068856_100002716 | Ga0068856_1000027166 | 252 |
| 97 | 3300005614 | Ga0068856_100171541 | Ga0068856_1001715412 | 252 |
| 98 | 3300005615 | Ga0070702_100056816 | Ga0070702_1000568162 | 252 |
| 99 | 3300005617 | Ga0068859_100002495 | Ga0068859_1000024954 | 252 |
| 100 | 3300005617 | Ga0068859_100102443 | Ga0068859_1001024433 | 252 |
| 101 | 3300005618 | Ga0068864_100001334 | Ga0068864_1000013344 | 252 |
| 102 | 3300005719 | Ga0068861_100009309 | Ga0068861_1000093093 | 252 |
| 103 | 3300005719 | Ga0068861_100077458 | Ga0068861_1000774583 | 252 |
| 104 | 3300005840 | Ga0068870_10000934 | Ga0068870_100009348 | 252 |
| 105 | 3300005840 | Ga0068870_10171846 | Ga0068870_101718462 | 252 |
| 106 | 3300005841 | Ga0068863_100122956 | Ga0068863_1001229563 | 252 |
| 107 | 3300005841 | Ga0068863_100282447 | Ga0068863_1002824472 | 252 |
| 108 | 3300005842 | Ga0068858_100020465 | Ga0068858_1000204654 | 252 |
| 109 | 3300005842 | Ga0068858_100401690 | Ga0068858_1004016902 | 252 |
| 110 | 3300005844 | Ga0068862_100002748 | Ga0068862_1000027484 | 252 |
| 111 | 3300005844 | Ga0068862_100158726 | Ga0068862_1001587262 | 252 |
| 112 | 3300005937 | Ga0081455_10000074 | Ga0081455_1000007466 | 252 |
| 113 | 3300005937 | Ga0081455_10022128 | Ga0081455_100221282 | 252 |
| 114 | 3300005981 | Ga0081538_10056629 | Ga0081538_100566292 | 252 |
| 115 | 3300005983 | Ga0081540_1005226 | Ga0081540_10052266 | 252 |
| 116 | 3300006028 | Ga0070717_10089316 | Ga0070717_100893162 | 252 |
| 117 | 3300006028 | Ga0070717_10107858 | Ga0070717_101078583 | 252 |
| 118 | 3300006038 | Ga0075365_10268910 | Ga0075365_102689102 | 252 |
| 119 | 3300006042 | Ga0075368_10040874 | Ga0075368_100408742 | 252 |
| 120 | 3300006042 | Ga0075368_10057408 | Ga0075368_100574082 | 252 |
| 121 | 3300006051 | Ga0075364_10017964 | Ga0075364_100179642 | 252 |
| 122 | 3300006173 | Ga0070716_100038839 | Ga0070716_1000388392 | 252 |
| 123 | 3300006175 | Ga0070712_100001675 | Ga0070712_1000016755 | 252 |
| 124 | 3300006175 | Ga0070712_100011814 | Ga0070712_1000118143 | 252 |
| 125 | 3300006178 | Ga0075367_10032834 | Ga0075367_100328343 | 252 |
| 126 | 3300006178 | Ga0075367_10050194 | Ga0075367_100501943 | 252 |
| 127 | 3300006178 | Ga0075367_10213776 | Ga0075367_102137762 | 252 |
| 128 | 3300006237 | Ga0097621_100283101 | Ga0097621_1002831012 | 252 |
| 129 | 3300006237 | Ga0097621_100303853 | Ga0097621_1003038532 | 252 |
| 130 | 3300006844 | Ga0075428_100000509 | Ga0075428_1000005098 | 252 |
| 131 | 3300006844 | Ga0075428_100013632 | Ga0075428_1000136322 | 252 |
| 132 | 3300006844 | Ga0075428_100026860 | Ga0075428_1000268603 | 252 |
| 133 | 3300006844 | Ga0075428_100098801 | Ga0075428_1000988012 | 252 |
| 134 | 3300006846 | Ga0075430_100001087 | Ga0075430_1000010871 | 252 |
| 135 | 3300006846 | Ga0075430_100003590 | Ga0075430_10000359011 | 252 |
| 136 | 3300006846 | Ga0075430_100022035 | Ga0075430_1000220354 | 252 |
| 137 | 3300006846 | Ga0075430_100123259 | Ga0075430_1001232592 | 252 |
| 138 | 3300006847 | Ga0075431_100001593 | Ga0075431_1000015939 | 252 |
| 139 | 3300006847 | Ga0075431_100002162 | Ga0075431_10000216219 | 252 |
| 140 | 3300006847 | Ga0075431_100006591 | Ga0075431_1000065913 | 252 |
| 141 | 3300006847 | Ga0075431_100008769 | Ga0075431_1000087693 | 252 |
| 142 | 3300006847 | Ga0075431_100008892 | Ga0075431_1000088929 | 252 |
| 143 | 3300006847 | Ga0075431_100549282 | Ga0075431_1005492822 | 252 |
| 144 | 3300006852 | Ga0075433_10002867 | Ga0075433_100028678 | 252 |
| 145 | 3300006852 | Ga0075433_10006931 | Ga0075433_100069316 | 252 |
