F448626

General Info

Members Datasets Scaffolds Average Seq Length
460 215 460 248

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0007019|Ga0501068_0007019_5352_6119
Length 238
Sequence VIVRVGHLYPEYLNIYADRGNIAVLERRAAWRGHELAVTPIGLGDALEPGAHDLLYVGGGQDREQALIAPDLAAKGDAIAALGRGYRGRDGSTMPGAGLFPHETVAGERRMIGDVLLECELDPGERRTVAGFENHAGRTRLDPGAVPLGRVVAGFGNDGESGFEGCRVGTALGTYLHGPLLPRNPWLADWLLSRALAHATGEAPRPLEPLPDELERQAHAVSAGRARERGGRGLCGIS

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 6.3
Rhizosphere 92.39
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100067996 3300005329 Bacteria 3319
2 Ga0070683_100096565 3300005329 Bacteria 2780
3 Ga0070690_100109295 3300005330 Bacteria 1843
4 Ga0070691_10012479 3300005341 Bacteria 3891
5 Ga0070691_10036046 3300005341 Bacteria 2330
6 Ga0070687_100062784 3300005343 Bacteria 1968
7 Ga0070692_10011357 3300005345 Bacteria 4085
8 Ga0070668_100009363 3300005347 Bacteria 7266
9 Ga0070674_100125068 3300005356 Bacteria 1908
10 Ga0070674_100359806 3300005356 Bacteria 1178
11 Ga0070659_100274265 3300005366 Bacteria 1402
12 Ga0070703_10020086 3300005406 Bacteria 1941
13 Ga0070714_100119901 3300005435 Bacteria 2339
14 Ga0070713_100115062 3300005436 Bacteria 2350
15 Ga0070710_10013927 3300005437 Bacteria 4037
16 Ga0070701_10125896 3300005438 Bacteria 1450
17 Ga0070701_10222566 3300005438 Bacteria 1126
18 Ga0070705_100045000 3300005440 Bacteria 2537
19 Ga0070700_100018858 3300005441 Bacteria 3973
20 Ga0070700_100094422 3300005441 Bacteria 1958
21 Ga0070681_10470834 3300005458 Bacteria 1169
22 Ga0068867_100304142 3300005459 Bacteria 1316
23 Ga0068867_100321084 3300005459 Unclassified 1283
24 Ga0070685_10270933 3300005466 Bacteria 1133
25 Ga0070706_100153861 3300005467 Bacteria 2147
26 Ga0070707_100093164 3300005468 Bacteria 2917
27 Ga0070698_100004043 3300005471 Bacteria 16137
28 Ga0070698_100006972 3300005471 Bacteria 12237
29 Ga0070698_100033852 3300005471 Bacteria 5293
30 Ga0070699_100014550 3300005518 Bacteria 6768
31 Ga0070699_100139917 3300005518 Unclassified 2137
32 Ga0070697_100270287 3300005536 Bacteria 1457
33 Ga0070672_100279917 3300005543 Bacteria 1410
34 Ga0070686_100132507 3300005544 Bacteria 1725
35 Ga0070686_100135967 3300005544 Bacteria 1706
36 Ga0070695_100084576 3300005545 Bacteria 2105
37 Ga0070693_100025509 3300005547 Bacteria 3183
38 Ga0070704_100058703 3300005549 Bacteria 2741
39 Ga0070704_100177899 3300005549 Bacteria 1699
40 Ga0068855_100142692 3300005563 Bacteria 2728
41 Ga0068855_100361295 3300005563 Bacteria 1598
42 Ga0068857_100116991 3300005577 Unclassified 2399
43 Ga0070702_100006382 3300005615 Bacteria 5578
44 Ga0070702_100049406 3300005615 Bacteria 2398
45 Ga0068859_100364110 3300005617 Unclassified 1541
46 Ga0068866_10272768 3300005718 Bacteria 1045
47 Ga0068866_10359357 3300005718 Bacteria 928
48 Ga0068861_100228827 3300005719 Bacteria 1576
49 Ga0068860_100296896 3300005843 Bacteria 1582
50 Ga0068860_100393907 3300005843 Bacteria 1369
51 Ga0081455_10017728 3300005937 Bacteria 6813
52 Ga0081455_10108018 3300005937 Bacteria 2217
53 Ga0081538_10000057 3300005981 Bacteria 102521
54 Ga0081539_10000041 3300005985 Bacteria 292660
55 Ga0081539_10020311 3300005985 Bacteria 4497
56 Ga0075365_10042218 3300006038 Bacteria 2981
57 Ga0075365_10171365 3300006038 Bacteria 1515
58 Ga0070712_100040160 3300006175 Bacteria 3206
59 Ga0075428_100032779 3300006844 Bacteria 5737
60 Ga0075428_100083770 3300006844 Bacteria 3479
61 Ga0075428_100268382 3300006844 Bacteria 1836
62 Ga0075428_101072793 3300006844 Unclassified 851
63 Ga0075430_100237238 3300006846 Bacteria 1511
64 Ga0075431_100611717 3300006847 Bacteria 1073
65 Ga0075434_100005176 3300006871 Bacteria 11840
66 Ga0075429_100016896 3300006880 Bacteria 6313
67 Ga0097620_100364127 3300006931 Unclassified 1541
68 Ga0105240_10434144 3300009093 Bacteria 1473
69 Ga0111539_10004593 3300009094 Bacteria 18043
70 Ga0111539_10007332 3300009094 Bacteria 14124
71 Ga0111539_10017628 3300009094 Bacteria 8840
72 Ga0111539_10302749 3300009094 Bacteria 1860
73 Ga0111539_10940458 3300009094 Bacteria 1005
74 Ga0111539_11247330 3300009094 Bacteria 863
75 Ga0105245_10059581 3300009098 Bacteria 3438
76 Ga0105245_10155361 3300009098 Bacteria 2166
77 Ga0105245_10230602 3300009098 Bacteria 1791
78 Ga0105245_10309239 3300009098 Bacteria 1553
79 Ga0105245_10316992 3300009098 Bacteria 1535
80 Ga0105245_10376241 3300009098 Bacteria 1413
81 Ga0114129_10010978 3300009147 Bacteria 12905
82 Ga0114129_10017065 3300009147 Bacteria 10335
83 Ga0114129_10180333 3300009147 Bacteria 2874
84 Ga0114129_11345026 3300009147 Bacteria 883
85 Ga0105243_10135815 3300009148 Bacteria 2092
86 Ga0105243_10243663 3300009148 Bacteria 1601
87 Ga0105243_10674276 3300009148 Bacteria 1005
88 Ga0105242_10495810 3300009176 Bacteria 1161
89 Ga0105248_10024828 3300009177 Bacteria 6664
90 Ga0105237_10114600 3300009545 Unclassified 2688
91 Ga0105238_10732183 3300009551 Bacteria 1002
92 Ga0105249_10010851 3300009553 Bacteria 8006
93 Ga0105249_10036826 3300009553 Bacteria 4439
94 Ga0105249_10099670 3300009553 Bacteria 2731
95 Ga0105249_10217612 3300009553 Bacteria 1878
96 Ga0105249_10331437 3300009553 Bacteria 1536
97 Ga0105249_10648983 3300009553 Bacteria 1113
98 Ga0105239_10038088 3300010375 Bacteria 5268
99 Ga0105239_10071415 3300010375 Bacteria 3814
100 Ga0105246_10038708 3300011119 Bacteria 3208
101 Ga0105246_10042765 3300011119 Bacteria 3069
102 Ga0105246_10137451 3300011119 Bacteria 1833
103 Ga0157371_10173040 3300013102 Bacteria 1543
104 Ga0157378_10096259 3300013297 Bacteria 2697
105 Ga0163162_10021629 3300013306 Bacteria 6336
106 Ga0157372_10506307 3300013307 Bacteria 1408
107 Ga0157375_10598480 3300013308 Bacteria 1262
108 Ga0163163_10121714 3300014325 Bacteria 2643
109 Ga0157377_10004169 3300014745 Bacteria 6605
110 Ga0157379_10367281 3300014968 Bacteria 1319
111 Ga0157376_10001321 3300014969 Bacteria 16360
112 Ga0157376_10006667 3300014969 Bacteria 8175
113 Ga0157376_10153912 3300014969 Bacteria 2077
114 Ga0163161_10333347 3300017792 Bacteria 1202
115 Ga0207688_10090435 3300025901 Bacteria 1757
116 Ga0207699_10063470 3300025906 Bacteria 2231
117 Ga0207645_10152386 3300025907 Bacteria 1509
118 Ga0207643_10047908 3300025908 Bacteria 2420
119 Ga0207707_10488020 3300025912 Bacteria 1052
120 Ga0207693_10006295 3300025915 Bacteria 9849
121 Ga0207693_10009157 3300025915 Bacteria 8083
122 Ga0207662_10122143 3300025918 Bacteria 1634
123 Ga0207657_10058167 3300025919 Bacteria 3328
124 Ga0207652_10497717 3300025921 Bacteria 1097
125 Ga0207646_10022680 3300025922 Bacteria 5779
126 Ga0207659_10055915 3300025926 Bacteria 2824
127 Ga0207687_10043101 3300025927 Bacteria 3108
128 Ga0207687_10134510 3300025927 Bacteria 1868
129 Ga0207700_10046069 3300025928 Bacteria 3223
130 Ga0207700_10229957 3300025928 Bacteria 1576
131 Ga0207690_10061569 3300025932 Bacteria 2552
132 Ga0207690_10398266 3300025932 Bacteria 1097
133 Ga0207706_10008758 3300025933 Bacteria 9313
134 Ga0207706_10042968 3300025933 Bacteria 4005
135 Ga0207706_10052165 3300025933 Bacteria 3611
136 Ga0207669_10073460 3300025937 Bacteria 2158
137 Ga0207704_10653708 3300025938 Bacteria 866
138 Ga0207665_10144486 3300025939 Bacteria 1699
139 Ga0207691_10305008 3300025940 Bacteria 1367
140 Ga0207661_10019751 3300025944 Bacteria 5029
141 Ga0207667_10413289 3300025949 Bacteria 1373
142 Ga0207712_10042305 3300025961 Bacteria 3136
143 Ga0207712_10220788 3300025961 Bacteria 1515
144 Ga0207668_10036930 3300025972 Bacteria 3266
145 Ga0207640_10130749 3300025981 Bacteria 1814
146 Ga0207640_10185645 3300025981 Bacteria 1563
147 Ga0207677_10149773 3300026023 Bacteria 1798
148 Ga0207677_10231675 3300026023 Bacteria 1488
149 Ga0207703_10131085 3300026035 Unclassified 2165
150 Ga0207639_10097922 3300026041 Bacteria 2363
151 Ga0207708_10009212 3300026075 Bacteria 7307
152 Ga0207708_10038461 3300026075 Bacteria 3644
153 Ga0207702_10023418 3300026078 Bacteria 5121
154 Ga0207641_10890209 3300026088 Bacteria 884
155 Ga0207648_10031354 3300026089 Bacteria 4700
156 Ga0207648_10041718 3300026089 Bacteria 4030
157 Ga0207648_10178107 3300026089 Bacteria 1881
158 Ga0207674_10006223 3300026116 Bacteria 14068
159 Ga0207674_10026768 3300026116 Bacteria 6117
160 Ga0207675_100007556 3300026118 Bacteria 10270
161 Ga0207675_100092754 3300026118 Bacteria 2840
162 Ga0207683_10162696 3300026121 Bacteria 2018
163 Ga0207428_10009220 3300027907 Bacteria 8864
164 Ga0207428_10009605 3300027907 Bacteria 8666
165 Ga0268265_10051134 3300028380 Bacteria 3118
166 Ga0268264_10530423 3300028381 Bacteria 1152
167 Ga0307408_100025364 3300031548 Bacteria 4061
168 Ga0307408_100298735 3300031548 Bacteria 1348
169 Ga0307413_10003425 3300031824 Bacteria 6671
170 Ga0307410_10090673 3300031852 Bacteria 2168
171 Ga0307406_10030824 3300031901 Bacteria 3260
172 Ga0307406_10106086 3300031901 Bacteria 1924
173 Ga0307412_10097390 3300031911 Unclassified 2073
174 Ga0307409_100011218 3300031995 Bacteria 5633
175 Ga0307409_100035980 3300031995 Bacteria 3634
176 Ga0307409_100207906 3300031995 Bacteria 1756
177 Ga0307416_100001425 3300032002 Bacteria 12993
178 Ga0307416_100012791 3300032002 Bacteria 5674
179 Ga0307416_100380294 3300032002 Bacteria 1442
180 Ga0307416_101009881 3300032002 Bacteria 935
181 Ga0307414_10178078 3300032004 Bacteria 1707
182 Ga0307415_100000286 3300032126 Bacteria 21920
183 Ga0307415_100014075 3300032126 Bacteria 4690
184 Ga0373952_0029053 3300035092 Bacteria 1217
185 Ga0395899_0003283 3300037312 Bacteria 12824
186 Ga0395899_0050094 3300037312 Bacteria 3102
187 Ga0395899_0066100 3300037312 Bacteria 2655
188 Ga0395899_0077036 3300037312 Bacteria 2433
189 Ga0395900_0005323 3300037418 Bacteria 13489
190 Ga0395900_0016923 3300037418 Bacteria 7442
191 Ga0395900_0039832 3300037418 Bacteria 4842
192 Ga0395900_0044318 3300037418 Bacteria 4584
193 Ga0395900_0066125 3300037418 Bacteria 3715
194 Ga0395900_0568422 3300037418 Bacteria 1077
195 Ga0395898_0002616 3300037466 Bacteria 20962
196 Ga0395898_0005906 3300037466 Bacteria 13162
197 Ga0395898_0007257 3300037466 Bacteria 11761
198 Ga0395898_0025937 3300037466 Bacteria 5902
199 Ga0395898_0064923 3300037466 Bacteria 3540
200 Ga0395898_0083514 3300037466 Bacteria 3078
201 Ga0395898_0533117 3300037466 Bacteria 1116
202 Ga0395905_0007137 3300037471 Bacteria 11170
203 Ga0395905_0014937 3300037471 Bacteria 7407
204 Ga0395905_0018631 3300037471 Bacteria 6584
205 Ga0395905_0147780 3300037471 Unclassified 2211
206 Ga0395901_0001394 3300038443 Bacteria 25270
207 Ga0395901_0002239 3300038443 Bacteria 19733
208 Ga0395901_0014181 3300038443 Bacteria 8114
209 Ga0395901_0024380 3300038443 Bacteria 6207
210 Ga0395901_0150080 3300038443 Bacteria 2449
211 Ga0395901_0400119 3300038443 Unclassified 1411
212 Ga0451839_0176762 3300041496 Bacteria 1772
213 Ga0451853_0176963 3300041512 Bacteria 1499
214 Ga0451853_0445709 3300041512 Bacteria 6578
215 Ga0439448_0004097 3300042005 Bacteria 4101
216 Ga0450920_015127 3300042122 Bacteria 1465
217 Ga0439458_0009648 3300042157 Bacteria 2150
218 Ga0466963_0441874 3300044694 Bacteria 918
219 Ga0466964_0001299 3300044706 Bacteria 8521
220 Ga0466964_0136606 3300044706 Bacteria 1122
221 Ga0451576_0009834 3300045051 Bacteria 11052
222 Ga0495603_0009829 3300046455 Bacteria 5789
223 Ga0495641_0141132 3300046461 Unclassified 1076
224 Ga0495653_0042394 3300046463 Bacteria 3545
225 Ga0495605_0026177 3300046474 Bacteria 3033
226 Ga0495584_0096775 3300046491 Bacteria 1491
227 Ga0495584_0230953 3300046491 Bacteria 940
228 Ga0495584_0291072 3300046491 Bacteria 830
229 Ga0495585_0064516 3300046492 Bacteria 2008
230 Ga0495594_0293189 3300046499 Bacteria 927
231 Ga0495618_0068013 3300046514 Bacteria 2265
232 Ga0495620_0072700 3300046515 Bacteria 1404
233 Ga0495620_0127157 3300046515 Bacteria 1002
234 Ga0495630_0084869 3300046517 Bacteria 2390
235 Ga0495665_0135366 3300046531 Unclassified 1289
236 Ga0495597_0136554 3300046542 Bacteria 1014
237 Ga0495667_0067798 3300046559 Bacteria 2331
238 Ga0495667_0082408 3300046559 Bacteria 2090
239 Ga0495667_0280785 3300046559 Bacteria 1057
240 Ga0495656_0062599 3300046615 Bacteria 1628
241 Ga0495656_0239385 3300046615 Bacteria 913
242 Ga0495634_0087165 3300046642 Bacteria 2032
243 Ga0495635_0066610 3300046663 Bacteria 2470
244 Ga0495635_0135861 3300046663 Bacteria 1676
245 Ga0495659_0002767 3300046664 Bacteria 5644
246 Ga0495646_0099408 3300046680 Bacteria 1670
247 Ga0495613_0282770 3300046689 Unclassified 1152
248 Ga0495670_0068348 3300046691 Unclassified 1795
249 Ga0495581_0014097 3300047315 Unclassified 4632
250 Ga0495581_0017173 3300047315 Bacteria 4206
251 Ga0495674_0037621 3300047319 Bacteria 4348
252 Ga0495674_0191341 3300047319 Bacteria 1700
253 Ga0495676_0068930 3300047321 Bacteria 2731
254 Ga0495680_0017808 3300047322 Bacteria 6048
255 Ga0495684_0023816 3300047471 Bacteria 4708
256 Ga0495684_0029206 3300047471 Bacteria 4232
257 Ga0495684_0044458 3300047471 Bacteria 3401
258 Ga0495614_0074549 3300048089 Bacteria 1466
259 Ga0495626_0028167 3300048091 Bacteria 2726
260 Ga0496101_0186795 3300048904 Bacteria 1598
261 Ga0496102_0073132 3300048905 Bacteria 3151
262 Ga0496103_0052054 3300048906 Bacteria 2536
263 Ga0496104_0000772 3300048907 Bacteria 27396
264 Ga0496104_0010424 3300048907 Bacteria 8302
265 Ga0496104_0053971 3300048907 Unclassified 3798
266 Ga0496105_0000542 3300048908 Bacteria 24896