| 146 | 3300006852 | Ga0075433_10009404 | Ga0075433_100094043 | 252 |
| 147 | 3300006852 | Ga0075433_10014523 | Ga0075433_100145236 | 252 |
| 148 | 3300006852 | Ga0075433_10024429 | Ga0075433_100244293 | 252 |
| 149 | 3300006852 | Ga0075433_10270788 | Ga0075433_102707882 | 252 |
| 150 | 3300006871 | Ga0075434_100025615 | Ga0075434_1000256152 | 252 |
| 151 | 3300006871 | Ga0075434_100056781 | Ga0075434_1000567814 | 252 |
| 152 | 3300006871 | Ga0075434_100208246 | Ga0075434_1002082462 | 252 |
| 153 | 3300006880 | Ga0075429_100016643 | Ga0075429_1000166435 | 252 |
| 154 | 3300006880 | Ga0075429_100032538 | Ga0075429_1000325385 | 252 |
| 155 | 3300006880 | Ga0075429_100035877 | Ga0075429_1000358774 | 252 |
| 156 | 3300006880 | Ga0075429_100067385 | Ga0075429_1000673852 | 252 |
| 157 | 3300006881 | Ga0068865_100428835 | Ga0068865_1004288352 | 252 |
| 158 | 3300006914 | Ga0075436_100046510 | Ga0075436_1000465102 | 252 |
| 159 | 3300006931 | Ga0097620_100002495 | Ga0097620_10000249514 | 252 |
| 160 | 3300006931 | Ga0097620_100102445 | Ga0097620_1001024453 | 252 |
| 161 | 3300006931 | Ga0097620_100149385 | Ga0097620_1001493852 | 252 |
| 162 | 3300007076 | Ga0075435_100001922 | Ga0075435_10000192212 | 252 |
| 163 | 3300007076 | Ga0075435_100012226 | Ga0075435_1000122262 | 252 |
| 164 | 3300007265 | Ga0099794_10001445 | Ga0099794_100014455 | 252 |
| 165 | 3300009093 | Ga0105240_10242374 | Ga0105240_102423742 | 252 |
| 166 | 3300009093 | Ga0105240_10250558 | Ga0105240_102505582 | 252 |
| 167 | 3300009093 | Ga0105240_10350754 | Ga0105240_103507541 | 252 |
| 168 | 3300009098 | Ga0105245_10020215 | Ga0105245_100202153 | 252 |
| 169 | 3300009098 | Ga0105245_10052690 | Ga0105245_100526903 | 252 |
| 170 | 3300009098 | Ga0105245_10812770 | Ga0105245_108127701 | 252 |
| 171 | 3300009147 | Ga0114129_10008686 | Ga0114129_100086866 | 252 |
| 172 | 3300009147 | Ga0114129_10017939 | Ga0114129_100179393 | 252 |
| 173 | 3300009147 | Ga0114129_10036423 | Ga0114129_100364233 | 252 |
| 174 | 3300009147 | Ga0114129_10043638 | Ga0114129_100436384 | 252 |
| 175 | 3300009147 | Ga0114129_10094036 | Ga0114129_100940363 | 252 |
| 176 | 3300009147 | Ga0114129_10096583 | Ga0114129_100965832 | 252 |
| 177 | 3300009147 | Ga0114129_10269811 | Ga0114129_102698113 | 252 |
| 178 | 3300009147 | Ga0114129_10279334 | Ga0114129_102793342 | 252 |
| 179 | 3300009147 | Ga0114129_10283680 | Ga0114129_102836802 | 252 |
| 180 | 3300009147 | Ga0114129_10377051 | Ga0114129_103770512 | 252 |
| 181 | 3300009545 | Ga0105237_10036167 | Ga0105237_100361672 | 252 |
| 182 | 3300009551 | Ga0105238_10018342 | Ga0105238_100183423 | 252 |
| 183 | 3300009551 | Ga0105238_10536495 | Ga0105238_105364952 | 252 |
| 184 | 3300011119 | Ga0105246_10015068 | Ga0105246_100150685 | 252 |
| 185 | 3300011119 | Ga0105246_10156571 | Ga0105246_101565712 | 252 |
| 186 | 3300013100 | Ga0157373_10000379 | Ga0157373_1000037916 | 252 |
| 187 | 3300013105 | Ga0157369_10062088 | Ga0157369_100620883 | 252 |
| 188 | 3300013296 | Ga0157374_10193562 | Ga0157374_101935623 | 252 |
| 189 | 3300013296 | Ga0157374_10292539 | Ga0157374_102925392 | 252 |
| 190 | 3300013307 | Ga0157372_10000135 | Ga0157372_1000013521 | 252 |
| 191 | 3300014325 | Ga0163163_10114249 | Ga0163163_101142493 | 252 |
| 192 | 3300014325 | Ga0163163_10687182 | Ga0163163_106871822 | 252 |
| 193 | 3300014326 | Ga0157380_10182830 | Ga0157380_101828302 | 252 |
| 194 | 3300014497 | Ga0182008_10016024 | Ga0182008_100160244 | 252 |
| 195 | 3300014969 | Ga0157376_10479090 | Ga0157376_104790902 | 252 |
| 196 | 3300021384 | Ga0213876_10097826 | Ga0213876_100978262 | 252 |
| 197 | 3300021441 | Ga0213871_10008081 | Ga0213871_100080813 | 252 |
| 198 | 3300025885 | Ga0207653_10016807 | Ga0207653_100168072 | 252 |
| 199 | 3300025885 | Ga0207653_10028196 | Ga0207653_100281962 | 252 |
| 200 | 3300025898 | Ga0207692_10053494 | Ga0207692_100534942 | 252 |
| 201 | 3300025904 | Ga0207647_10046585 | Ga0207647_100465853 | 252 |
| 202 | 3300025906 | Ga0207699_10032695 | Ga0207699_100326953 | 252 |
| 203 | 3300025906 | Ga0207699_10257252 | Ga0207699_102572522 | 252 |
| 204 | 3300025907 | Ga0207645_10000075 | Ga0207645_100000753 | 252 |
| 205 | 3300025907 | Ga0207645_10300910 | Ga0207645_103009102 | 252 |
| 206 | 3300025908 | Ga0207643_10000146 | Ga0207643_100001464 | 252 |
| 207 | 3300025910 | Ga0207684_10001638 | Ga0207684_1000163810 | 252 |
| 208 | 3300025910 | Ga0207684_10008109 | Ga0207684_100081094 | 252 |
| 209 | 3300025910 | Ga0207684_10029205 | Ga0207684_100292054 | 252 |
| 210 | 3300025910 | Ga0207684_10090431 | Ga0207684_100904313 | 252 |
| 211 | 3300025912 | Ga0207707_10000135 | Ga0207707_1000013517 | 252 |
| 212 | 3300025912 | Ga0207707_10213425 | Ga0207707_102134251 | 252 |
| 213 | 3300025912 | Ga0207707_10695795 | Ga0207707_106957951 | 252 |
| 214 | 3300025914 | Ga0207671_10090230 | Ga0207671_100902302 | 252 |
| 215 | 3300025915 | Ga0207693_10006864 | Ga0207693_100068644 | 252 |
| 216 | 3300025915 | Ga0207693_10014327 | Ga0207693_100143274 | 252 |
| 217 | 3300025916 | Ga0207663_10092953 | Ga0207663_100929532 | 252 |
| 218 | 3300025916 | Ga0207663_10352981 | Ga0207663_103529811 | 252 |
| 219 | 3300025917 | Ga0207660_10002799 | Ga0207660_100027994 | 252 |
| 220 | 3300025917 | Ga0207660_10129708 | Ga0207660_101297082 | 252 |
| 221 | 3300025918 | Ga0207662_10039973 | Ga0207662_100399732 | 252 |
| 222 | 3300025919 | Ga0207657_10000037 | Ga0207657_1000003773 | 252 |
| 223 | 3300025920 | Ga0207649_10029197 | Ga0207649_100291974 | 252 |
| 224 | 3300025921 | Ga0207652_10001525 | Ga0207652_100015257 | 252 |
| 225 | 3300025922 | Ga0207646_10001729 | Ga0207646_1000172918 | 252 |
| 226 | 3300025922 | Ga0207646_10053456 | Ga0207646_100534562 | 252 |
| 227 | 3300025922 | Ga0207646_10177431 | Ga0207646_101774312 | 252 |
| 228 | 3300025922 | Ga0207646_10305953 | Ga0207646_103059531 | 252 |
| 229 | 3300025923 | Ga0207681_10086853 | Ga0207681_100868532 | 252 |
| 230 | 3300025923 | Ga0207681_10432289 | Ga0207681_104322892 | 252 |
| 231 | 3300025927 | Ga0207687_10098741 | Ga0207687_100987412 | 252 |
| 232 | 3300025927 | Ga0207687_10149773 | Ga0207687_101497732 | 252 |
| 233 | 3300025928 | Ga0207700_10044370 | Ga0207700_100443703 | 252 |
| 234 | 3300025928 | Ga0207700_10055837 | Ga0207700_100558371 | 252 |
| 235 | 3300025928 | Ga0207700_10097002 | Ga0207700_100970022 | 252 |
| 236 | 3300025929 | Ga0207664_10121244 | Ga0207664_101212442 | 252 |
| 237 | 3300025935 | Ga0207709_10042272 | Ga0207709_100422723 | 252 |
| 238 | 3300025939 | Ga0207665_10000576 | Ga0207665_100005764 | 252 |
| 239 | 3300025940 | Ga0207691_10235348 | Ga0207691_102353482 | 252 |
| 240 | 3300025942 | Ga0207689_10000029 | Ga0207689_1000002947 | 252 |
| 241 | 3300025942 | Ga0207689_10039823 | Ga0207689_100398233 | 252 |
| 242 | 3300025945 | Ga0207679_10002294 | Ga0207679_100022944 | 252 |
| 243 | 3300025949 | Ga0207667_10000652 | Ga0207667_1000065215 | 252 |
| 244 | 3300025986 | Ga0207658_10255809 | Ga0207658_102558091 | 252 |
| 245 | 3300026035 | Ga0207703_10053517 | Ga0207703_100535173 | 252 |
| 246 | 3300026035 | Ga0207703_10517025 | Ga0207703_105170252 | 252 |
| 247 | 3300026041 | Ga0207639_10004221 | Ga0207639_100042216 | 252 |