267 Ga0496105_0060951 3300048908 Bacteria 3113
268 Ga0496106_0052710 3300048909 Bacteria 3070
269 Ga0496106_0209375 3300048909 Bacteria 1553
270 Ga0496108_0002080 3300048911 Bacteria 16011
271 Ga0496108_0004739 3300048911 Bacteria 10967
272 Ga0496109_0001642 3300048912 Bacteria 18684
273 Ga0496109_0013491 3300048912 Bacteria 7089
274 Ga0496109_0087585 3300048912 Unclassified 2876
275 Ga0496110_0000787 3300048913 Bacteria 22120
276 Ga0496110_0002026 3300048913 Bacteria 15085
277 Ga0496110_0008121 3300048913 Bacteria 8432
278 Ga0496110_0012389 3300048913 Bacteria 7011
279 Ga0496110_0465020 3300048913 Bacteria 1153
280 Ga0496111_0000234 3300048914 Bacteria 26582
281 Ga0496111_0001318 3300048914 Bacteria 13940
282 Ga0496112_0034001 3300048915 Bacteria 4959
283 Ga0496112_0585730 3300048915 Bacteria 1048
284 Ga0496113_0021005 3300048916 Bacteria 4600
285 Ga0496113_0215746 3300048916 Unclassified 1528
286 Ga0496113_0293846 3300048916 Bacteria 1300
287 Ga0496114_0361936 3300048917 Bacteria 1283
288 Ga0496115_0007169 3300048918 Bacteria 8187
289 Ga0501031_0000640 3300049568 Bacteria 20732
290 Ga0501031_0000679 3300049568 Bacteria 20283
291 Ga0501031_0004457 3300049568 Bacteria 9082
292 Ga0501031_0015927 3300049568 Bacteria 4881
293 Ga0501032_0006634 3300049569 Bacteria 8496
294 Ga0501032_0013463 3300049569 Bacteria 5816
295 Ga0501032_0016637 3300049569 Bacteria 5170
296 Ga0501032_0051185 3300049569 Bacteria 2785
297 Ga0501033_0001257 3300049570 Bacteria 22689
298 Ga0501033_0004461 3300049570 Bacteria 11198
299 Ga0501033_0007690 3300049570 Bacteria 8363
300 Ga0501033_0084620 3300049570 Bacteria 2324
301 Ga0501034_0046112 3300049571 Bacteria 4404
302 Ga0501036_0000260 3300049572 Bacteria 35885
303 Ga0501036_0000438 3300049572 Bacteria 29594
304 Ga0501036_0002733 3300049572 Bacteria 13950
305 Ga0501036_0325210 3300049572 Bacteria 1285
306 Ga0501037_0000275 3300049573 Bacteria 43921
307 Ga0501037_0120338 3300049573 Bacteria 1888
308 Ga0501037_0283196 3300049573 Bacteria 1154
309 Ga0501038_0000230 3300049574 Bacteria 47516
310 Ga0501038_0001135 3300049574 Bacteria 24147
311 Ga0501038_0008509 3300049574 Bacteria 9430
312 Ga0501038_0015611 3300049574 Bacteria 6903
313 Ga0501039_0000406 3300049575 Bacteria 30991
314 Ga0501039_0006769 3300049575 Bacteria 8720
315 Ga0501039_0180404 3300049575 Bacteria 1660
316 Ga0501039_0468547 3300049575 Bacteria 989
317 Ga0501040_0000592 3300049576 Bacteria 22114
318 Ga0501040_0008421 3300049576 Bacteria 6700
319 Ga0501040_0016289 3300049576 Bacteria 4917
320 Ga0501040_0359390 3300049576 Bacteria 1043
321 Ga0501040_0382239 3300049576 Bacteria 1010
322 Ga0501040_0484686 3300049576 Bacteria 891
323 Ga0501041_0000272 3300049577 Bacteria 24566
324 Ga0501041_0000911 3300049577 Bacteria 16004
325 Ga0501041_0003737 3300049577 Bacteria 8754
326 Ga0501041_0037419 3300049577 Bacteria 2940
327 Ga0501042_0000997 3300049578 Bacteria 16053
328 Ga0501042_0003497 3300049578 Bacteria 9870
329 Ga0501042_0014020 3300049578 Bacteria 5463
330 Ga0501042_0014994 3300049578 Bacteria 5299
331 Ga0501042_0033130 3300049578 Bacteria 3662
332 Ga0501043_0003228 3300049579 Bacteria 13458
333 Ga0501043_0004614 3300049579 Bacteria 11177
334 Ga0501043_0204607 3300049579 Bacteria 1531
335 Ga0501046_0001734 3300049580 Bacteria 20803
336 Ga0501046_0004112 3300049580 Bacteria 13259
337 Ga0501046_0009300 3300049580 Bacteria 8508
338 Ga0501046_0011277 3300049580 Bacteria 7648
339 Ga0501046_0056539 3300049580 Bacteria 3080
340 Ga0501046_0073540 3300049580 Bacteria 2652
341 Ga0501046_0353005 3300049580 Bacteria 1067
342 Ga0501047_0026326 3300049581 Bacteria 5596
343 Ga0501048_0001139 3300049582 Bacteria 19959
344 Ga0501048_0001500 3300049582 Bacteria 17671
345 Ga0501048_0008742 3300049582 Bacteria 7631
346 Ga0501048_0028556 3300049582 Bacteria 4049
347 Ga0501048_0318873 3300049582 Bacteria 1107
348 Ga0501067_0000516 3300049583 Bacteria 21125
349 Ga0501067_0026821 3300049583 Bacteria 3190
350 Ga0501068_0000011 3300049584 Bacteria 65947
351 Ga0501068_0007019 3300049584 Bacteria 6231
352 Ga0501069_0000320 3300049585 Bacteria 21738
353 Ga0501069_0000482 3300049585 Bacteria 18238
354 Ga0501069_0002134 3300049585 Bacteria 9961
355 Ga0501069_0004504 3300049585 Bacteria 7200
356 Ga0501069_0005912 3300049585 Bacteria 6378
357 Ga0501069_0075950 3300049585 Bacteria 1888
358 Ga0501070_0003288 3300049586 Bacteria 14025
359 Ga0501070_0004186 3300049586 Bacteria 12422
360 Ga0501070_0010643 3300049586 Bacteria 7776
361 Ga0501070_0012724 3300049586 Bacteria 7096
362 Ga0501071_0004198 3300049587 Bacteria 9119
363 Ga0501071_0006394 3300049587 Bacteria 7647
364 Ga0501071_0007457 3300049587 Bacteria 7185
365 Ga0501071_0060487 3300049587 Bacteria 2742
366 Ga0501071_0136118 3300049587 Bacteria 1828
367 Ga0501072_0000354 3300049588 Bacteria 32671
368 Ga0501072_0002880 3300049588 Bacteria 12937
369 Ga0501072_0006422 3300049588 Bacteria 8957
370 Ga0501073_0018753 3300049589 Bacteria 5002
371 Ga0501073_0032970 3300049589 Bacteria 3691
372 Ga0501073_0051970 3300049589 Bacteria 2870
373 Ga0501074_0000438 3300049590 Bacteria 24855
374 Ga0501074_0004727 3300049590 Bacteria 9759
375 Ga0501074_0046401 3300049590 Bacteria 3141
376 Ga0501074_0080284 3300049590 Bacteria 2340
377 Ga0501075_0000040 3300049591 Bacteria 52221
378 Ga0501075_0028861 3300049591 Bacteria 4098
379 Ga0501075_0030741 3300049591 Bacteria 3979
380 Ga0501075_0106731 3300049591 Bacteria 2128
381 Ga0501076_0000089 3300049592 Bacteria 48333
382 Ga0501076_0008506 3300049592 Bacteria 7521
383 Ga0501076_0041762 3300049592 Bacteria 3609
384 Ga0501076_0126808 3300049592 Bacteria 2068
385 Ga0501076_0218325 3300049592 Unclassified 1558
386 Ga0501076_0317113 3300049592 Bacteria 1279
387 Ga0501077_0000172 3300049593 Bacteria 37130
388 Ga0501077_0005913 3300049593 Bacteria 7462
389 Ga0501077_0020179 3300049593 Bacteria 4218
390 Ga0501077_0025000 3300049593 Bacteria 3792
391 Ga0501077_0064592 3300049593 Bacteria 2322
392 Ga0501077_0156551 3300049593 Bacteria 1446
393 Ga0501079_0002976 3300049741 Bacteria 12392
394 Ga0501079_0004229 3300049741 Bacteria 10649
395 Ga0501079_0092544 3300049741 Bacteria 2342
396 Ga0501079_0135589 3300049741 Bacteria 1916
397 Ga0501079_0197489 3300049741 Bacteria 1570
398 Ga0501079_0276470 3300049741 Bacteria 1313
399 Ga0501080_0000142 3300049742 Bacteria 50372
400 Ga0501080_0018136 3300049742 Bacteria 6515
401 Ga0501080_0044217 3300049742 Bacteria 4146
402 Ga0501080_0055738 3300049742 Bacteria 3681
403 Ga0501081_0006516 3300049743 Bacteria 7581
404 Ga0501081_0008909 3300049743 Bacteria 6518
405 Ga0501081_0010258 3300049743 Bacteria 6116