| 248 | 3300026067 | Ga0207678_10005618 | Ga0207678_100056184 | 252 |
| 249 | 3300026075 | Ga0207708_10101271 | Ga0207708_101012712 | 252 |
| 250 | 3300026075 | Ga0207708_10140164 | Ga0207708_101401642 | 252 |
| 251 | 3300026078 | Ga0207702_10007290 | Ga0207702_100072904 | 252 |
| 252 | 3300026078 | Ga0207702_10026562 | Ga0207702_100265622 | 252 |
| 253 | 3300026078 | Ga0207702_10131942 | Ga0207702_101319422 | 252 |
| 254 | 3300026078 | Ga0207702_10148617 | Ga0207702_101486173 | 252 |
| 255 | 3300026078 | Ga0207702_10395325 | Ga0207702_103953252 | 252 |
| 256 | 3300026088 | Ga0207641_10017579 | Ga0207641_100175795 | 252 |
| 257 | 3300026088 | Ga0207641_10117997 | Ga0207641_101179972 | 252 |
| 258 | 3300026088 | Ga0207641_10207381 | Ga0207641_102073812 | 252 |
| 259 | 3300026089 | Ga0207648_10000552 | Ga0207648_1000055210 | 252 |
| 260 | 3300026089 | Ga0207648_10181539 | Ga0207648_101815392 | 252 |
| 261 | 3300026089 | Ga0207648_10755362 | Ga0207648_107553621 | 252 |
| 262 | 3300026095 | Ga0207676_10152463 | Ga0207676_101524632 | 252 |
| 263 | 3300026116 | Ga0207674_10000306 | Ga0207674_1000030632 | 252 |
| 264 | 3300026116 | Ga0207674_10173949 | Ga0207674_101739492 | 252 |
| 265 | 3300026116 | Ga0207674_10502401 | Ga0207674_105024012 | 252 |
| 266 | 3300026118 | Ga0207675_100010607 | Ga0207675_1000106074 | 252 |
| 267 | 3300026118 | Ga0207675_100563574 | Ga0207675_1005635742 | 252 |
| 268 | 3300027671 | Ga0209588_1000952 | Ga0209588_10009525 | 252 |
| 269 | 3300027866 | Ga0209813_10141234 | Ga0209813_101412341 | 252 |
| 270 | 3300028380 | Ga0268265_10003670 | Ga0268265_1000367011 | 252 |
| 271 | 3300028381 | Ga0268264_10038337 | Ga0268264_100383372 | 252 |
| 272 | 3300028556 | Ga0265337_1040913 | Ga0265337_10409132 | 252 |
| 273 | 3300028800 | Ga0265338_10009595 | Ga0265338_100095954 | 252 |
| 274 | 3300028800 | Ga0265338_10454592 | Ga0265338_104545921 | 252 |
| 275 | 3300031090 | Ga0265760_10019952 | Ga0265760_100199521 | 252 |
| 276 | 3300031251 | Ga0265327_10000402 | Ga0265327_1000040229 | 252 |
| 277 | 3300031548 | Ga0307408_100032995 | Ga0307408_1000329951 | 252 |
| 278 | 3300031727 | Ga0316576_10011200 | Ga0316576_100112003 | 252 |
| 279 | 3300031727 | Ga0316576_10058556 | Ga0316576_100585563 | 252 |
| 280 | 3300031727 | Ga0316576_10431940 | Ga0316576_104319401 | 252 |
| 281 | 3300031728 | Ga0316578_10077451 | Ga0316578_100774511 | 252 |
| 282 | 3300031903 | Ga0307407_10005606 | Ga0307407_100056065 | 252 |
| 283 | 3300031903 | Ga0307407_10063635 | Ga0307407_100636352 | 252 |
| 284 | 3300032002 | Ga0307416_100184177 | Ga0307416_1001841772 | 252 |
| 285 | 3300032002 | Ga0307416_100193529 | Ga0307416_1001935293 | 252 |
| 286 | 3300034817 | Ga0373948_0005769 | Ga0373948_0005769_949_1707 | 252 |
| 287 | 3300035086 | Ga0373934_0034242 | Ga0373934_0034242_1092_1856 | 252 |
| 288 | 3300035088 | Ga0373940_0057617 | Ga0373940_0057617_266_1027 | 252 |
| 289 | 3300035090 | Ga0373949_0050283 | Ga0373949_0050283_237_995 | 252 |
| 290 | 3300035091 | Ga0373951_0008323 | Ga0373951_0008323_421_1179 | 252 |
| 291 | 3300035111 | Ga0373923_0014012 | Ga0373923_0014012_429_1193 | 252 |
| 292 | 3300035111 | Ga0373923_0020697 | Ga0373923_0020697_1105_1869 | 252 |
| 293 | 3300035113 | Ga0373936_0165209 | Ga0373936_0165209_111_875 | 252 |
| 294 | 3300035114 | Ga0373939_0021188 | Ga0373939_0021188_727_1485 | 252 |
| 295 | 3300035115 | Ga0373941_0004881 | Ga0373941_0004881_416_1174 | 252 |
| 296 | 3300035117 | Ga0373953_0070551 | Ga0373953_0070551_256_1020 | 252 |
| 297 | 3300035118 | Ga0373954_0094685 | Ga0373954_0094685_28_792 | 252 |
| 298 | 3300035120 | Ga0373957_0082232 | Ga0373957_0082232_156_920 | 252 |
| 299 | 3300035170 | Ga0373943_0071610 | Ga0373943_0071610_484_1248 | 252 |
| 300 | 3300035171 | Ga0373946_0014654 | Ga0373946_0014654_64_828 | 252 |
| 301 | 3300035172 | Ga0373955_0174843 | Ga0373955_0174843_102_866 | 252 |
| 302 | 3300035241 | Ga0373961_0002358 | Ga0373961_0002358_1639_2397 | 252 |
| 303 | 3300035242 | Ga0373962_0008549 | Ga0373962_0008549_1260_2018 | 252 |
| 304 | 3300035398 | Ga0316574_0032975 | Ga0316574_0032975_73_864 | 252 |
| 305 | 3300035410 | Ga0373924_0009511 | Ga0373924_0009511_275_1039 | 252 |
| 306 | 3300035410 | Ga0373924_0012767 | Ga0373924_0012767_1915_2679 | 252 |
| 307 | 3300035691 | Ga0373931_0095536 | Ga0373931_0095536_295_1053 | 252 |
| 308 | 3300035695 | Ga0373927_0262925 | Ga0373927_0262925_290_1054 | 252 |
| 309 | 3300035695 | Ga0373927_0329737 | Ga0373927_0329737_35_799 | 252 |
| 310 | 3300035724 | Ga0373933_0024850 | Ga0373933_0024850_1995_2759 | 252 |
| 311 | 3300036401 | Ga0373937_0044781 | Ga0373937_0044781_1247_2011 | 252 |
| 312 | 3300036401 | Ga0373937_0093621 | Ga0373937_0093621_1020_1784 | 252 |
| 313 | 3300036712 | Ga0316584_0012965 | Ga0316584_0012965_1781_2572 | 252 |
| 314 | 3300037068 | Ga0373925_0012187 | Ga0373925_0012187_4662_5426 | 252 |
| 315 | 3300037068 | Ga0373925_0039472 | Ga0373925_0039472_129_893 | 252 |
| 316 | 3300037068 | Ga0373925_0315682 | Ga0373925_0315682_131_895 | 252 |
| 317 | 3300037312 | Ga0395899_0102020 | Ga0395899_0102020_259_1017 | 252 |
| 318 | 3300037466 | Ga0395898_0658260 | Ga0395898_0658260_214_972 | 252 |
| 319 | 3300037471 | Ga0395905_0053364 | Ga0395905_0053364_2004_2762 | 252 |
| 320 | 3300037853 | Ga0436364_0149728 | Ga0436364_0149728_193_960 | 252 |
| 321 | 3300037853 | Ga0436364_0700812 | Ga0436364_0700812_449_1213 | 252 |
| 322 | 3300037853 | Ga0436364_1396155 | Ga0436364_1396155_1835_2599 | 252 |
| 323 | 3300038443 | Ga0395901_0300327 | Ga0395901_0300327_103_861 | 252 |
| 324 | 3300039062 | Ga0400483_162612 | Ga0400483_162612_18989_19762 | 252 |
| 325 | 3300039438 | Ga0436360_0365160 | Ga0436360_0365160_158_916 | 252 |
| 326 | 3300039438 | Ga0436360_1043819 | Ga0436360_1043819_1432_2199 | 252 |
| 327 | 3300039438 | Ga0436360_1253789 | Ga0436360_1253789_78_842 | 252 |
| 328 | 3300039447 | Ga0436361_1133418 | Ga0436361_1133418_2146_2922 | 252 |
| 329 | 3300039450 | Ga0436363_0063999 | Ga0436363_0063999_17_784 | 252 |
| 330 | 3300039450 | Ga0436363_1495745 | Ga0436363_1495745_226_990 | 252 |
| 331 | 3300039453 | Ga0436362_1042850 | Ga0436362_1042850_54_821 | 252 |
| 332 | 3300041413 | Ga0439465_0014267 | Ga0439465_0014267_22_786 | 252 |
| 333 | 3300042005 | Ga0439448_0019399 | Ga0439448_0019399_69_827 | 252 |
| 334 | 3300042007 | Ga0439449_0008350 | Ga0439449_0008350_1175_1978 | 252 |
| 335 | 3300042008 | Ga0439450_006251 | Ga0439450_006251_1150_1908 | 252 |
| 336 | 3300042144 | Ga0450889_005015 | Ga0450889_005015_64_822 | 252 |
| 337 | 3300042437 | Ga0439444_0005857 | Ga0439444_0005857_418_1176 | 252 |
| 338 | 3300042438 | Ga0439459_0003228 | Ga0439459_0003228_138_896 | 252 |
| 339 | 3300042439 | Ga0439464_0007480 | Ga0439464_0007480_1707_2465 | 252 |
| 340 | 3300042461 | Ga0439460_0000701 | Ga0439460_0000701_2898_3656 | 252 |
| 341 | 3300042461 | Ga0439460_0031146 | Ga0439460_0031146_134_892 | 252 |
| 342 | 3300042876 | Ga0451577_0092204 | Ga0451577_0092204_1920_2681 | 252 |
| 343 | 3300042876 | Ga0451577_0114693 | Ga0451577_0114693_443_1201 | 252 |
| 344 | 3300042876 | Ga0451577_0329779 | Ga0451577_0329779_58_837 | 252 |