406 Ga0501081_0014393 3300049743 Bacteria 5218
407 Ga0501081_0030509 3300049743 Bacteria 3649
408 Ga0501081_0147943 3300049743 Bacteria 1686
409 Ga0501081_0322341 3300049743 Bacteria 1136
410 Ga0501083_0001393 3300049744 Bacteria 16434
411 Ga0501083_0001626 3300049744 Bacteria 15377
412 Ga0501083_0070369 3300049744 Bacteria 2327
413 Ga0501083_0188900 3300049744 Unclassified 1344
414 Ga0501083_0203833 3300049744 Bacteria 1290
415 Ga0501035_0005187 3300049822 Bacteria 12324
416 Ga0501035_0008094 3300049822 Bacteria 9798
417 Ga0501035_0144670 3300049822 Bacteria 2065
418 Ga0501044_0019579 3300049823 Bacteria 7236
419 Ga0501044_0057962 3300049823 Bacteria 3973
420 Ga0501044_0070013 3300049823 Bacteria 3570
421 Ga0501045_0000357 3300049824 Bacteria 27239
422 Ga0501045_0007804 3300049824 Bacteria 7443
423 Ga0501045_0008579 3300049824 Bacteria 7123
424 Ga0501045_0021415 3300049824 Bacteria 4624
425 Ga0501045_0602341 3300049824 Bacteria 813
426 nmdc:mga0yw44_53407_c1 3300050492 Bacteria 2454
427 nmdc:mga05p37_4680_c1 3300050507 Bacteria 15983
428 nmdc:mga05p37_498140_c1 3300050507 Bacteria 1399
429 nmdc:mga05p37_831558_c1 3300050507 Bacteria 1005
430 nmdc:mga09592_14491_c1 3300050508 Bacteria 6435
431 nmdc:mga09592_394182_c1 3300050508 Bacteria 1197
432 nmdc:mga09592_522363_c1 3300050508 Bacteria 1021
433 nmdc:mga0qj67_42072_c1 3300050509 Bacteria 3596
434 nmdc:mga06r32_311110_c1 3300050510 Bacteria 1561
435 nmdc:mga06r32_672918_c1 3300050510 Bacteria 1002
436 nmdc:mga08y16_16896_c1 3300050511 Bacteria 7684
437 nmdc:mga08y16_17863_c1 3300050511 Bacteria 7472
438 nmdc:mga0n895_18537_c1 3300050512 Bacteria 6444
439 nmdc:mga0a205_321354_c1 3300050515 Unclassified 1419
440 Ga0495601_0049162 3300053077 Bacteria 2658
441 Ga0495601_0098779 3300053077 Bacteria 1884
442 Ga0495595_0061985 3300053084 Bacteria 1753
443 Ga0501084_0000144 3300054114 Bacteria 54020
444 Ga0501084_0013228 3300054114 Bacteria 6828
445 Ga0501084_0019269 3300054114 Bacteria 5682
446 Ga0501084_0039678 3300054114 Bacteria 3937
447 Ga0501084_0127428 3300054114 Bacteria 2142
448 Ga0501084_0202722 3300054114 Bacteria 1674
449 Ga0501084_0426765 3300054114 Bacteria 1121
450 Ga0501082_0000730 3300060353 Bacteria 28954
451 Ga0501082_0001289 3300060353 Bacteria 21965
452 Ga0501082_0015705 3300060353 Bacteria 6513
453 Ga0501082_0052277 3300060353 Bacteria 3521
454 Ga0501082_0055411 3300060353 Bacteria 3416
455 Ga0501082_0121746 3300060353 Bacteria 2261
456 Ga0501082_0489429 3300060353 Bacteria 1075
457 Ga0530510_0000612 3300061734 Bacteria 23017
458 Ga0530510_0002207 3300061734 Bacteria 13362
459 Ga0530510_0102748 3300061734 Bacteria 2090
460 Ga0530510_0296545 3300061734 Bacteria 1209

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0291072 Ga0495584_0291072_30_716 228
2 3300049576 Ga0501040_0484686 Ga0501040_0484686_31_723 228
3 3300054114 Ga0501084_0426765 Ga0501084_0426765_14_706 228
4 3300009098 Ga0105245_10316992 Ga0105245_103169922 229
5 3300049568 Ga0501031_0015927 Ga0501031_0015927_4006_4758 232
6 3300049569 Ga0501032_0013463 Ga0501032_0013463_673_1422 232
7 3300049569 Ga0501032_0016637 Ga0501032_0016637_4296_5048 232
8 3300049570 Ga0501033_0001257 Ga0501033_0001257_1717_2469 232
9 3300049572 Ga0501036_0002733 Ga0501036_0002733_13059_13811 232
10 3300049574 Ga0501038_0015611 Ga0501038_0015611_578_1330 232
11 3300049575 Ga0501039_0006769 Ga0501039_0006769_7546_8298 232
12 3300049576 Ga0501040_0016289 Ga0501040_0016289_2958_3707 232
13 3300049577 Ga0501041_0003737 Ga0501041_0003737_1712_2464 232
14 3300049578 Ga0501042_0014994 Ga0501042_0014994_131_883 232
15 3300049579 Ga0501043_0004614 Ga0501043_0004614_5622_6374 232
16 3300049580 Ga0501046_0009300 Ga0501046_0009300_3439_4191 232
17 3300049582 Ga0501048_0008742 Ga0501048_0008742_263_1015 232
18 3300049584 Ga0501068_0007019 Ga0501068_0007019_5352_6119 232
19 3300049585 Ga0501069_0000320 Ga0501069_0000320_20821_21573 232
20 3300049586 Ga0501070_0004186 Ga0501070_0004186_5574_6326 232
21 3300049587 Ga0501071_0004198 Ga0501071_0004198_7790_8542 232
22 3300049589 Ga0501073_0018753 Ga0501073_0018753_4226_4978 232
23 3300049590 Ga0501074_0004727 Ga0501074_0004727_1717_2469 232
24 3300049591 Ga0501075_0030741 Ga0501075_0030741_2650_3402 232
25 3300049592 Ga0501076_0126808 Ga0501076_0126808_1076_1828 232
26 3300049593 Ga0501077_0025000 Ga0501077_0025000_263_1015 232
27 3300049741 Ga0501079_0197489 Ga0501079_0197489_578_1330 232
28 3300049742 Ga0501080_0044217 Ga0501080_0044217_3154_3906 232
29 3300049743 Ga0501081_0008909 Ga0501081_0008909_5643_6395 232
30 3300049744 Ga0501083_0001393 Ga0501083_0001393_1688_2440 232
31 3300049823 Ga0501044_0057962 Ga0501044_0057962_258_1010 232
32 3300049824 Ga0501045_0007804 Ga0501045_0007804_6119_6871 232
33 3300054114 Ga0501084_0019269 Ga0501084_0019269_3214_3966 232
34 3300060353 Ga0501082_0015705 Ga0501082_0015705_2984_3736 232
35 3300014969 Ga0157376_10153912 Ga0157376_101539123 234
36 3300046463 Ga0495653_0042394 Ga0495653_0042394_1070_1828 236
37 3300046559 Ga0495667_0082408 Ga0495667_0082408_1190_1948 236
38 3300046663 Ga0495635_0135861 Ga0495635_0135861_346_1104 236
39 3300046680 Ga0495646_0099408 Ga0495646_0099408_846_1604 236
40 3300047319 Ga0495674_0191341 Ga0495674_0191341_439_1197 236
41 3300047471 Ga0495684_0023816 Ga0495684_0023816_3280_4038 236
42 3300053077 Ga0495601_0098779 Ga0495601_0098779_166_924 236
43 3300053084 Ga0495595_0061985 Ga0495595_0061985_118_876 236
44 3300038443 Ga0395901_0400119 Ga0395901_0400119_631_1380 238
45 3300049578 Ga0501042_0033130 Ga0501042_0033130_197_952 239
46 3300049741 Ga0501079_0135589 Ga0501079_0135589_1138_1893 239
47 3300049591 Ga0501075_0106731 Ga0501075_0106731_198_944 242
48 3300060353 Ga0501082_0489429 Ga0501082_0489429_117_863 242
49 3300005536 Ga0070697_100270287 Ga0070697_1002702872 243
50 3300006844 Ga0075428_100083770 Ga0075428_1000837704 244
51 3300037466 Ga0395898_0064923 Ga0395898_0064923_261_998 244
52 3300048913 Ga0496110_0465020 Ga0496110_0465020_268_1002 244
53 3300050508 nmdc:mga09592_522363_c1 nmdc:mga09592_522363_c1_15_749 244
54 3300006844 Ga0075428_100268382 Ga0075428_1002683822 247
55 3300006846 Ga0075430_100237238 Ga0075430_1002372382 247
56 3300006880 Ga0075429_100016896 Ga0075429_1000168962 247
57 3300009147 Ga0114129_10010978 Ga0114129_100109788 247
58 3300014325 Ga0163163_10121714 Ga0163163_101217143 247
59 3300025940 Ga0207691_10305008 Ga0207691_103050082 247
60 3300041512 Ga0451853_0176963 Ga0451853_0176963_718_1461 247
61 3300046615 Ga0495656_0239385 Ga0495656_0239385_50_793 247
62 3300048917 Ga0496114_0361936 Ga0496114_0361936_312_1055 247
63 3300049741 Ga0501079_0276470 Ga0501079_0276470_133_879 247
64 3300049743 Ga0501081_0147943 Ga0501081_0147943_128_877 247
65 3300050507 nmdc:mga05p37_4680_c1 nmdc:mga05p37_4680_c1_7602_8357 247
66 3300050508 nmdc:mga09592_14491_c1 nmdc:mga09592_14491_c1_2968_3723 247
67 3300050509 nmdc:mga0qj67_42072_c1 nmdc:mga0qj67_42072_c1_1852_2607 247
68 3300050510 nmdc:mga06r32_311110_c1 nmdc:mga06r32_311110_c1_749_1504 247
69 3300005435 Ga0070714_100119901 Ga0070714_1001199011 248
70 3300005458 Ga0070681_10470834 Ga0070681_104708342 248
71 3300009545 Ga0105237_10114600 Ga0105237_101146001 248
72 3300025912 Ga0207707_10488020 Ga0207707_104880202 248
73 3300025928 Ga0207700_10046069 Ga0207700_100460691 248
74 3300026088 Ga0207641_10890209 Ga0207641_108902092 248
75 3300046455 Ga0495603_0009829 Ga0495603_0009829_2363_3109 248
76 3300046461 Ga0495641_0141132 Ga0495641_0141132_295_1041 248
77 3300046531 Ga0495665_0135366 Ga0495665_0135366_469_1215 248
78 3300046559 Ga0495667_0067798 Ga0495667_0067798_1193_1939 248
79 3300046559 Ga0495667_0280785 Ga0495667_0280785_18_776 248
80 3300046642 Ga0495634_0087165 Ga0495634_0087165_1153_1899 248
81 3300046663 Ga0495635_0066610 Ga0495635_0066610_993_1739 248
82 3300046689 Ga0495613_0282770 Ga0495613_0282770_95_841 248
83 3300047315 Ga0495581_0014097 Ga0495581_0014097_3845_4591 248
84 3300047315 Ga0495581_0017173 Ga0495581_0017173_137_883 248
85 3300047321 Ga0495676_0068930 Ga0495676_0068930_137_883 248
86 3300047322 Ga0495680_0017808 Ga0495680_0017808_3460_4206 248
87 3300047471 Ga0495684_0044458 Ga0495684_0044458_714_1460 248
88 3300048089 Ga0495614_0074549 Ga0495614_0074549_601_1347 248
89 3300048907 Ga0496104_0010424 Ga0496104_0010424_2275_3033 248
90 3300048908 Ga0496105_0060951 Ga0496105_0060951_785_1543 248
91 3300005329 Ga0070683_100067996 Ga0070683_1000679964 249
92 3300005329 Ga0070683_100096565 Ga0070683_1000965654 249
93 3300005330 Ga0070690_100109295 Ga0070690_1001092951 249
94 3300005341 Ga0070691_10012479 Ga0070691_100124793 249
95 3300005341 Ga0070691_10036046 Ga0070691_100360462 249
96 3300005343 Ga0070687_100062784 Ga0070687_1000627842 249
97 3300005345 Ga0070692_10011357 Ga0070692_100113575 249
98 3300005347 Ga0070668_100009363 Ga0070668_1000093634 249
99 3300005356 Ga0070674_100125068 Ga0070674_1001250682 249
100 3300005356 Ga0070674_100359806 Ga0070674_1003598061 249
101 3300005366 Ga0070659_100274265 Ga0070659_1002742653 249
102 3300005406 Ga0070703_10020086 Ga0070703_100200862 249
103 3300005436 Ga0070713_100115062 Ga0070713_1001150622 249
104 3300005437 Ga0070710_10013927 Ga0070710_100139274 249
105 3300005438 Ga0070701_10125896 Ga0070701_101258962 249
106 3300005438 Ga0070701_10222566 Ga0070701_102225661 249
107 3300005440 Ga0070705_100045000 Ga0070705_1000450002 249
108 3300005441 Ga0070700_100018858 Ga0070700_1000188583 249
109 3300005441 Ga0070700_100094422 Ga0070700_1000944221 249
110 3300005459 Ga0068867_100304142 Ga0068867_1003041422 249
111 3300005459 Ga0068867_100321084 Ga0068867_1003210842 249
112 3300005466 Ga0070685_10270933 Ga0070685_102709332 249
113 3300005467 Ga0070706_100153861 Ga0070706_1001538613 249
114 3300005468 Ga0070707_100093164 Ga0070707_1000931644 249
115 3300005471 Ga0070698_100004043 Ga0070698_1000040432 249
116 3300005471 Ga0070698_100006972 Ga0070698_1000069726 249
117 3300005471 Ga0070698_100033852 Ga0070698_1000338523 249
118 3300005518 Ga0070699_100014550 Ga0070699_1000145504 249
119 3300005518 Ga0070699_100139917 Ga0070699_1001399172 249
120 3300005543 Ga0070672_100279917 Ga0070672_1002799173 249
121 3300005544 Ga0070686_100132507 Ga0070686_1001325072 249
122 3300005544 Ga0070686_100135967 Ga0070686_1001359672 249
123 3300005545 Ga0070695_100084576 Ga0070695_1000845762 249
124 3300005547 Ga0070693_100025509 Ga0070693_1000255093 249
125 3300005549 Ga0070704_100058703 Ga0070704_1000587034 249
126 3300005549 Ga0070704_100177899 Ga0070704_1001778992 249
127 3300005563 Ga0068855_100142692 Ga0068855_1001426923 249
128 3300005563 Ga0068855_100361295 Ga0068855_1003612952 249
129 3300005577 Ga0068857_100116991 Ga0068857_1001169912 249
130 3300005615 Ga0070702_100006382 Ga0070702_1000063822 249
131 3300005615 Ga0070702_100049406 Ga0070702_1000494062 249
132 3300005617 Ga0068859_100364110 Ga0068859_1003641102 249
133 3300005718 Ga0068866_10272768 Ga0068866_102727682 249
134 3300005718 Ga0068866_10359357 Ga0068866_103593572 249
135 3300005719 Ga0068861_100228827 Ga0068861_1002288272 249
136 3300005843 Ga0068860_100296896 Ga0068860_1002968962 249
137 3300005843 Ga0068860_100393907 Ga0068860_1003939072 249
138 3300005937 Ga0081455_10017728 Ga0081455_100177282 249
139 3300005937 Ga0081455_10108018 Ga0081455_101080181 249
140 3300005981 Ga0081538_10000057 Ga0081538_1000005710 249
141 3300005985 Ga0081539_10000041 Ga0081539_1000004151 249
142 3300005985 Ga0081539_10020311 Ga0081539_100203114 249
143 3300006038 Ga0075365_10042218 Ga0075365_100422182 249
144 3300006038 Ga0075365_10171365 Ga0075365_101713652 249
145 3300006175 Ga0070712_100040160 Ga0070712_1000401602 249
146 3300006844 Ga0075428_100032779 Ga0075428_1000327793 249
147 3300006844 Ga0075428_101072793 Ga0075428_1010727931 249
148 3300006847 Ga0075431_100611717 Ga0075431_1006117172 249
149 3300006871 Ga0075434_100005176 Ga0075434_10000517613 249
150 3300006931 Ga0097620_100364127 Ga0097620_1003641272 249
151 3300009093 Ga0105240_10434144 Ga0105240_104341442 249
152 3300009094 Ga0111539_10004593 Ga0111539_1000459312 249
153 3300009094 Ga0111539_10007332 Ga0111539_1000733210 249
154 3300009094 Ga0111539_10017628 Ga0111539_100176284 249
155 3300009094 Ga0111539_10302749 Ga0111539_103027491 249
156 3300009094 Ga0111539_10940458 Ga0111539_109404582 249
157 3300009094 Ga0111539_11247330 Ga0111539_112473301 249
158 3300009098 Ga0105245_10059581 Ga0105245_100595812 249
159 3300009098 Ga0105245_10155361 Ga0105245_101553612 249
160 3300009098 Ga0105245_10230602 Ga0105245_102306022 249
161 3300009098 Ga0105245_10309239 Ga0105245_103092392 249
162 3300009098 Ga0105245_10376241 Ga0105245_103762412 249
163 3300009147 Ga0114129_10017065 Ga0114129_100170656 249
164 3300009147 Ga0114129_10180333 Ga0114129_101803333 249
165 3300009147 Ga0114129_11345026 Ga0114129_113450261 249
166 3300009148 Ga0105243_10135815 Ga0105243_101358151 249
167 3300009148 Ga0105243_10243663 Ga0105243_102436632 249
168 3300009148 Ga0105243_10674276 Ga0105243_106742762 249
169 3300009176 Ga0105242_10495810 Ga0105242_104958102 249
170 3300009177 Ga0105248_10024828 Ga0105248_100248282 249
171 3300009551 Ga0105238_10732183 Ga0105238_107321832 249
172 3300009553 Ga0105249_10010851 Ga0105249_100108514 249
173 3300009553 Ga0105249_10036826 Ga0105249_100368263 249
174 3300009553 Ga0105249_10099670 Ga0105249_100996702 249
175 3300009553 Ga0105249_10217612 Ga0105249_102176123 249
176 3300009553 Ga0105249_10331437 Ga0105249_103314372 249
177 3300009553 Ga0105249_10648983 Ga0105249_106489832 249
178 3300010375 Ga0105239_10038088 Ga0105239_100380882 249
179 3300010375 Ga0105239_10071415 Ga0105239_100714152 249
180 3300011119 Ga0105246_10038708 Ga0105246_100387082 249
181 3300011119 Ga0105246_10042765 Ga0105246_100427652 249
182 3300011119 Ga0105246_10137451 Ga0105246_101374512 249
183 3300013102 Ga0157371_10173040 Ga0157371_101730402 249
184 3300013297 Ga0157378_10096259 Ga0157378_100962592 249
185 3300013306 Ga0163162_10021629 Ga0163162_100216295 249
186 3300013307 Ga0157372_10506307 Ga0157372_105063072 249
187 3300013308 Ga0157375_10598480 Ga0157375_105984802 249
188 3300014745 Ga0157377_10004169 Ga0157377_100041697 249
189 3300014968 Ga0157379_10367281 Ga0157379_103672812 249
190 3300014969 Ga0157376_10001321 Ga0157376_100013214 249
191 3300014969 Ga0157376_10006667 Ga0157376_100066673 249
192 3300017792 Ga0163161_10333347 Ga0163161_103333471 249
193 3300025901 Ga0207688_10090435 Ga0207688_100904352 249
194 3300025906 Ga0207699_10063470 Ga0207699_100634704 249
195 3300025907 Ga0207645_10152386 Ga0207645_101523862 249
196 3300025908 Ga0207643_10047908 Ga0207643_100479083 249
197 3300025915 Ga0207693_10006295 Ga0207693_100062958 249
198 3300025915 Ga0207693_10009157 Ga0207693_100091573 249
199 3300025918 Ga0207662_10122143 Ga0207662_101221432 249
200 3300025919 Ga0207657_10058167 Ga0207657_100581672 249
201 3300025921 Ga0207652_10497717 Ga0207652_104977172 249
202 3300025922 Ga0207646_10022680 Ga0207646_100226806 249
203 3300025926 Ga0207659_10055915 Ga0207659_100559153 249
204 3300025927 Ga0207687_10043101 Ga0207687_100431014 249
205 3300025927 Ga0207687_10134510 Ga0207687_101345103 249
206 3300025928 Ga0207700_10229957 Ga0207700_102299571 249
207 3300025932 Ga0207690_10061569 Ga0207690_100615692 249
208 3300025932 Ga0207690_10398266 Ga0207690_103982662 249
209 3300025933 Ga0207706_10008758 Ga0207706_100087582 249
210 3300025933 Ga0207706_10042968 Ga0207706_100429683 249
211 3300025933 Ga0207706_10052165 Ga0207706_100521653 249
212 3300025937 Ga0207669_10073460 Ga0207669_100734601 249
213 3300025938 Ga0207704_10653708 Ga0207704_106537081 249
214 3300025939 Ga0207665_10144486 Ga0207665_101444862 249
215 3300025944 Ga0207661_10019751 Ga0207661_100197513 249
216 3300025949 Ga0207667_10413289 Ga0207667_104132892 249
217 3300025961 Ga0207712_10042305 Ga0207712_100423054 249
218 3300025961 Ga0207712_10220788 Ga0207712_102207881 249
219 3300025972 Ga0207668_10036930 Ga0207668_100369302 249
220 3300025981 Ga0207640_10130749 Ga0207640_101307493 249
221 3300025981 Ga0207640_10185645 Ga0207640_101856452 249
222 3300026023 Ga0207677_10149773 Ga0207677_101497732 249
223 3300026023 Ga0207677_10231675 Ga0207677_102316752 249
224 3300026035 Ga0207703_10131085 Ga0207703_101310852 249
225 3300026041 Ga0207639_10097922 Ga0207639_100979222 249
226 3300026075 Ga0207708_10009212 Ga0207708_100092127 249
227 3300026075 Ga0207708_10038461 Ga0207708_100384613 249
228 3300026078 Ga0207702_10023418 Ga0207702_100234184 249
229 3300026089 Ga0207648_10031354 Ga0207648_100313541 249
230 3300026089 Ga0207648_10041718 Ga0207648_100417183 249
231 3300026089 Ga0207648_10178107 Ga0207648_101781072 249
232 3300026116 Ga0207674_10006223 Ga0207674_1000622315 249
233 3300026116 Ga0207674_10026768 Ga0207674_100267683 249
234 3300026118 Ga0207675_100007556 Ga0207675_10000755611 249
235 3300026118 Ga0207675_100092754 Ga0207675_1000927542 249
236 3300026121 Ga0207683_10162696 Ga0207683_101626963 249
237 3300027907 Ga0207428_10009220 Ga0207428_100092203 249
238 3300027907 Ga0207428_10009605 Ga0207428_100096055 249
239 3300028380 Ga0268265_10051134 Ga0268265_100511342 249
240 3300028381 Ga0268264_10530423 Ga0268264_105304232 249
241 3300031548 Ga0307408_100025364 Ga0307408_1000253643 249
242 3300031548 Ga0307408_100298735 Ga0307408_1002987352 249
243 3300031824 Ga0307413_10003425 Ga0307413_100034254 249
244 3300031852 Ga0307410_10090673 Ga0307410_100906732 249
245 3300031901 Ga0307406_10030824 Ga0307406_100308243 249
246 3300031901 Ga0307406_10106086 Ga0307406_101060862 249
247 3300031911 Ga0307412_10097390 Ga0307412_100973902 249
248 3300031995 Ga0307409_100011218 Ga0307409_1000112182 249
249 3300031995 Ga0307409_100035980 Ga0307409_1000359803 249
250 3300031995 Ga0307409_100207906 Ga0307409_1002079062 249
251 3300032002 Ga0307416_100001425 Ga0307416_1000014258 249
252 3300032002 Ga0307416_100012791 Ga0307416_1000127914 249
253 3300032002 Ga0307416_100380294 Ga0307416_1003802942 249
254 3300032002 Ga0307416_101009881 Ga0307416_1010098811 249
255 3300032004 Ga0307414_10178078 Ga0307414_101780782 249
256 3300032126 Ga0307415_100000286 Ga0307415_10000028610 249
257 3300032126 Ga0307415_100014075 Ga0307415_1000140753 249
258 3300035092 Ga0373952_0029053 Ga0373952_0029053_313_1062 249
259 3300037312 Ga0395899_0003283 Ga0395899_0003283_10087_10842 249
260 3300037312 Ga0395899_0050094 Ga0395899_0050094_1300_2052 249
261 3300037312 Ga0395899_0066100 Ga0395899_0066100_932_1687 249
262 3300037312 Ga0395899_0077036 Ga0395899_0077036_517_1272 249
263 3300037418 Ga0395900_0005323 Ga0395900_0005323_9281_10036 249
264 3300037418 Ga0395900_0016923 Ga0395900_0016923_4945_5700 249
265 3300037418 Ga0395900_0039832 Ga0395900_0039832_1064_1816 249
266 3300037418 Ga0395900_0044318 Ga0395900_0044318_354_1103 249
267 3300037418 Ga0395900_0066125 Ga0395900_0066125_2338_3090 249
268 3300037418 Ga0395900_0568422 Ga0395900_0568422_267_1016 249
269 3300037466 Ga0395898_0002616 Ga0395898_0002616_9917_10669 249
270 3300037466 Ga0395898_0005906 Ga0395898_0005906_12283_13032 249
271 3300037466 Ga0395898_0007257 Ga0395898_0007257_5677_6432 249
272 3300037466 Ga0395898_0025937 Ga0395898_0025937_3892_4647 249
273 3300037466 Ga0395898_0083514 Ga0395898_0083514_820_1575 249
274 3300037466 Ga0395898_0533117 Ga0395898_0533117_203_952 249
275 3300037471 Ga0395905_0007137 Ga0395905_0007137_1398_2153 249
276 3300037471 Ga0395905_0014937 Ga0395905_0014937_5653_6408 249
277 3300037471 Ga0395905_0018631 Ga0395905_0018631_898_1647 249
278 3300037471 Ga0395905_0147780 Ga0395905_0147780_777_1529 249
279 3300038443 Ga0395901_0001394 Ga0395901_0001394_10362_11111 249
280 3300038443 Ga0395901_0002239 Ga0395901_0002239_5273_6028 249
281 3300038443 Ga0395901_0014181 Ga0395901_0014181_2953_3705 249
282 3300038443 Ga0395901_0024380 Ga0395901_0024380_3794_4549 249
283 3300038443 Ga0395901_0150080 Ga0395901_0150080_695_1450 249
284 3300041496 Ga0451839_0176762 Ga0451839_0176762_379_1140 249
285 3300041512 Ga0451853_0445709 Ga0451853_0445709_4721_5470 249
286 3300042005 Ga0439448_0004097 Ga0439448_0004097_1619_2371 249
287 3300042122 Ga0450920_015127 Ga0450920_015127_208_957 249
288 3300042157 Ga0439458_0009648 Ga0439458_0009648_771_1523 249
289 3300044694 Ga0466963_0441874 Ga0466963_0441874_29_790 249
290 3300044706 Ga0466964_0001299 Ga0466964_0001299_2231_2992 249
291 3300044706 Ga0466964_0136606 Ga0466964_0136606_319_1068 249
292 3300045051 Ga0451576_0009834 Ga0451576_0009834_79_831 249
293 3300046474 Ga0495605_0026177 Ga0495605_0026177_1531_2280 249
294 3300046491 Ga0495584_0096775 Ga0495584_0096775_286_1038 249
295 3300046491 Ga0495584_0230953 Ga0495584_0230953_119_868 249
296 3300046492 Ga0495585_0064516 Ga0495585_0064516_1241_1990 249
297 3300046499 Ga0495594_0293189 Ga0495594_0293189_118_870 249
298 3300046514 Ga0495618_0068013 Ga0495618_0068013_319_1077 249
299 3300046515 Ga0495620_0072700 Ga0495620_0072700_36_788 249
300 3300046515 Ga0495620_0127157 Ga0495620_0127157_50_799 249
301 3300046517 Ga0495630_0084869 Ga0495630_0084869_646_1404 249
302 3300046542 Ga0495597_0136554 Ga0495597_0136554_247_996 249
303 3300046615 Ga0495656_0062599 Ga0495656_0062599_850_1599 249
304 3300046664 Ga0495659_0002767 Ga0495659_0002767_1410_2159 249
305 3300046691 Ga0495670_0068348 Ga0495670_0068348_846_1595 249
306 3300047319 Ga0495674_0037621 Ga0495674_0037621_2100_2858 249
307 3300047471 Ga0495684_0029206 Ga0495684_0029206_774_1532 249
308 3300048091 Ga0495626_0028167 Ga0495626_0028167_1384_2133 249
309 3300048904 Ga0496101_0186795 Ga0496101_0186795_177_929 249
310 3300048905 Ga0496102_0073132 Ga0496102_0073132_1293_2045 249
311 3300048906 Ga0496103_0052054 Ga0496103_0052054_1348_2097 249
312 3300048907 Ga0496104_0000772 Ga0496104_0000772_24255_25007 249
313 3300048907 Ga0496104_0053971 Ga0496104_0053971_1382_2131 249
314 3300048908 Ga0496105_0000542 Ga0496105_0000542_22618_23370 249
315 3300048909 Ga0496106_0052710 Ga0496106_0052710_361_1113 249
316 3300048909 Ga0496106_0209375 Ga0496106_0209375_331_1083 249
317 3300048911 Ga0496108_0002080 Ga0496108_0002080_10660_11412 249
318 3300048911 Ga0496108_0004739 Ga0496108_0004739_3609_4358 249
319 3300048912 Ga0496109_0001642 Ga0496109_0001642_14355_15107 249
320 3300048912 Ga0496109_0013491 Ga0496109_0013491_456_1205 249
321 3300048912 Ga0496109_0087585 Ga0496109_0087585_283_1035 249
322 3300048913 Ga0496110_0000787 Ga0496110_0000787_8296_9048 249
323 3300048913 Ga0496110_0002026 Ga0496110_0002026_10970_11719 249
324 3300048913 Ga0496110_0008121 Ga0496110_0008121_772_1524 249
325 3300048913 Ga0496110_0012389 Ga0496110_0012389_887_1639 249
326 3300048914 Ga0496111_0000234 Ga0496111_0000234_6976_7725 249
327 3300048914 Ga0496111_0001318 Ga0496111_0001318_10632_11384 249
328 3300048915 Ga0496112_0034001 Ga0496112_0034001_2918_3670 249
329 3300048915 Ga0496112_0585730 Ga0496112_0585730_147_899 249
330 3300048916 Ga0496113_0021005 Ga0496113_0021005_2946_3698 249
331 3300048916 Ga0496113_0215746 Ga0496113_0215746_467_1219 249
332 3300048916 Ga0496113_0293846 Ga0496113_0293846_115_924 249
333 3300048918 Ga0496115_0007169 Ga0496115_0007169_1350_2102 249
334 3300049568 Ga0501031_0000640 Ga0501031_0000640_17229_17990 249
335 3300049568 Ga0501031_0000679 Ga0501031_0000679_15867_16619 249
336 3300049568 Ga0501031_0004457 Ga0501031_0004457_8160_8909 249
337 3300049569 Ga0501032_0006634 Ga0501032_0006634_5145_5906 249
338 3300049569 Ga0501032_0051185 Ga0501032_0051185_584_1336 249
339 3300049570 Ga0501033_0004461 Ga0501033_0004461_7855_8616 249
340 3300049570 Ga0501033_0007690 Ga0501033_0007690_828_1577 249
341 3300049570 Ga0501033_0084620 Ga0501033_0084620_706_1458 249
342 3300049571 Ga0501034_0046112 Ga0501034_0046112_250_1011 249
343 3300049572 Ga0501036_0000260 Ga0501036_0000260_2521_3282 249
344 3300049572 Ga0501036_0000438 Ga0501036_0000438_10823_11575 249
345 3300049572 Ga0501036_0325210 Ga0501036_0325210_323_1075 249
346 3300049573 Ga0501037_0000275 Ga0501037_0000275_36382_37143 249
347 3300049573 Ga0501037_0120338 Ga0501037_0120338_198_950 249
348 3300049573 Ga0501037_0283196 Ga0501037_0283196_205_954 249
349 3300049574 Ga0501038_0000230 Ga0501038_0000230_32604_33365 249
350 3300049574 Ga0501038_0001135 Ga0501038_0001135_7159_7908 249
351 3300049574 Ga0501038_0008509 Ga0501038_0008509_8430_9182 249
352 3300049575 Ga0501039_0000406 Ga0501039_0000406_21411_22172 249
353 3300049575 Ga0501039_0180404 Ga0501039_0180404_48_800 249
354 3300049575 Ga0501039_0468547 Ga0501039_0468547_121_873 249
355 3300049576 Ga0501040_0000592 Ga0501040_0000592_11441_12193 249
356 3300049576 Ga0501040_0008421 Ga0501040_0008421_2386_3147 249
357 3300049576 Ga0501040_0359390 Ga0501040_0359390_256_1017 249
358 3300049576 Ga0501040_0382239 Ga0501040_0382239_229_984 249
359 3300049577 Ga0501041_0000272 Ga0501041_0000272_17559_18311 249
360 3300049577 Ga0501041_0000911 Ga0501041_0000911_6432_7193 249
361 3300049577 Ga0501041_0037419 Ga0501041_0037419_1996_2757 249
362 3300049578 Ga0501042_0000997 Ga0501042_0000997_6203_6955 249
363 3300049578 Ga0501042_0003497 Ga0501042_0003497_8031_8780 249
364 3300049578 Ga0501042_0014020 Ga0501042_0014020_2425_3186 249
365 3300049579 Ga0501043_0003228 Ga0501043_0003228_9955_10716 249
366 3300049579 Ga0501043_0204607 Ga0501043_0204607_517_1269 249
367 3300049580 Ga0501046_0001734 Ga0501046_0001734_639_1388 249
368 3300049580 Ga0501046_0004112 Ga0501046_0004112_10113_10874 249
369 3300049580 Ga0501046_0011277 Ga0501046_0011277_1214_1966 249
370 3300049580 Ga0501046_0056539 Ga0501046_0056539_2229_2984 249
371 3300049580 Ga0501046_0073540 Ga0501046_0073540_1094_1855 249
372 3300049580 Ga0501046_0353005 Ga0501046_0353005_291_1040 249
373 3300049581 Ga0501047_0026326 Ga0501047_0026326_2227_2988 249
374 3300049582 Ga0501048_0001139 Ga0501048_0001139_14350_15102 249
375 3300049582 Ga0501048_0001500 Ga0501048_0001500_14525_15286 249
376 3300049582 Ga0501048_0028556 Ga0501048_0028556_1419_2168 249
377 3300049582 Ga0501048_0318873 Ga0501048_0318873_322_1077 249
378 3300049583 Ga0501067_0000516 Ga0501067_0000516_1450_2199 249
379 3300049583 Ga0501067_0026821 Ga0501067_0026821_1072_1824 249
380 3300049584 Ga0501068_0000011 Ga0501068_0000011_39043_39804 249
381 3300049585 Ga0501069_0000482 Ga0501069_0000482_845_1594 249
382 3300049585 Ga0501069_0002134 Ga0501069_0002134_2616_3368 249
383 3300049585 Ga0501069_0004504 Ga0501069_0004504_2386_3147 249
384 3300049585 Ga0501069_0005912 Ga0501069_0005912_1820_2569 249
385 3300049585 Ga0501069_0075950 Ga0501069_0075950_634_1383 249
386 3300049586 Ga0501070_0003288 Ga0501070_0003288_4857_5606 249
387 3300049586 Ga0501070_0010643 Ga0501070_0010643_2722_3483 249
388 3300049586 Ga0501070_0012724 Ga0501070_0012724_2886_3638 249
389 3300049587 Ga0501071_0006394 Ga0501071_0006394_6813_7565 249
390 3300049587 Ga0501071_0007457 Ga0501071_0007457_3682_4443 249
391 3300049587 Ga0501071_0060487 Ga0501071_0060487_1598_2359 249
392 3300049587 Ga0501071_0136118 Ga0501071_0136118_381_1130 249
393 3300049588 Ga0501072_0000354 Ga0501072_0000354_9101_9853 249
394 3300049588 Ga0501072_0002880 Ga0501072_0002880_2386_3147 249
395 3300049588 Ga0501072_0006422 Ga0501072_0006422_375_1124 249
396 3300049589 Ga0501073_0032970 Ga0501073_0032970_2074_2835 249
397 3300049589 Ga0501073_0051970 Ga0501073_0051970_1149_1901 249
398 3300049590 Ga0501074_0000438 Ga0501074_0000438_20413_21174 249
399 3300049590 Ga0501074_0046401 Ga0501074_0046401_2165_2926 249
400 3300049590 Ga0501074_0080284 Ga0501074_0080284_1154_1903 249
401 3300049591 Ga0501075_0000040 Ga0501075_0000040_5807_6568 249
402 3300049591 Ga0501075_0028861 Ga0501075_0028861_1249_2010 249
403 3300049592 Ga0501076_0000089 Ga0501076_0000089_26138_26899 249
404 3300049592 Ga0501076_0008506 Ga0501076_0008506_6498_7250 249
405 3300049592 Ga0501076_0041762 Ga0501076_0041762_1264_2025 249
406 3300049592 Ga0501076_0218325 Ga0501076_0218325_636_1385 249
407 3300049592 Ga0501076_0317113 Ga0501076_0317113_250_1002 249
408 3300049593 Ga0501077_0000172 Ga0501077_0000172_15958_16719 249
409 3300049593 Ga0501077_0005913 Ga0501077_0005913_687_1439 249
410 3300049593 Ga0501077_0020179 Ga0501077_0020179_639_1388 249
411 3300049593 Ga0501077_0064592 Ga0501077_0064592_249_1010 249
412 3300049593 Ga0501077_0156551 Ga0501077_0156551_10_765 249
413 3300049741 Ga0501079_0002976 Ga0501079_0002976_4543_5304 249
414 3300049741 Ga0501079_0004229 Ga0501079_0004229_4702_5454 249
415 3300049741 Ga0501079_0092544 Ga0501079_0092544_197_958 249
416 3300049742 Ga0501080_0000142 Ga0501080_0000142_35460_36221 249
417 3300049742 Ga0501080_0018136 Ga0501080_0018136_4923_5675 249
418 3300049742 Ga0501080_0055738 Ga0501080_0055738_1664_2413 249
419 3300049743 Ga0501081_0006516 Ga0501081_0006516_4543_5304 249
420 3300049743 Ga0501081_0010258 Ga0501081_0010258_3576_4328 249
421 3300049743 Ga0501081_0014393 Ga0501081_0014393_3461_4216 249
422 3300049743 Ga0501081_0030509 Ga0501081_0030509_506_1267 249
423 3300049743 Ga0501081_0322341 Ga0501081_0322341_42_791 249
424 3300049744 Ga0501083_0001626 Ga0501083_0001626_8820_9581 249
425 3300049744 Ga0501083_0070369 Ga0501083_0070369_555_1307 249
426 3300049744 Ga0501083_0188900 Ga0501083_0188900_422_1171 249
427 3300049744 Ga0501083_0203833 Ga0501083_0203833_178_933 249
428 3300049822 Ga0501035_0005187 Ga0501035_0005187_9179_9940 249
429 3300049822 Ga0501035_0008094 Ga0501035_0008094_1554_2303 249
430 3300049822 Ga0501035_0144670 Ga0501035_0144670_766_1518 249
431 3300049823 Ga0501044_0019579 Ga0501044_0019579_3916_4677 249
432 3300049823 Ga0501044_0070013 Ga0501044_0070013_1049_1798 249
433 3300049824 Ga0501045_0000357 Ga0501045_0000357_11593_12345 249
434 3300049824 Ga0501045_0008579 Ga0501045_0008579_3620_4381 249
435 3300049824 Ga0501045_0021415 Ga0501045_0021415_1483_2244 249
436 3300049824 Ga0501045_0602341 Ga0501045_0602341_10_771 249
437 3300050492 nmdc:mga0yw44_53407_c1 nmdc:mga0yw44_53407_c1_86_838 249
438 3300050507 nmdc:mga05p37_498140_c1 nmdc:mga05p37_498140_c1_248_1003 249
439 3300050507 nmdc:mga05p37_831558_c1 nmdc:mga05p37_831558_c1_124_873 249
440 3300050508 nmdc:mga09592_394182_c1 nmdc:mga09592_394182_c1_206_964 249
441 3300050510 nmdc:mga06r32_672918_c1 nmdc:mga06r32_672918_c1_24_782 249
442 3300050511 nmdc:mga08y16_16896_c1 nmdc:mga08y16_16896_c1_6516_7265 249
443 3300050511 nmdc:mga08y16_17863_c1 nmdc:mga08y16_17863_c1_3774_4523 249
444 3300050512 nmdc:mga0n895_18537_c1 nmdc:mga0n895_18537_c1_4771_5523 249
445 3300050515 nmdc:mga0a205_321354_c1 nmdc:mga0a205_321354_c1_377_1129 249
446 3300053077 Ga0495601_0049162 Ga0495601_0049162_824_1582 249
447 3300054114 Ga0501084_0000144 Ga0501084_0000144_42338_43090 249
448 3300054114 Ga0501084_0013228 Ga0501084_0013228_2386_3147 249
449 3300054114 Ga0501084_0039678 Ga0501084_0039678_1312_2073 249
450 3300054114 Ga0501084_0127428 Ga0501084_0127428_235_984 249
451 3300054114 Ga0501084_0202722 Ga0501084_0202722_235_987 249
452 3300060353 Ga0501082_0000730 Ga0501082_0000730_14042_14803 249
453 3300060353 Ga0501082_0001289 Ga0501082_0001289_17550_18302 249
454 3300060353 Ga0501082_0052277 Ga0501082_0052277_1463_2224 249
455 3300060353 Ga0501082_0055411 Ga0501082_0055411_2447_3202 249
456 3300060353 Ga0501082_0121746 Ga0501082_0121746_302_1051 249
457 3300061734 Ga0530510_0000612 Ga0530510_0000612_12144_12905 249
458 3300061734 Ga0530510_0002207 Ga0530510_0002207_1689_2441 249
459 3300061734 Ga0530510_0102748 Ga0530510_0102748_257_1006 249
460 3300061734 Ga0530510_0296545 Ga0530510_0296545_259_1020 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

79

185

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.9267 2 242
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.9151 2 235
5n9m-assembly2.cif.gz_B crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation 0.9046 2 242
6fqb-assembly4.cif.gz_H murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 0.8514 2 235
5f9y-assembly3.cif.gz_B crystal structure of prolyl-trna synthetase from cryptosporidium parvum complexed with l-proline and amp 0.7601 1 39
ID Description Score Start End Superfamily
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9478 15 212 3.40.50.880
af_Q2FX00_16_208_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9384 15 212 3.40.50.880
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9291 16 212 3.40.50.880
af_I6XI14_15_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9201 16 212 3.40.50.880
af_Q54VK0_115_197_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8579 2 42 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A538G3M5-F1-model_v4 Glutamine amidotransferase 0.9953 2 182 GO:0006541
GO:0016740
AF-A0A838FFP9-F1-model_v4 Glutamine amidotransferase 0.9837 1 95 GO:0016740
AF-A0A7W0SYC4-F1-model_v4 Glutamine amidotransferase 0.9825 86 249 GO:0006541
GO:0016740
AF-A0A7W1IKL4-F1-model_v4 Glutamine amidotransferase 0.9817 2 194 GO:0004359
GO:0006541
GO:0009236
GO:0016740
GO:0071555
AF-A0A2E7MPV6-F1-model_v4 Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD (EC 6.3.5.13) (Lipid II isoglutaminyl synthase glutaminase subunit) (EC 3.5.1.2) 0.9776 1 243 GO:0004359
GO:0006541
GO:0008360
GO:0009236
GO:0009252
GO:0016740
GO:0071555
GO:0140282

Feature Viewer

pLDDT pTM Quality
93.83 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map