| 345 | 3300044673 | Ga0453683_0013899 | Ga0453683_0013899_3896_4654 | 252 |
| 346 | 3300044712 | Ga0453684_0061871 | Ga0453684_0061871_3155_3913 | 252 |
| 347 | 3300044712 | Ga0453684_0325764 | Ga0453684_0325764_125_904 | 252 |
| 348 | 3300044712 | Ga0453684_0715734 | Ga0453684_0715734_30_824 | 252 |
| 349 | 3300045051 | Ga0451576_0056116 | Ga0451576_0056116_1287_2045 | 252 |
| 350 | 3300045051 | Ga0451576_0219841 | Ga0451576_0219841_543_1301 | 252 |
| 351 | 3300045051 | Ga0451576_0262034 | Ga0451576_0262034_271_1029 | 252 |
| 352 | 3300045836 | Ga0466958_0091451 | Ga0466958_0091451_994_1758 | 252 |
| 353 | 3300046454 | Ga0495592_0171809 | Ga0495592_0171809_536_1300 | 252 |
| 354 | 3300046462 | Ga0495651_0237985 | Ga0495651_0237985_158_922 | 252 |
| 355 | 3300046462 | Ga0495651_0417970 | Ga0495651_0417970_98_862 | 252 |
| 356 | 3300046471 | Ga0495650_0069753 | Ga0495650_0069753_466_1230 | 252 |
| 357 | 3300046472 | Ga0495580_0034739 | Ga0495580_0034739_2010_2768 | 252 |
| 358 | 3300046477 | Ga0495664_0006389 | Ga0495664_0006389_3057_3821 | 252 |
| 359 | 3300046511 | Ga0495608_0002977 | Ga0495608_0002977_10419_11183 | 252 |
| 360 | 3300046511 | Ga0495608_0034326 | Ga0495608_0034326_1536_2300 | 252 |
| 361 | 3300046533 | Ga0495640_0048271 | Ga0495640_0048271_180_956 | 252 |
| 362 | 3300046533 | Ga0495640_0113205 | Ga0495640_0113205_76_840 | 252 |
| 363 | 3300046536 | Ga0495587_0249254 | Ga0495587_0249254_129_893 | 252 |
| 364 | 3300046542 | Ga0495597_0000028 | Ga0495597_0000028_84162_84941 | 252 |
| 365 | 3300046543 | Ga0495645_0000478 | Ga0495645_0000478_25789_26553 | 252 |
| 366 | 3300046559 | Ga0495667_0020698 | Ga0495667_0020698_1980_2744 | 252 |
| 367 | 3300046678 | Ga0495599_0035562 | Ga0495599_0035562_2041_2805 | 252 |
| 368 | 3300046809 | Ga0495600_0047741 | Ga0495600_0047741_1109_1873 | 252 |
| 369 | 3300047318 | Ga0495636_0134249 | Ga0495636_0134249_184_942 | 252 |
| 370 | 3300047319 | Ga0495674_0064825 | Ga0495674_0064825_1997_2761 | 252 |
| 371 | 3300047319 | Ga0495674_0073827 | Ga0495674_0073827_1924_2754 | 252 |
| 372 | 3300047444 | Ga0495675_0003932 | Ga0495675_0003932_2677_3441 | 252 |
| 373 | 3300047471 | Ga0495684_0029112 | Ga0495684_0029112_583_1359 | 252 |
| 374 | 3300047471 | Ga0495684_0414421 | Ga0495684_0414421_50_910 | 252 |
| 375 | 3300048088 | Ga0495602_0001497 | Ga0495602_0001497_9308_10072 | 252 |
| 376 | 3300048088 | Ga0495602_0127663 | Ga0495602_0127663_1005_1775 | 252 |
| 377 | 3300048905 | Ga0496102_0032773 | Ga0496102_0032773_1790_2548 | 252 |
| 378 | 3300048909 | Ga0496106_0544086 | Ga0496106_0544086_34_792 | 252 |
| 379 | 3300048910 | Ga0496107_0301477 | Ga0496107_0301477_381_1139 | 252 |
| 380 | 3300048915 | Ga0496112_0056779 | Ga0496112_0056779_593_1351 | 252 |
| 381 | 3300048922 | Ga0496119_0018323 | Ga0496119_0018323_4053_4823 | 252 |
| 382 | 3300049574 | Ga0501038_0101381 | Ga0501038_0101381_1331_2089 | 252 |
| 383 | 3300049576 | Ga0501040_0075021 | Ga0501040_0075021_302_1060 | 252 |
| 384 | 3300049578 | Ga0501042_0057796 | Ga0501042_0057796_441_1199 | 252 |
| 385 | 3300049580 | Ga0501046_0210631 | Ga0501046_0210631_346_1104 | 252 |
| 386 | 3300049582 | Ga0501048_0570376 | Ga0501048_0570376_10_768 | 252 |
| 387 | 3300049584 | Ga0501068_0113202 | Ga0501068_0113202_731_1489 | 252 |
| 388 | 3300049587 | Ga0501071_0071383 | Ga0501071_0071383_1202_1960 | 252 |
| 389 | 3300049587 | Ga0501071_0411543 | Ga0501071_0411543_250_1008 | 252 |
| 390 | 3300049588 | Ga0501072_0041603 | Ga0501072_0041603_1173_1931 | 252 |
| 391 | 3300049588 | Ga0501072_0275505 | Ga0501072_0275505_132_890 | 252 |
| 392 | 3300049591 | Ga0501075_0022010 | Ga0501075_0022010_2329_3087 | 252 |
| 393 | 3300049591 | Ga0501075_0024071 | Ga0501075_0024071_1457_2215 | 252 |
| 394 | 3300049591 | Ga0501075_0250069 | Ga0501075_0250069_139_897 | 252 |
| 395 | 3300049591 | Ga0501075_0320901 | Ga0501075_0320901_175_933 | 252 |
| 396 | 3300049592 | Ga0501076_0006750 | Ga0501076_0006750_6683_7441 | 252 |
| 397 | 3300049593 | Ga0501077_0012001 | Ga0501077_0012001_2419_3177 | 252 |
| 398 | 3300049593 | Ga0501077_0037049 | Ga0501077_0037049_1998_2756 | 252 |
| 399 | 3300049593 | Ga0501077_0174295 | Ga0501077_0174295_445_1203 | 252 |
| 400 | 3300049741 | Ga0501079_0023873 | Ga0501079_0023873_3790_4548 | 252 |
| 401 | 3300049741 | Ga0501079_0026176 | Ga0501079_0026176_364_1122 | 252 |
| 402 | 3300049742 | Ga0501080_0632796 | Ga0501080_0632796_168_926 | 252 |
| 403 | 3300049743 | Ga0501081_0061560 | Ga0501081_0061560_346_1104 | 252 |
| 404 | 3300049743 | Ga0501081_0145302 | Ga0501081_0145302_481_1239 | 252 |
| 405 | 3300049743 | Ga0501081_0265888 | Ga0501081_0265888_481_1239 | 252 |
| 406 | 3300050491 | nmdc:mga00v17_29366_c1 | nmdc:mga00v17_29366_c1_1843_2607 | 252 |
| 407 | 3300050492 | nmdc:mga0yw44_238611_c1 | nmdc:mga0yw44_238611_c1_289_1053 | 252 |
| 408 | 3300050494 | nmdc:mga06z11_5116_c1 | nmdc:mga06z11_5116_c1_1640_2404 | 252 |
| 409 | 3300050495 | nmdc:mga04h51_164617_c1 | nmdc:mga04h51_164617_c1_56_820 | 252 |
| 410 | 3300050496 | nmdc:mga07m45_9291_c1 | nmdc:mga07m45_9291_c1_1041_1805 | 252 |
| 411 | 3300050507 | nmdc:mga05p37_128788_c1 | nmdc:mga05p37_128788_c1_849_1607 | 252 |
| 412 | 3300050507 | nmdc:mga05p37_15169_c1 | nmdc:mga05p37_15169_c1_8109_8867 | 252 |
| 413 | 3300050507 | nmdc:mga05p37_175237_c1 | nmdc:mga05p37_175237_c1_1703_2461 | 252 |
| 414 | 3300050507 | nmdc:mga05p37_23681_c1 | nmdc:mga05p37_23681_c1_3048_3806 | 252 |
| 415 | 3300050507 | nmdc:mga05p37_70724_c1 | nmdc:mga05p37_70724_c1_589_1359 | 252 |
| 416 | 3300050507 | nmdc:mga05p37_92760_c1 | nmdc:mga05p37_92760_c1_1238_1996 | 252 |
| 417 | 3300050507 | nmdc:mga05p37_99353_c1 | nmdc:mga05p37_99353_c1_503_1261 | 252 |
| 418 | 3300050508 | nmdc:mga09592_14974_c1 | nmdc:mga09592_14974_c1_3641_4399 | 252 |
| 419 | 3300050508 | nmdc:mga09592_31534_c1 | nmdc:mga09592_31534_c1_189_959 | 252 |
| 420 | 3300050508 | nmdc:mga09592_61627_c1 | nmdc:mga09592_61627_c1_1462_2220 | 252 |
| 421 | 3300050509 | nmdc:mga0qj67_100476_c1 | nmdc:mga0qj67_100476_c1_664_1443 | 252 |
| 422 | 3300050509 | nmdc:mga0qj67_12889_c1 | nmdc:mga0qj67_12889_c1_4890_5669 | 252 |
| 423 | 3300050509 | nmdc:mga0qj67_235915_c1 | nmdc:mga0qj67_235915_c1_187_945 | 252 |
| 424 | 3300050509 | nmdc:mga0qj67_2387_c1 | nmdc:mga0qj67_2387_c1_11783_12541 | 252 |
| 425 | 3300050509 | nmdc:mga0qj67_39409_c1 | nmdc:mga0qj67_39409_c1_1380_2138 | 252 |
| 426 | 3300050510 | nmdc:mga06r32_17872_c1 | nmdc:mga06r32_17872_c1_3478_4236 | 252 |
| 427 | 3300050510 | nmdc:mga06r32_33942_c1 | nmdc:mga06r32_33942_c1_157_915 | 252 |
| 428 | 3300050510 | nmdc:mga06r32_428636_c1 | nmdc:mga06r32_428636_c1_506_1264 | 252 |
| 429 | 3300050510 | nmdc:mga06r32_468909_c1 | nmdc:mga06r32_468909_c1_52_822 | 252 |
| 430 | 3300050510 | nmdc:mga06r32_538263_c1 | nmdc:mga06r32_538263_c1_255_1022 | 252 |
| 431 | 3300050510 | nmdc:mga06r32_693_c1 | nmdc:mga06r32_693_c1_19960_20718 | 252 |
| 432 | 3300050512 | nmdc:mga0n895_16764_c1 | nmdc:mga0n895_16764_c1_4363_5121 | 252 |
| 433 | 3300050512 | nmdc:mga0n895_467341_c1 | nmdc:mga0n895_467341_c1_155_913 | 252 |
| 434 | 3300050512 | nmdc:mga0n895_472094_c1 | nmdc:mga0n895_472094_c1_336_1094 | 252 |
| 435 | 3300050512 | nmdc:mga0n895_53578_c1 | nmdc:mga0n895_53578_c1_997_1755 | 252 |
| 436 | 3300050512 | nmdc:mga0n895_87294_c1 | nmdc:mga0n895_87294_c1_2297_3055 | 252 |
| 437 | 3300050513 | nmdc:mga0rr50_326363_c1 | nmdc:mga0rr50_326363_c1_468_1226 | 252 |
| 438 | 3300050513 | nmdc:mga0rr50_405060_c1 | nmdc:mga0rr50_405060_c1_272_1030 | 252 |
| 439 | 3300050514 | nmdc:mga08x19_167955_c1 | nmdc:mga08x19_167955_c1_320_1078 | 252 |
| 440 | 3300050515 | nmdc:mga0a205_128_c1 | nmdc:mga0a205_128_c1_27015_27773 | 252 |
| 441 | 3300050515 | nmdc:mga0a205_182443_c1 | nmdc:mga0a205_182443_c1_849_1607 | 252 |
| 442 | 3300050515 | nmdc:mga0a205_305428_c1 | nmdc:mga0a205_305428_c1_450_1208 | 252 |
| 443 | 3300050515 | nmdc:mga0a205_35617_c1 | nmdc:mga0a205_35617_c1_2967_3725 | 252 |
| 444 | 3300053077 | Ga0495601_0008121 | Ga0495601_0008121_4847_5611 | 252 |
| 445 | 3300053077 | Ga0495601_0212150 | Ga0495601_0212150_61_825 | 252 |
| 446 | 3300053078 | Ga0495612_0004257 | Ga0495612_0004257_2279_3043 | 252 |
| 447 | 3300053122 | Ga0500608_006441 | Ga0500608_006441_2576_3334 | 252 |
| 448 | 3300053139 | Ga0500568_0054740 | Ga0500568_0054740_28_792 | 252 |
| 449 | 3300054114 | Ga0501084_0004982 | Ga0501084_0004982_2071_2829 | 252 |
| 450 | 3300054114 | Ga0501084_0028822 | Ga0501084_0028822_717_1475 | 252 |
| 451 | 3300054114 | Ga0501084_0069294 | Ga0501084_0069294_183_941 | 252 |
| 452 | 3300054114 | Ga0501084_0152895 | Ga0501084_0152895_466_1224 | 252 |
| 453 | 3300060353 | Ga0501082_0112031 | Ga0501082_0112031_190_948 | 252 |
| 454 | 3300060353 | Ga0501082_0277302 | Ga0501082_0277302_467_1225 | 252 |
| 455 | 3300060353 | Ga0501082_0474801 | Ga0501082_0474801_276_1034 | 252 |
| 456 | 3300061734 | Ga0530510_0025883 | Ga0530510_0025883_541_1299 | 252 |
| 457 | 3300061734 | Ga0530510_0042453 | Ga0530510_0042453_2471_3229 | 252 |
| 458 | 3300061734 | Ga0530510_0078164 | Ga0530510_0078164_1023_1781 | 252 |
| 459 | iso_pu_bacteria | 2643221604 | 2644032992 | 252 |
| 460 | iso_pu_bacteria | 2894023352 | 2894025410 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9241 | 4 | 245 |
| 4jbw-assembly1.cif.gz_A | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9214 | 4 | 239 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9202 | 1 | 240 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9174 | 1 | 240 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9142 | 4 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9637 | 3 | 252 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9562 | 3 | 252 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9351 | 2 | 236 | 3.40.50.300 |
| af_P07821_3_262_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9342 | 2 | 249 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9332 | 4 | 234 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0WPJ1-F1-model_v4 | High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | 0.9726 | 1 | 252 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A7W3T3T6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9723 | 5 | 251 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7C3YY79-F1-model_v4 | ABC transporter ATP-binding protein | 0.9706 | 1 | 251 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A1F9DPH1-F1-model_v4 | ABC transporter domain-containing protein | 0.9692 | 2 | 252 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A3C0WPJ1-F1-model_v4 | High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | 0.9689 | 1 | 252 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar