F448626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 215 | 460 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300049584|Ga0501068_0007019|Ga0501068_0007019_5352_6119 |
| Length | 238 |
| Sequence | VIVRVGHLYPEYLNIYADRGNIAVLERRAAWRGHELAVTPIGLGDALEPGAHDLLYVGGGQDREQALIAPDLAAKGDAIAALGRGYRGRDGSTMPGAGLFPHETVAGERRMIGDVLLECELDPGERRTVAGFENHAGRTRLDPGAVPLGRVVAGFGNDGESGFEGCRVGTALGTYLHGPLLPRNPWLADWLLSRALAHATGEAPRPLEPLPDELERQAHAVSAGRARERGGRGLCGIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 116 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 117 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 118 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 124 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 125 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 6.3 |
| Rhizosphere | 92.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100067996 | 3300005329 | Bacteria | 3319 |
| 2 | Ga0070683_100096565 | 3300005329 | Bacteria | 2780 |
| 3 | Ga0070690_100109295 | 3300005330 | Bacteria | 1843 |
| 4 | Ga0070691_10012479 | 3300005341 | Bacteria | 3891 |
| 5 | Ga0070691_10036046 | 3300005341 | Bacteria | 2330 |
| 6 | Ga0070687_100062784 | 3300005343 | Bacteria | 1968 |
| 7 | Ga0070692_10011357 | 3300005345 | Bacteria | 4085 |
| 8 | Ga0070668_100009363 | 3300005347 | Bacteria | 7266 |
| 9 | Ga0070674_100125068 | 3300005356 | Bacteria | 1908 |
| 10 | Ga0070674_100359806 | 3300005356 | Bacteria | 1178 |
| 11 | Ga0070659_100274265 | 3300005366 | Bacteria | 1402 |
| 12 | Ga0070703_10020086 | 3300005406 | Bacteria | 1941 |
| 13 | Ga0070714_100119901 | 3300005435 | Bacteria | 2339 |
| 14 | Ga0070713_100115062 | 3300005436 | Bacteria | 2350 |
| 15 | Ga0070710_10013927 | 3300005437 | Bacteria | 4037 |
| 16 | Ga0070701_10125896 | 3300005438 | Bacteria | 1450 |
| 17 | Ga0070701_10222566 | 3300005438 | Bacteria | 1126 |
| 18 | Ga0070705_100045000 | 3300005440 | Bacteria | 2537 |
| 19 | Ga0070700_100018858 | 3300005441 | Bacteria | 3973 |
| 20 | Ga0070700_100094422 | 3300005441 | Bacteria | 1958 |
| 21 | Ga0070681_10470834 | 3300005458 | Bacteria | 1169 |
| 22 | Ga0068867_100304142 | 3300005459 | Bacteria | 1316 |
| 23 | Ga0068867_100321084 | 3300005459 | Unclassified | 1283 |
| 24 | Ga0070685_10270933 | 3300005466 | Bacteria | 1133 |
| 25 | Ga0070706_100153861 | 3300005467 | Bacteria | 2147 |
| 26 | Ga0070707_100093164 | 3300005468 | Bacteria | 2917 |
| 27 | Ga0070698_100004043 | 3300005471 | Bacteria | 16137 |
| 28 | Ga0070698_100006972 | 3300005471 | Bacteria | 12237 |
| 29 | Ga0070698_100033852 | 3300005471 | Bacteria | 5293 |
| 30 | Ga0070699_100014550 | 3300005518 | Bacteria | 6768 |
| 31 | Ga0070699_100139917 | 3300005518 | Unclassified | 2137 |
| 32 | Ga0070697_100270287 | 3300005536 | Bacteria | 1457 |
| 33 | Ga0070672_100279917 | 3300005543 | Bacteria | 1410 |
| 34 | Ga0070686_100132507 | 3300005544 | Bacteria | 1725 |
| 35 | Ga0070686_100135967 | 3300005544 | Bacteria | 1706 |
| 36 | Ga0070695_100084576 | 3300005545 | Bacteria | 2105 |
| 37 | Ga0070693_100025509 | 3300005547 | Bacteria | 3183 |
| 38 | Ga0070704_100058703 | 3300005549 | Bacteria | 2741 |
| 39 | Ga0070704_100177899 | 3300005549 | Bacteria | 1699 |
| 40 | Ga0068855_100142692 | 3300005563 | Bacteria | 2728 |
| 41 | Ga0068855_100361295 | 3300005563 | Bacteria | 1598 |
| 42 | Ga0068857_100116991 | 3300005577 | Unclassified | 2399 |
| 43 | Ga0070702_100006382 | 3300005615 | Bacteria | 5578 |
| 44 | Ga0070702_100049406 | 3300005615 | Bacteria | 2398 |
| 45 | Ga0068859_100364110 | 3300005617 | Unclassified | 1541 |
| 46 | Ga0068866_10272768 | 3300005718 | Bacteria | 1045 |
| 47 | Ga0068866_10359357 | 3300005718 | Bacteria | 928 |
| 48 | Ga0068861_100228827 | 3300005719 | Bacteria | 1576 |
| 49 | Ga0068860_100296896 | 3300005843 | Bacteria | 1582 |
| 50 | Ga0068860_100393907 | 3300005843 | Bacteria | 1369 |
| 51 | Ga0081455_10017728 | 3300005937 | Bacteria | 6813 |
| 52 | Ga0081455_10108018 | 3300005937 | Bacteria | 2217 |
| 53 | Ga0081538_10000057 | 3300005981 | Bacteria | 102521 |
| 54 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 55 | Ga0081539_10020311 | 3300005985 | Bacteria | 4497 |
| 56 | Ga0075365_10042218 | 3300006038 | Bacteria | 2981 |
| 57 | Ga0075365_10171365 | 3300006038 | Bacteria | 1515 |
| 58 | Ga0070712_100040160 | 3300006175 | Bacteria | 3206 |
| 59 | Ga0075428_100032779 | 3300006844 | Bacteria | 5737 |
| 60 | Ga0075428_100083770 | 3300006844 | Bacteria | 3479 |
| 61 | Ga0075428_100268382 | 3300006844 | Bacteria | 1836 |
| 62 | Ga0075428_101072793 | 3300006844 | Unclassified | 851 |
| 63 | Ga0075430_100237238 | 3300006846 | Bacteria | 1511 |
| 64 | Ga0075431_100611717 | 3300006847 | Bacteria | 1073 |
| 65 | Ga0075434_100005176 | 3300006871 | Bacteria | 11840 |
| 66 | Ga0075429_100016896 | 3300006880 | Bacteria | 6313 |
| 67 | Ga0097620_100364127 | 3300006931 | Unclassified | 1541 |
| 68 | Ga0105240_10434144 | 3300009093 | Bacteria | 1473 |
| 69 | Ga0111539_10004593 | 3300009094 | Bacteria | 18043 |
| 70 | Ga0111539_10007332 | 3300009094 | Bacteria | 14124 |
| 71 | Ga0111539_10017628 | 3300009094 | Bacteria | 8840 |
| 72 | Ga0111539_10302749 | 3300009094 | Bacteria | 1860 |
| 73 | Ga0111539_10940458 | 3300009094 | Bacteria | 1005 |
| 74 | Ga0111539_11247330 | 3300009094 | Bacteria | 863 |
| 75 | Ga0105245_10059581 | 3300009098 | Bacteria | 3438 |
| 76 | Ga0105245_10155361 | 3300009098 | Bacteria | 2166 |
| 77 | Ga0105245_10230602 | 3300009098 | Bacteria | 1791 |
| 78 | Ga0105245_10309239 | 3300009098 | Bacteria | 1553 |
| 79 | Ga0105245_10316992 | 3300009098 | Bacteria | 1535 |
| 80 | Ga0105245_10376241 | 3300009098 | Bacteria | 1413 |
| 81 | Ga0114129_10010978 | 3300009147 | Bacteria | 12905 |
| 82 | Ga0114129_10017065 | 3300009147 | Bacteria | 10335 |
| 83 | Ga0114129_10180333 | 3300009147 | Bacteria | 2874 |
| 84 | Ga0114129_11345026 | 3300009147 | Bacteria | 883 |
| 85 | Ga0105243_10135815 | 3300009148 | Bacteria | 2092 |
| 86 | Ga0105243_10243663 | 3300009148 | Bacteria | 1601 |
| 87 | Ga0105243_10674276 | 3300009148 | Bacteria | 1005 |
| 88 | Ga0105242_10495810 | 3300009176 | Bacteria | 1161 |
| 89 | Ga0105248_10024828 | 3300009177 | Bacteria | 6664 |
| 90 | Ga0105237_10114600 | 3300009545 | Unclassified | 2688 |
| 91 | Ga0105238_10732183 | 3300009551 | Bacteria | 1002 |
| 92 | Ga0105249_10010851 | 3300009553 | Bacteria | 8006 |
| 93 | Ga0105249_10036826 | 3300009553 | Bacteria | 4439 |
| 94 | Ga0105249_10099670 | 3300009553 | Bacteria | 2731 |
| 95 | Ga0105249_10217612 | 3300009553 | Bacteria | 1878 |
| 96 | Ga0105249_10331437 | 3300009553 | Bacteria | 1536 |
| 97 | Ga0105249_10648983 | 3300009553 | Bacteria | 1113 |
| 98 | Ga0105239_10038088 | 3300010375 | Bacteria | 5268 |
| 99 | Ga0105239_10071415 | 3300010375 | Bacteria | 3814 |
| 100 | Ga0105246_10038708 | 3300011119 | Bacteria | 3208 |
| 101 | Ga0105246_10042765 | 3300011119 | Bacteria | 3069 |
| 102 | Ga0105246_10137451 | 3300011119 | Bacteria | 1833 |
| 103 | Ga0157371_10173040 | 3300013102 | Bacteria | 1543 |
| 104 | Ga0157378_10096259 | 3300013297 | Bacteria | 2697 |
| 105 | Ga0163162_10021629 | 3300013306 | Bacteria | 6336 |
| 106 | Ga0157372_10506307 | 3300013307 | Bacteria | 1408 |
| 107 | Ga0157375_10598480 | 3300013308 | Bacteria | 1262 |
| 108 | Ga0163163_10121714 | 3300014325 | Bacteria | 2643 |
| 109 | Ga0157377_10004169 | 3300014745 | Bacteria | 6605 |
| 110 | Ga0157379_10367281 | 3300014968 | Bacteria | 1319 |
| 111 | Ga0157376_10001321 | 3300014969 | Bacteria | 16360 |
| 112 | Ga0157376_10006667 | 3300014969 | Bacteria | 8175 |
| 113 | Ga0157376_10153912 | 3300014969 | Bacteria | 2077 |
| 114 | Ga0163161_10333347 | 3300017792 | Bacteria | 1202 |
| 115 | Ga0207688_10090435 | 3300025901 | Bacteria | 1757 |
| 116 | Ga0207699_10063470 | 3300025906 | Bacteria | 2231 |
| 117 | Ga0207645_10152386 | 3300025907 | Bacteria | 1509 |
| 118 | Ga0207643_10047908 | 3300025908 | Bacteria | 2420 |
| 119 | Ga0207707_10488020 | 3300025912 | Bacteria | 1052 |
| 120 | Ga0207693_10006295 | 3300025915 | Bacteria | 9849 |
| 121 | Ga0207693_10009157 | 3300025915 | Bacteria | 8083 |
| 122 | Ga0207662_10122143 | 3300025918 | Bacteria | 1634 |
| 123 | Ga0207657_10058167 | 3300025919 | Bacteria | 3328 |
| 124 | Ga0207652_10497717 | 3300025921 | Bacteria | 1097 |
| 125 | Ga0207646_10022680 | 3300025922 | Bacteria | 5779 |
| 126 | Ga0207659_10055915 | 3300025926 | Bacteria | 2824 |
| 127 | Ga0207687_10043101 | 3300025927 | Bacteria | 3108 |
| 128 | Ga0207687_10134510 | 3300025927 | Bacteria | 1868 |
| 129 | Ga0207700_10046069 | 3300025928 | Bacteria | 3223 |
| 130 | Ga0207700_10229957 | 3300025928 | Bacteria | 1576 |
| 131 | Ga0207690_10061569 | 3300025932 | Bacteria | 2552 |
| 132 | Ga0207690_10398266 | 3300025932 | Bacteria | 1097 |
| 133 | Ga0207706_10008758 | 3300025933 | Bacteria | 9313 |
| 134 | Ga0207706_10042968 | 3300025933 | Bacteria | 4005 |
| 135 | Ga0207706_10052165 | 3300025933 | Bacteria | 3611 |
| 136 | Ga0207669_10073460 | 3300025937 | Bacteria | 2158 |
| 137 | Ga0207704_10653708 | 3300025938 | Bacteria | 866 |
| 138 | Ga0207665_10144486 | 3300025939 | Bacteria | 1699 |
| 139 | Ga0207691_10305008 | 3300025940 | Bacteria | 1367 |
| 140 | Ga0207661_10019751 | 3300025944 | Bacteria | 5029 |
| 141 | Ga0207667_10413289 | 3300025949 | Bacteria | 1373 |
| 142 | Ga0207712_10042305 | 3300025961 | Bacteria | 3136 |
| 143 | Ga0207712_10220788 | 3300025961 | Bacteria | 1515 |
| 144 | Ga0207668_10036930 | 3300025972 | Bacteria | 3266 |
| 145 | Ga0207640_10130749 | 3300025981 | Bacteria | 1814 |
| 146 | Ga0207640_10185645 | 3300025981 | Bacteria | 1563 |
| 147 | Ga0207677_10149773 | 3300026023 | Bacteria | 1798 |
| 148 | Ga0207677_10231675 | 3300026023 | Bacteria | 1488 |
| 149 | Ga0207703_10131085 | 3300026035 | Unclassified | 2165 |
| 150 | Ga0207639_10097922 | 3300026041 | Bacteria | 2363 |
| 151 | Ga0207708_10009212 | 3300026075 | Bacteria | 7307 |
| 152 | Ga0207708_10038461 | 3300026075 | Bacteria | 3644 |
| 153 | Ga0207702_10023418 | 3300026078 | Bacteria | 5121 |
| 154 | Ga0207641_10890209 | 3300026088 | Bacteria | 884 |
| 155 | Ga0207648_10031354 | 3300026089 | Bacteria | 4700 |
| 156 | Ga0207648_10041718 | 3300026089 | Bacteria | 4030 |
| 157 | Ga0207648_10178107 | 3300026089 | Bacteria | 1881 |
| 158 | Ga0207674_10006223 | 3300026116 | Bacteria | 14068 |
| 159 | Ga0207674_10026768 | 3300026116 | Bacteria | 6117 |
| 160 | Ga0207675_100007556 | 3300026118 | Bacteria | 10270 |
| 161 | Ga0207675_100092754 | 3300026118 | Bacteria | 2840 |
| 162 | Ga0207683_10162696 | 3300026121 | Bacteria | 2018 |
| 163 | Ga0207428_10009220 | 3300027907 | Bacteria | 8864 |
| 164 | Ga0207428_10009605 | 3300027907 | Bacteria | 8666 |
| 165 | Ga0268265_10051134 | 3300028380 | Bacteria | 3118 |
| 166 | Ga0268264_10530423 | 3300028381 | Bacteria | 1152 |
| 167 | Ga0307408_100025364 | 3300031548 | Bacteria | 4061 |
| 168 | Ga0307408_100298735 | 3300031548 | Bacteria | 1348 |
| 169 | Ga0307413_10003425 | 3300031824 | Bacteria | 6671 |
| 170 | Ga0307410_10090673 | 3300031852 | Bacteria | 2168 |
| 171 | Ga0307406_10030824 | 3300031901 | Bacteria | 3260 |
| 172 | Ga0307406_10106086 | 3300031901 | Bacteria | 1924 |
| 173 | Ga0307412_10097390 | 3300031911 | Unclassified | 2073 |
| 174 | Ga0307409_100011218 | 3300031995 | Bacteria | 5633 |
| 175 | Ga0307409_100035980 | 3300031995 | Bacteria | 3634 |
| 176 | Ga0307409_100207906 | 3300031995 | Bacteria | 1756 |
| 177 | Ga0307416_100001425 | 3300032002 | Bacteria | 12993 |
| 178 | Ga0307416_100012791 | 3300032002 | Bacteria | 5674 |
| 179 | Ga0307416_100380294 | 3300032002 | Bacteria | 1442 |
| 180 | Ga0307416_101009881 | 3300032002 | Bacteria | 935 |
| 181 | Ga0307414_10178078 | 3300032004 | Bacteria | 1707 |
| 182 | Ga0307415_100000286 | 3300032126 | Bacteria | 21920 |
| 183 | Ga0307415_100014075 | 3300032126 | Bacteria | 4690 |
| 184 | Ga0373952_0029053 | 3300035092 | Bacteria | 1217 |
| 185 | Ga0395899_0003283 | 3300037312 | Bacteria | 12824 |
| 186 | Ga0395899_0050094 | 3300037312 | Bacteria | 3102 |
| 187 | Ga0395899_0066100 | 3300037312 | Bacteria | 2655 |
| 188 | Ga0395899_0077036 | 3300037312 | Bacteria | 2433 |
| 189 | Ga0395900_0005323 | 3300037418 | Bacteria | 13489 |
| 190 | Ga0395900_0016923 | 3300037418 | Bacteria | 7442 |
| 191 | Ga0395900_0039832 | 3300037418 | Bacteria | 4842 |
| 192 | Ga0395900_0044318 | 3300037418 | Bacteria | 4584 |
| 193 | Ga0395900_0066125 | 3300037418 | Bacteria | 3715 |
| 194 | Ga0395900_0568422 | 3300037418 | Bacteria | 1077 |
| 195 | Ga0395898_0002616 | 3300037466 | Bacteria | 20962 |
| 196 | Ga0395898_0005906 | 3300037466 | Bacteria | 13162 |
| 197 | Ga0395898_0007257 | 3300037466 | Bacteria | 11761 |
| 198 | Ga0395898_0025937 | 3300037466 | Bacteria | 5902 |
| 199 | Ga0395898_0064923 | 3300037466 | Bacteria | 3540 |
| 200 | Ga0395898_0083514 | 3300037466 | Bacteria | 3078 |
| 201 | Ga0395898_0533117 | 3300037466 | Bacteria | 1116 |
| 202 | Ga0395905_0007137 | 3300037471 | Bacteria | 11170 |
| 203 | Ga0395905_0014937 | 3300037471 | Bacteria | 7407 |
| 204 | Ga0395905_0018631 | 3300037471 | Bacteria | 6584 |
| 205 | Ga0395905_0147780 | 3300037471 | Unclassified | 2211 |
| 206 | Ga0395901_0001394 | 3300038443 | Bacteria | 25270 |
| 207 | Ga0395901_0002239 | 3300038443 | Bacteria | 19733 |
| 208 | Ga0395901_0014181 | 3300038443 | Bacteria | 8114 |
| 209 | Ga0395901_0024380 | 3300038443 | Bacteria | 6207 |
| 210 | Ga0395901_0150080 | 3300038443 | Bacteria | 2449 |
| 211 | Ga0395901_0400119 | 3300038443 | Unclassified | 1411 |
| 212 | Ga0451839_0176762 | 3300041496 | Bacteria | 1772 |
| 213 | Ga0451853_0176963 | 3300041512 | Bacteria | 1499 |
| 214 | Ga0451853_0445709 | 3300041512 | Bacteria | 6578 |
| 215 | Ga0439448_0004097 | 3300042005 | Bacteria | 4101 |
| 216 | Ga0450920_015127 | 3300042122 | Bacteria | 1465 |
| 217 | Ga0439458_0009648 | 3300042157 | Bacteria | 2150 |
| 218 | Ga0466963_0441874 | 3300044694 | Bacteria | 918 |
| 219 | Ga0466964_0001299 | 3300044706 | Bacteria | 8521 |
| 220 | Ga0466964_0136606 | 3300044706 | Bacteria | 1122 |
| 221 | Ga0451576_0009834 | 3300045051 | Bacteria | 11052 |
| 222 | Ga0495603_0009829 | 3300046455 | Bacteria | 5789 |
| 223 | Ga0495641_0141132 | 3300046461 | Unclassified | 1076 |
| 224 | Ga0495653_0042394 | 3300046463 | Bacteria | 3545 |
| 225 | Ga0495605_0026177 | 3300046474 | Bacteria | 3033 |
| 226 | Ga0495584_0096775 | 3300046491 | Bacteria | 1491 |
| 227 | Ga0495584_0230953 | 3300046491 | Bacteria | 940 |
| 228 | Ga0495584_0291072 | 3300046491 | Bacteria | 830 |
| 229 | Ga0495585_0064516 | 3300046492 | Bacteria | 2008 |
| 230 | Ga0495594_0293189 | 3300046499 | Bacteria | 927 |
| 231 | Ga0495618_0068013 | 3300046514 | Bacteria | 2265 |
| 232 | Ga0495620_0072700 | 3300046515 | Bacteria | 1404 |
| 233 | Ga0495620_0127157 | 3300046515 | Bacteria | 1002 |
| 234 | Ga0495630_0084869 | 3300046517 | Bacteria | 2390 |
| 235 | Ga0495665_0135366 | 3300046531 | Unclassified | 1289 |
| 236 | Ga0495597_0136554 | 3300046542 | Bacteria | 1014 |
| 237 | Ga0495667_0067798 | 3300046559 | Bacteria | 2331 |
| 238 | Ga0495667_0082408 | 3300046559 | Bacteria | 2090 |
| 239 | Ga0495667_0280785 | 3300046559 | Bacteria | 1057 |
| 240 | Ga0495656_0062599 | 3300046615 | Bacteria | 1628 |
| 241 | Ga0495656_0239385 | 3300046615 | Bacteria | 913 |
| 242 | Ga0495634_0087165 | 3300046642 | Bacteria | 2032 |
| 243 | Ga0495635_0066610 | 3300046663 | Bacteria | 2470 |
| 244 | Ga0495635_0135861 | 3300046663 | Bacteria | 1676 |
| 245 | Ga0495659_0002767 | 3300046664 | Bacteria | 5644 |
| 246 | Ga0495646_0099408 | 3300046680 | Bacteria | 1670 |
| 247 | Ga0495613_0282770 | 3300046689 | Unclassified | 1152 |
| 248 | Ga0495670_0068348 | 3300046691 | Unclassified | 1795 |
| 249 | Ga0495581_0014097 | 3300047315 | Unclassified | 4632 |
| 250 | Ga0495581_0017173 | 3300047315 | Bacteria | 4206 |
| 251 | Ga0495674_0037621 | 3300047319 | Bacteria | 4348 |
| 252 | Ga0495674_0191341 | 3300047319 | Bacteria | 1700 |
| 253 | Ga0495676_0068930 | 3300047321 | Bacteria | 2731 |
| 254 | Ga0495680_0017808 | 3300047322 | Bacteria | 6048 |
| 255 | Ga0495684_0023816 | 3300047471 | Bacteria | 4708 |
| 256 | Ga0495684_0029206 | 3300047471 | Bacteria | 4232 |
| 257 | Ga0495684_0044458 | 3300047471 | Bacteria | 3401 |
| 258 | Ga0495614_0074549 | 3300048089 | Bacteria | 1466 |
| 259 | Ga0495626_0028167 | 3300048091 | Bacteria | 2726 |
| 260 | Ga0496101_0186795 | 3300048904 | Bacteria | 1598 |
| 261 | Ga0496102_0073132 | 3300048905 | Bacteria | 3151 |
| 262 | Ga0496103_0052054 | 3300048906 | Bacteria | 2536 |
| 263 | Ga0496104_0000772 | 3300048907 | Bacteria | 27396 |
| 264 | Ga0496104_0010424 | 3300048907 | Bacteria | 8302 |
| 265 | Ga0496104_0053971 | 3300048907 | Unclassified | 3798 |
| 266 | Ga0496105_0000542 | 3300048908 | Bacteria | 24896 |
| 267 | Ga0496105_0060951 | 3300048908 | Bacteria | 3113 |
| 268 | Ga0496106_0052710 | 3300048909 | Bacteria | 3070 |
| 269 | Ga0496106_0209375 | 3300048909 | Bacteria | 1553 |
| 270 | Ga0496108_0002080 | 3300048911 | Bacteria | 16011 |
| 271 | Ga0496108_0004739 | 3300048911 | Bacteria | 10967 |
| 272 | Ga0496109_0001642 | 3300048912 | Bacteria | 18684 |
| 273 | Ga0496109_0013491 | 3300048912 | Bacteria | 7089 |
| 274 | Ga0496109_0087585 | 3300048912 | Unclassified | 2876 |
| 275 | Ga0496110_0000787 | 3300048913 | Bacteria | 22120 |
| 276 | Ga0496110_0002026 | 3300048913 | Bacteria | 15085 |
| 277 | Ga0496110_0008121 | 3300048913 | Bacteria | 8432 |
| 278 | Ga0496110_0012389 | 3300048913 | Bacteria | 7011 |
| 279 | Ga0496110_0465020 | 3300048913 | Bacteria | 1153 |
| 280 | Ga0496111_0000234 | 3300048914 | Bacteria | 26582 |
| 281 | Ga0496111_0001318 | 3300048914 | Bacteria | 13940 |
| 282 | Ga0496112_0034001 | 3300048915 | Bacteria | 4959 |
| 283 | Ga0496112_0585730 | 3300048915 | Bacteria | 1048 |
| 284 | Ga0496113_0021005 | 3300048916 | Bacteria | 4600 |
| 285 | Ga0496113_0215746 | 3300048916 | Unclassified | 1528 |
| 286 | Ga0496113_0293846 | 3300048916 | Bacteria | 1300 |
| 287 | Ga0496114_0361936 | 3300048917 | Bacteria | 1283 |
| 288 | Ga0496115_0007169 | 3300048918 | Bacteria | 8187 |
| 289 | Ga0501031_0000640 | 3300049568 | Bacteria | 20732 |
| 290 | Ga0501031_0000679 | 3300049568 | Bacteria | 20283 |
| 291 | Ga0501031_0004457 | 3300049568 | Bacteria | 9082 |
| 292 | Ga0501031_0015927 | 3300049568 | Bacteria | 4881 |
| 293 | Ga0501032_0006634 | 3300049569 | Bacteria | 8496 |
| 294 | Ga0501032_0013463 | 3300049569 | Bacteria | 5816 |
| 295 | Ga0501032_0016637 | 3300049569 | Bacteria | 5170 |
| 296 | Ga0501032_0051185 | 3300049569 | Bacteria | 2785 |
| 297 | Ga0501033_0001257 | 3300049570 | Bacteria | 22689 |
| 298 | Ga0501033_0004461 | 3300049570 | Bacteria | 11198 |
| 299 | Ga0501033_0007690 | 3300049570 | Bacteria | 8363 |
| 300 | Ga0501033_0084620 | 3300049570 | Bacteria | 2324 |
| 301 | Ga0501034_0046112 | 3300049571 | Bacteria | 4404 |
| 302 | Ga0501036_0000260 | 3300049572 | Bacteria | 35885 |
| 303 | Ga0501036_0000438 | 3300049572 | Bacteria | 29594 |
| 304 | Ga0501036_0002733 | 3300049572 | Bacteria | 13950 |
| 305 | Ga0501036_0325210 | 3300049572 | Bacteria | 1285 |
| 306 | Ga0501037_0000275 | 3300049573 | Bacteria | 43921 |
| 307 | Ga0501037_0120338 | 3300049573 | Bacteria | 1888 |
| 308 | Ga0501037_0283196 | 3300049573 | Bacteria | 1154 |
| 309 | Ga0501038_0000230 | 3300049574 | Bacteria | 47516 |
| 310 | Ga0501038_0001135 | 3300049574 | Bacteria | 24147 |
| 311 | Ga0501038_0008509 | 3300049574 | Bacteria | 9430 |
| 312 | Ga0501038_0015611 | 3300049574 | Bacteria | 6903 |
| 313 | Ga0501039_0000406 | 3300049575 | Bacteria | 30991 |
| 314 | Ga0501039_0006769 | 3300049575 | Bacteria | 8720 |
| 315 | Ga0501039_0180404 | 3300049575 | Bacteria | 1660 |
| 316 | Ga0501039_0468547 | 3300049575 | Bacteria | 989 |
| 317 | Ga0501040_0000592 | 3300049576 | Bacteria | 22114 |
| 318 | Ga0501040_0008421 | 3300049576 | Bacteria | 6700 |
| 319 | Ga0501040_0016289 | 3300049576 | Bacteria | 4917 |
| 320 | Ga0501040_0359390 | 3300049576 | Bacteria | 1043 |
| 321 | Ga0501040_0382239 | 3300049576 | Bacteria | 1010 |
| 322 | Ga0501040_0484686 | 3300049576 | Bacteria | 891 |
| 323 | Ga0501041_0000272 | 3300049577 | Bacteria | 24566 |
| 324 | Ga0501041_0000911 | 3300049577 | Bacteria | 16004 |
| 325 | Ga0501041_0003737 | 3300049577 | Bacteria | 8754 |
| 326 | Ga0501041_0037419 | 3300049577 | Bacteria | 2940 |
| 327 | Ga0501042_0000997 | 3300049578 | Bacteria | 16053 |
| 328 | Ga0501042_0003497 | 3300049578 | Bacteria | 9870 |
| 329 | Ga0501042_0014020 | 3300049578 | Bacteria | 5463 |
| 330 | Ga0501042_0014994 | 3300049578 | Bacteria | 5299 |
| 331 | Ga0501042_0033130 | 3300049578 | Bacteria | 3662 |
| 332 | Ga0501043_0003228 | 3300049579 | Bacteria | 13458 |
| 333 | Ga0501043_0004614 | 3300049579 | Bacteria | 11177 |
| 334 | Ga0501043_0204607 | 3300049579 | Bacteria | 1531 |
| 335 | Ga0501046_0001734 | 3300049580 | Bacteria | 20803 |
| 336 | Ga0501046_0004112 | 3300049580 | Bacteria | 13259 |
| 337 | Ga0501046_0009300 | 3300049580 | Bacteria | 8508 |
| 338 | Ga0501046_0011277 | 3300049580 | Bacteria | 7648 |
| 339 | Ga0501046_0056539 | 3300049580 | Bacteria | 3080 |
| 340 | Ga0501046_0073540 | 3300049580 | Bacteria | 2652 |
| 341 | Ga0501046_0353005 | 3300049580 | Bacteria | 1067 |
| 342 | Ga0501047_0026326 | 3300049581 | Bacteria | 5596 |
| 343 | Ga0501048_0001139 | 3300049582 | Bacteria | 19959 |
| 344 | Ga0501048_0001500 | 3300049582 | Bacteria | 17671 |
| 345 | Ga0501048_0008742 | 3300049582 | Bacteria | 7631 |
| 346 | Ga0501048_0028556 | 3300049582 | Bacteria | 4049 |
| 347 | Ga0501048_0318873 | 3300049582 | Bacteria | 1107 |
| 348 | Ga0501067_0000516 | 3300049583 | Bacteria | 21125 |
| 349 | Ga0501067_0026821 | 3300049583 | Bacteria | 3190 |
| 350 | Ga0501068_0000011 | 3300049584 | Bacteria | 65947 |
| 351 | Ga0501068_0007019 | 3300049584 | Bacteria | 6231 |
| 352 | Ga0501069_0000320 | 3300049585 | Bacteria | 21738 |
| 353 | Ga0501069_0000482 | 3300049585 | Bacteria | 18238 |
| 354 | Ga0501069_0002134 | 3300049585 | Bacteria | 9961 |
| 355 | Ga0501069_0004504 | 3300049585 | Bacteria | 7200 |
| 356 | Ga0501069_0005912 | 3300049585 | Bacteria | 6378 |
| 357 | Ga0501069_0075950 | 3300049585 | Bacteria | 1888 |
| 358 | Ga0501070_0003288 | 3300049586 | Bacteria | 14025 |
| 359 | Ga0501070_0004186 | 3300049586 | Bacteria | 12422 |
| 360 | Ga0501070_0010643 | 3300049586 | Bacteria | 7776 |
| 361 | Ga0501070_0012724 | 3300049586 | Bacteria | 7096 |
| 362 | Ga0501071_0004198 | 3300049587 | Bacteria | 9119 |
| 363 | Ga0501071_0006394 | 3300049587 | Bacteria | 7647 |
| 364 | Ga0501071_0007457 | 3300049587 | Bacteria | 7185 |
| 365 | Ga0501071_0060487 | 3300049587 | Bacteria | 2742 |
| 366 | Ga0501071_0136118 | 3300049587 | Bacteria | 1828 |
| 367 | Ga0501072_0000354 | 3300049588 | Bacteria | 32671 |
| 368 | Ga0501072_0002880 | 3300049588 | Bacteria | 12937 |
| 369 | Ga0501072_0006422 | 3300049588 | Bacteria | 8957 |
| 370 | Ga0501073_0018753 | 3300049589 | Bacteria | 5002 |
| 371 | Ga0501073_0032970 | 3300049589 | Bacteria | 3691 |
| 372 | Ga0501073_0051970 | 3300049589 | Bacteria | 2870 |
| 373 | Ga0501074_0000438 | 3300049590 | Bacteria | 24855 |
| 374 | Ga0501074_0004727 | 3300049590 | Bacteria | 9759 |
| 375 | Ga0501074_0046401 | 3300049590 | Bacteria | 3141 |
| 376 | Ga0501074_0080284 | 3300049590 | Bacteria | 2340 |
| 377 | Ga0501075_0000040 | 3300049591 | Bacteria | 52221 |
| 378 | Ga0501075_0028861 | 3300049591 | Bacteria | 4098 |
| 379 | Ga0501075_0030741 | 3300049591 | Bacteria | 3979 |
| 380 | Ga0501075_0106731 | 3300049591 | Bacteria | 2128 |
| 381 | Ga0501076_0000089 | 3300049592 | Bacteria | 48333 |
| 382 | Ga0501076_0008506 | 3300049592 | Bacteria | 7521 |
| 383 | Ga0501076_0041762 | 3300049592 | Bacteria | 3609 |
| 384 | Ga0501076_0126808 | 3300049592 | Bacteria | 2068 |
| 385 | Ga0501076_0218325 | 3300049592 | Unclassified | 1558 |
| 386 | Ga0501076_0317113 | 3300049592 | Bacteria | 1279 |
| 387 | Ga0501077_0000172 | 3300049593 | Bacteria | 37130 |
| 388 | Ga0501077_0005913 | 3300049593 | Bacteria | 7462 |
| 389 | Ga0501077_0020179 | 3300049593 | Bacteria | 4218 |
| 390 | Ga0501077_0025000 | 3300049593 | Bacteria | 3792 |
| 391 | Ga0501077_0064592 | 3300049593 | Bacteria | 2322 |
| 392 | Ga0501077_0156551 | 3300049593 | Bacteria | 1446 |
| 393 | Ga0501079_0002976 | 3300049741 | Bacteria | 12392 |
| 394 | Ga0501079_0004229 | 3300049741 | Bacteria | 10649 |
| 395 | Ga0501079_0092544 | 3300049741 | Bacteria | 2342 |
| 396 | Ga0501079_0135589 | 3300049741 | Bacteria | 1916 |
| 397 | Ga0501079_0197489 | 3300049741 | Bacteria | 1570 |
| 398 | Ga0501079_0276470 | 3300049741 | Bacteria | 1313 |
| 399 | Ga0501080_0000142 | 3300049742 | Bacteria | 50372 |
| 400 | Ga0501080_0018136 | 3300049742 | Bacteria | 6515 |
| 401 | Ga0501080_0044217 | 3300049742 | Bacteria | 4146 |
| 402 | Ga0501080_0055738 | 3300049742 | Bacteria | 3681 |
| 403 | Ga0501081_0006516 | 3300049743 | Bacteria | 7581 |
| 404 | Ga0501081_0008909 | 3300049743 | Bacteria | 6518 |
| 405 | Ga0501081_0010258 | 3300049743 | Bacteria | 6116 |
| 406 | Ga0501081_0014393 | 3300049743 | Bacteria | 5218 |
| 407 | Ga0501081_0030509 | 3300049743 | Bacteria | 3649 |
| 408 | Ga0501081_0147943 | 3300049743 | Bacteria | 1686 |
| 409 | Ga0501081_0322341 | 3300049743 | Bacteria | 1136 |
| 410 | Ga0501083_0001393 | 3300049744 | Bacteria | 16434 |
| 411 | Ga0501083_0001626 | 3300049744 | Bacteria | 15377 |
| 412 | Ga0501083_0070369 | 3300049744 | Bacteria | 2327 |
| 413 | Ga0501083_0188900 | 3300049744 | Unclassified | 1344 |
| 414 | Ga0501083_0203833 | 3300049744 | Bacteria | 1290 |
| 415 | Ga0501035_0005187 | 3300049822 | Bacteria | 12324 |
| 416 | Ga0501035_0008094 | 3300049822 | Bacteria | 9798 |
| 417 | Ga0501035_0144670 | 3300049822 | Bacteria | 2065 |
| 418 | Ga0501044_0019579 | 3300049823 | Bacteria | 7236 |
| 419 | Ga0501044_0057962 | 3300049823 | Bacteria | 3973 |
| 420 | Ga0501044_0070013 | 3300049823 | Bacteria | 3570 |
| 421 | Ga0501045_0000357 | 3300049824 | Bacteria | 27239 |
| 422 | Ga0501045_0007804 | 3300049824 | Bacteria | 7443 |
| 423 | Ga0501045_0008579 | 3300049824 | Bacteria | 7123 |
| 424 | Ga0501045_0021415 | 3300049824 | Bacteria | 4624 |
| 425 | Ga0501045_0602341 | 3300049824 | Bacteria | 813 |
| 426 | nmdc:mga0yw44_53407_c1 | 3300050492 | Bacteria | 2454 |
| 427 | nmdc:mga05p37_4680_c1 | 3300050507 | Bacteria | 15983 |
| 428 | nmdc:mga05p37_498140_c1 | 3300050507 | Bacteria | 1399 |
| 429 | nmdc:mga05p37_831558_c1 | 3300050507 | Bacteria | 1005 |
| 430 | nmdc:mga09592_14491_c1 | 3300050508 | Bacteria | 6435 |
| 431 | nmdc:mga09592_394182_c1 | 3300050508 | Bacteria | 1197 |
| 432 | nmdc:mga09592_522363_c1 | 3300050508 | Bacteria | 1021 |
| 433 | nmdc:mga0qj67_42072_c1 | 3300050509 | Bacteria | 3596 |
| 434 | nmdc:mga06r32_311110_c1 | 3300050510 | Bacteria | 1561 |
| 435 | nmdc:mga06r32_672918_c1 | 3300050510 | Bacteria | 1002 |
| 436 | nmdc:mga08y16_16896_c1 | 3300050511 | Bacteria | 7684 |
| 437 | nmdc:mga08y16_17863_c1 | 3300050511 | Bacteria | 7472 |
| 438 | nmdc:mga0n895_18537_c1 | 3300050512 | Bacteria | 6444 |
| 439 | nmdc:mga0a205_321354_c1 | 3300050515 | Unclassified | 1419 |
| 440 | Ga0495601_0049162 | 3300053077 | Bacteria | 2658 |
| 441 | Ga0495601_0098779 | 3300053077 | Bacteria | 1884 |
| 442 | Ga0495595_0061985 | 3300053084 | Bacteria | 1753 |
| 443 | Ga0501084_0000144 | 3300054114 | Bacteria | 54020 |
| 444 | Ga0501084_0013228 | 3300054114 | Bacteria | 6828 |
| 445 | Ga0501084_0019269 | 3300054114 | Bacteria | 5682 |
| 446 | Ga0501084_0039678 | 3300054114 | Bacteria | 3937 |
| 447 | Ga0501084_0127428 | 3300054114 | Bacteria | 2142 |
| 448 | Ga0501084_0202722 | 3300054114 | Bacteria | 1674 |
| 449 | Ga0501084_0426765 | 3300054114 | Bacteria | 1121 |
| 450 | Ga0501082_0000730 | 3300060353 | Bacteria | 28954 |
| 451 | Ga0501082_0001289 | 3300060353 | Bacteria | 21965 |
| 452 | Ga0501082_0015705 | 3300060353 | Bacteria | 6513 |
| 453 | Ga0501082_0052277 | 3300060353 | Bacteria | 3521 |
| 454 | Ga0501082_0055411 | 3300060353 | Bacteria | 3416 |
| 455 | Ga0501082_0121746 | 3300060353 | Bacteria | 2261 |
| 456 | Ga0501082_0489429 | 3300060353 | Bacteria | 1075 |
| 457 | Ga0530510_0000612 | 3300061734 | Bacteria | 23017 |
| 458 | Ga0530510_0002207 | 3300061734 | Bacteria | 13362 |
| 459 | Ga0530510_0102748 | 3300061734 | Bacteria | 2090 |
| 460 | Ga0530510_0296545 | 3300061734 | Bacteria | 1209 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0291072 | Ga0495584_0291072_30_716 | 228 |
| 2 | 3300049576 | Ga0501040_0484686 | Ga0501040_0484686_31_723 | 228 |
| 3 | 3300054114 | Ga0501084_0426765 | Ga0501084_0426765_14_706 | 228 |
| 4 | 3300009098 | Ga0105245_10316992 | Ga0105245_103169922 | 229 |
| 5 | 3300049568 | Ga0501031_0015927 | Ga0501031_0015927_4006_4758 | 232 |
| 6 | 3300049569 | Ga0501032_0013463 | Ga0501032_0013463_673_1422 | 232 |
| 7 | 3300049569 | Ga0501032_0016637 | Ga0501032_0016637_4296_5048 | 232 |
| 8 | 3300049570 | Ga0501033_0001257 | Ga0501033_0001257_1717_2469 | 232 |
| 9 | 3300049572 | Ga0501036_0002733 | Ga0501036_0002733_13059_13811 | 232 |
| 10 | 3300049574 | Ga0501038_0015611 | Ga0501038_0015611_578_1330 | 232 |
| 11 | 3300049575 | Ga0501039_0006769 | Ga0501039_0006769_7546_8298 | 232 |
| 12 | 3300049576 | Ga0501040_0016289 | Ga0501040_0016289_2958_3707 | 232 |
| 13 | 3300049577 | Ga0501041_0003737 | Ga0501041_0003737_1712_2464 | 232 |
| 14 | 3300049578 | Ga0501042_0014994 | Ga0501042_0014994_131_883 | 232 |
| 15 | 3300049579 | Ga0501043_0004614 | Ga0501043_0004614_5622_6374 | 232 |
| 16 | 3300049580 | Ga0501046_0009300 | Ga0501046_0009300_3439_4191 | 232 |
| 17 | 3300049582 | Ga0501048_0008742 | Ga0501048_0008742_263_1015 | 232 |
| 18 | 3300049584 | Ga0501068_0007019 | Ga0501068_0007019_5352_6119 | 232 |
| 19 | 3300049585 | Ga0501069_0000320 | Ga0501069_0000320_20821_21573 | 232 |
| 20 | 3300049586 | Ga0501070_0004186 | Ga0501070_0004186_5574_6326 | 232 |
| 21 | 3300049587 | Ga0501071_0004198 | Ga0501071_0004198_7790_8542 | 232 |
| 22 | 3300049589 | Ga0501073_0018753 | Ga0501073_0018753_4226_4978 | 232 |
| 23 | 3300049590 | Ga0501074_0004727 | Ga0501074_0004727_1717_2469 | 232 |
| 24 | 3300049591 | Ga0501075_0030741 | Ga0501075_0030741_2650_3402 | 232 |
| 25 | 3300049592 | Ga0501076_0126808 | Ga0501076_0126808_1076_1828 | 232 |
| 26 | 3300049593 | Ga0501077_0025000 | Ga0501077_0025000_263_1015 | 232 |
| 27 | 3300049741 | Ga0501079_0197489 | Ga0501079_0197489_578_1330 | 232 |
| 28 | 3300049742 | Ga0501080_0044217 | Ga0501080_0044217_3154_3906 | 232 |
| 29 | 3300049743 | Ga0501081_0008909 | Ga0501081_0008909_5643_6395 | 232 |
| 30 | 3300049744 | Ga0501083_0001393 | Ga0501083_0001393_1688_2440 | 232 |
| 31 | 3300049823 | Ga0501044_0057962 | Ga0501044_0057962_258_1010 | 232 |
| 32 | 3300049824 | Ga0501045_0007804 | Ga0501045_0007804_6119_6871 | 232 |
| 33 | 3300054114 | Ga0501084_0019269 | Ga0501084_0019269_3214_3966 | 232 |
| 34 | 3300060353 | Ga0501082_0015705 | Ga0501082_0015705_2984_3736 | 232 |
| 35 | 3300014969 | Ga0157376_10153912 | Ga0157376_101539123 | 234 |
| 36 | 3300046463 | Ga0495653_0042394 | Ga0495653_0042394_1070_1828 | 236 |
| 37 | 3300046559 | Ga0495667_0082408 | Ga0495667_0082408_1190_1948 | 236 |
| 38 | 3300046663 | Ga0495635_0135861 | Ga0495635_0135861_346_1104 | 236 |
| 39 | 3300046680 | Ga0495646_0099408 | Ga0495646_0099408_846_1604 | 236 |
| 40 | 3300047319 | Ga0495674_0191341 | Ga0495674_0191341_439_1197 | 236 |
| 41 | 3300047471 | Ga0495684_0023816 | Ga0495684_0023816_3280_4038 | 236 |
| 42 | 3300053077 | Ga0495601_0098779 | Ga0495601_0098779_166_924 | 236 |
| 43 | 3300053084 | Ga0495595_0061985 | Ga0495595_0061985_118_876 | 236 |
| 44 | 3300038443 | Ga0395901_0400119 | Ga0395901_0400119_631_1380 | 238 |
| 45 | 3300049578 | Ga0501042_0033130 | Ga0501042_0033130_197_952 | 239 |
| 46 | 3300049741 | Ga0501079_0135589 | Ga0501079_0135589_1138_1893 | 239 |
| 47 | 3300049591 | Ga0501075_0106731 | Ga0501075_0106731_198_944 | 242 |
| 48 | 3300060353 | Ga0501082_0489429 | Ga0501082_0489429_117_863 | 242 |
| 49 | 3300005536 | Ga0070697_100270287 | Ga0070697_1002702872 | 243 |
| 50 | 3300006844 | Ga0075428_100083770 | Ga0075428_1000837704 | 244 |
| 51 | 3300037466 | Ga0395898_0064923 | Ga0395898_0064923_261_998 | 244 |
| 52 | 3300048913 | Ga0496110_0465020 | Ga0496110_0465020_268_1002 | 244 |
| 53 | 3300050508 | nmdc:mga09592_522363_c1 | nmdc:mga09592_522363_c1_15_749 | 244 |
| 54 | 3300006844 | Ga0075428_100268382 | Ga0075428_1002683822 | 247 |
| 55 | 3300006846 | Ga0075430_100237238 | Ga0075430_1002372382 | 247 |
| 56 | 3300006880 | Ga0075429_100016896 | Ga0075429_1000168962 | 247 |
| 57 | 3300009147 | Ga0114129_10010978 | Ga0114129_100109788 | 247 |
| 58 | 3300014325 | Ga0163163_10121714 | Ga0163163_101217143 | 247 |
| 59 | 3300025940 | Ga0207691_10305008 | Ga0207691_103050082 | 247 |
| 60 | 3300041512 | Ga0451853_0176963 | Ga0451853_0176963_718_1461 | 247 |
| 61 | 3300046615 | Ga0495656_0239385 | Ga0495656_0239385_50_793 | 247 |
| 62 | 3300048917 | Ga0496114_0361936 | Ga0496114_0361936_312_1055 | 247 |
| 63 | 3300049741 | Ga0501079_0276470 | Ga0501079_0276470_133_879 | 247 |
| 64 | 3300049743 | Ga0501081_0147943 | Ga0501081_0147943_128_877 | 247 |
| 65 | 3300050507 | nmdc:mga05p37_4680_c1 | nmdc:mga05p37_4680_c1_7602_8357 | 247 |
| 66 | 3300050508 | nmdc:mga09592_14491_c1 | nmdc:mga09592_14491_c1_2968_3723 | 247 |
| 67 | 3300050509 | nmdc:mga0qj67_42072_c1 | nmdc:mga0qj67_42072_c1_1852_2607 | 247 |
| 68 | 3300050510 | nmdc:mga06r32_311110_c1 | nmdc:mga06r32_311110_c1_749_1504 | 247 |
| 69 | 3300005435 | Ga0070714_100119901 | Ga0070714_1001199011 | 248 |
| 70 | 3300005458 | Ga0070681_10470834 | Ga0070681_104708342 | 248 |
| 71 | 3300009545 | Ga0105237_10114600 | Ga0105237_101146001 | 248 |
| 72 | 3300025912 | Ga0207707_10488020 | Ga0207707_104880202 | 248 |
| 73 | 3300025928 | Ga0207700_10046069 | Ga0207700_100460691 | 248 |
| 74 | 3300026088 | Ga0207641_10890209 | Ga0207641_108902092 | 248 |
| 75 | 3300046455 | Ga0495603_0009829 | Ga0495603_0009829_2363_3109 | 248 |
| 76 | 3300046461 | Ga0495641_0141132 | Ga0495641_0141132_295_1041 | 248 |
| 77 | 3300046531 | Ga0495665_0135366 | Ga0495665_0135366_469_1215 | 248 |
| 78 | 3300046559 | Ga0495667_0067798 | Ga0495667_0067798_1193_1939 | 248 |
| 79 | 3300046559 | Ga0495667_0280785 | Ga0495667_0280785_18_776 | 248 |
| 80 | 3300046642 | Ga0495634_0087165 | Ga0495634_0087165_1153_1899 | 248 |
| 81 | 3300046663 | Ga0495635_0066610 | Ga0495635_0066610_993_1739 | 248 |
| 82 | 3300046689 | Ga0495613_0282770 | Ga0495613_0282770_95_841 | 248 |
| 83 | 3300047315 | Ga0495581_0014097 | Ga0495581_0014097_3845_4591 | 248 |
| 84 | 3300047315 | Ga0495581_0017173 | Ga0495581_0017173_137_883 | 248 |
| 85 | 3300047321 | Ga0495676_0068930 | Ga0495676_0068930_137_883 | 248 |
| 86 | 3300047322 | Ga0495680_0017808 | Ga0495680_0017808_3460_4206 | 248 |
| 87 | 3300047471 | Ga0495684_0044458 | Ga0495684_0044458_714_1460 | 248 |
| 88 | 3300048089 | Ga0495614_0074549 | Ga0495614_0074549_601_1347 | 248 |
| 89 | 3300048907 | Ga0496104_0010424 | Ga0496104_0010424_2275_3033 | 248 |
| 90 | 3300048908 | Ga0496105_0060951 | Ga0496105_0060951_785_1543 | 248 |
| 91 | 3300005329 | Ga0070683_100067996 | Ga0070683_1000679964 | 249 |
| 92 | 3300005329 | Ga0070683_100096565 | Ga0070683_1000965654 | 249 |
| 93 | 3300005330 | Ga0070690_100109295 | Ga0070690_1001092951 | 249 |
| 94 | 3300005341 | Ga0070691_10012479 | Ga0070691_100124793 | 249 |
| 95 | 3300005341 | Ga0070691_10036046 | Ga0070691_100360462 | 249 |
| 96 | 3300005343 | Ga0070687_100062784 | Ga0070687_1000627842 | 249 |
| 97 | 3300005345 | Ga0070692_10011357 | Ga0070692_100113575 | 249 |
| 98 | 3300005347 | Ga0070668_100009363 | Ga0070668_1000093634 | 249 |
| 99 | 3300005356 | Ga0070674_100125068 | Ga0070674_1001250682 | 249 |
| 100 | 3300005356 | Ga0070674_100359806 | Ga0070674_1003598061 | 249 |
| 101 | 3300005366 | Ga0070659_100274265 | Ga0070659_1002742653 | 249 |
| 102 | 3300005406 | Ga0070703_10020086 | Ga0070703_100200862 | 249 |
| 103 | 3300005436 | Ga0070713_100115062 | Ga0070713_1001150622 | 249 |
| 104 | 3300005437 | Ga0070710_10013927 | Ga0070710_100139274 | 249 |
| 105 | 3300005438 | Ga0070701_10125896 | Ga0070701_101258962 | 249 |
| 106 | 3300005438 | Ga0070701_10222566 | Ga0070701_102225661 | 249 |
| 107 | 3300005440 | Ga0070705_100045000 | Ga0070705_1000450002 | 249 |
| 108 | 3300005441 | Ga0070700_100018858 | Ga0070700_1000188583 | 249 |
| 109 | 3300005441 | Ga0070700_100094422 | Ga0070700_1000944221 | 249 |
| 110 | 3300005459 | Ga0068867_100304142 | Ga0068867_1003041422 | 249 |
| 111 | 3300005459 | Ga0068867_100321084 | Ga0068867_1003210842 | 249 |
| 112 | 3300005466 | Ga0070685_10270933 | Ga0070685_102709332 | 249 |
| 113 | 3300005467 | Ga0070706_100153861 | Ga0070706_1001538613 | 249 |
| 114 | 3300005468 | Ga0070707_100093164 | Ga0070707_1000931644 | 249 |
| 115 | 3300005471 | Ga0070698_100004043 | Ga0070698_1000040432 | 249 |
| 116 | 3300005471 | Ga0070698_100006972 | Ga0070698_1000069726 | 249 |
| 117 | 3300005471 | Ga0070698_100033852 | Ga0070698_1000338523 | 249 |
| 118 | 3300005518 | Ga0070699_100014550 | Ga0070699_1000145504 | 249 |
| 119 | 3300005518 | Ga0070699_100139917 | Ga0070699_1001399172 | 249 |
| 120 | 3300005543 | Ga0070672_100279917 | Ga0070672_1002799173 | 249 |
| 121 | 3300005544 | Ga0070686_100132507 | Ga0070686_1001325072 | 249 |
| 122 | 3300005544 | Ga0070686_100135967 | Ga0070686_1001359672 | 249 |
| 123 | 3300005545 | Ga0070695_100084576 | Ga0070695_1000845762 | 249 |
| 124 | 3300005547 | Ga0070693_100025509 | Ga0070693_1000255093 | 249 |
| 125 | 3300005549 | Ga0070704_100058703 | Ga0070704_1000587034 | 249 |
| 126 | 3300005549 | Ga0070704_100177899 | Ga0070704_1001778992 | 249 |
| 127 | 3300005563 | Ga0068855_100142692 | Ga0068855_1001426923 | 249 |
| 128 | 3300005563 | Ga0068855_100361295 | Ga0068855_1003612952 | 249 |
| 129 | 3300005577 | Ga0068857_100116991 | Ga0068857_1001169912 | 249 |
| 130 | 3300005615 | Ga0070702_100006382 | Ga0070702_1000063822 | 249 |
| 131 | 3300005615 | Ga0070702_100049406 | Ga0070702_1000494062 | 249 |
| 132 | 3300005617 | Ga0068859_100364110 | Ga0068859_1003641102 | 249 |
| 133 | 3300005718 | Ga0068866_10272768 | Ga0068866_102727682 | 249 |
| 134 | 3300005718 | Ga0068866_10359357 | Ga0068866_103593572 | 249 |
| 135 | 3300005719 | Ga0068861_100228827 | Ga0068861_1002288272 | 249 |
| 136 | 3300005843 | Ga0068860_100296896 | Ga0068860_1002968962 | 249 |
| 137 | 3300005843 | Ga0068860_100393907 | Ga0068860_1003939072 | 249 |
| 138 | 3300005937 | Ga0081455_10017728 | Ga0081455_100177282 | 249 |
| 139 | 3300005937 | Ga0081455_10108018 | Ga0081455_101080181 | 249 |
| 140 | 3300005981 | Ga0081538_10000057 | Ga0081538_1000005710 | 249 |
| 141 | 3300005985 | Ga0081539_10000041 | Ga0081539_1000004151 | 249 |
| 142 | 3300005985 | Ga0081539_10020311 | Ga0081539_100203114 | 249 |
| 143 | 3300006038 | Ga0075365_10042218 | Ga0075365_100422182 | 249 |
| 144 | 3300006038 | Ga0075365_10171365 | Ga0075365_101713652 | 249 |
| 145 | 3300006175 | Ga0070712_100040160 | Ga0070712_1000401602 | 249 |
| 146 | 3300006844 | Ga0075428_100032779 | Ga0075428_1000327793 | 249 |
| 147 | 3300006844 | Ga0075428_101072793 | Ga0075428_1010727931 | 249 |
| 148 | 3300006847 | Ga0075431_100611717 | Ga0075431_1006117172 | 249 |
| 149 | 3300006871 | Ga0075434_100005176 | Ga0075434_10000517613 | 249 |
| 150 | 3300006931 | Ga0097620_100364127 | Ga0097620_1003641272 | 249 |
| 151 | 3300009093 | Ga0105240_10434144 | Ga0105240_104341442 | 249 |
| 152 | 3300009094 | Ga0111539_10004593 | Ga0111539_1000459312 | 249 |
| 153 | 3300009094 | Ga0111539_10007332 | Ga0111539_1000733210 | 249 |
| 154 | 3300009094 | Ga0111539_10017628 | Ga0111539_100176284 | 249 |
| 155 | 3300009094 | Ga0111539_10302749 | Ga0111539_103027491 | 249 |
| 156 | 3300009094 | Ga0111539_10940458 | Ga0111539_109404582 | 249 |
| 157 | 3300009094 | Ga0111539_11247330 | Ga0111539_112473301 | 249 |
| 158 | 3300009098 | Ga0105245_10059581 | Ga0105245_100595812 | 249 |
| 159 | 3300009098 | Ga0105245_10155361 | Ga0105245_101553612 | 249 |
| 160 | 3300009098 | Ga0105245_10230602 | Ga0105245_102306022 | 249 |
| 161 | 3300009098 | Ga0105245_10309239 | Ga0105245_103092392 | 249 |
| 162 | 3300009098 | Ga0105245_10376241 | Ga0105245_103762412 | 249 |
| 163 | 3300009147 | Ga0114129_10017065 | Ga0114129_100170656 | 249 |
| 164 | 3300009147 | Ga0114129_10180333 | Ga0114129_101803333 | 249 |
| 165 | 3300009147 | Ga0114129_11345026 | Ga0114129_113450261 | 249 |
| 166 | 3300009148 | Ga0105243_10135815 | Ga0105243_101358151 | 249 |
| 167 | 3300009148 | Ga0105243_10243663 | Ga0105243_102436632 | 249 |
| 168 | 3300009148 | Ga0105243_10674276 | Ga0105243_106742762 | 249 |
| 169 | 3300009176 | Ga0105242_10495810 | Ga0105242_104958102 | 249 |
| 170 | 3300009177 | Ga0105248_10024828 | Ga0105248_100248282 | 249 |
| 171 | 3300009551 | Ga0105238_10732183 | Ga0105238_107321832 | 249 |
| 172 | 3300009553 | Ga0105249_10010851 | Ga0105249_100108514 | 249 |
| 173 | 3300009553 | Ga0105249_10036826 | Ga0105249_100368263 | 249 |
| 174 | 3300009553 | Ga0105249_10099670 | Ga0105249_100996702 | 249 |
| 175 | 3300009553 | Ga0105249_10217612 | Ga0105249_102176123 | 249 |
| 176 | 3300009553 | Ga0105249_10331437 | Ga0105249_103314372 | 249 |
| 177 | 3300009553 | Ga0105249_10648983 | Ga0105249_106489832 | 249 |
| 178 | 3300010375 | Ga0105239_10038088 | Ga0105239_100380882 | 249 |
| 179 | 3300010375 | Ga0105239_10071415 | Ga0105239_100714152 | 249 |
| 180 | 3300011119 | Ga0105246_10038708 | Ga0105246_100387082 | 249 |
| 181 | 3300011119 | Ga0105246_10042765 | Ga0105246_100427652 | 249 |
| 182 | 3300011119 | Ga0105246_10137451 | Ga0105246_101374512 | 249 |
| 183 | 3300013102 | Ga0157371_10173040 | Ga0157371_101730402 | 249 |
| 184 | 3300013297 | Ga0157378_10096259 | Ga0157378_100962592 | 249 |
| 185 | 3300013306 | Ga0163162_10021629 | Ga0163162_100216295 | 249 |
| 186 | 3300013307 | Ga0157372_10506307 | Ga0157372_105063072 | 249 |
| 187 | 3300013308 | Ga0157375_10598480 | Ga0157375_105984802 | 249 |
| 188 | 3300014745 | Ga0157377_10004169 | Ga0157377_100041697 | 249 |
| 189 | 3300014968 | Ga0157379_10367281 | Ga0157379_103672812 | 249 |
| 190 | 3300014969 | Ga0157376_10001321 | Ga0157376_100013214 | 249 |
| 191 | 3300014969 | Ga0157376_10006667 | Ga0157376_100066673 | 249 |
| 192 | 3300017792 | Ga0163161_10333347 | Ga0163161_103333471 | 249 |
| 193 | 3300025901 | Ga0207688_10090435 | Ga0207688_100904352 | 249 |
| 194 | 3300025906 | Ga0207699_10063470 | Ga0207699_100634704 | 249 |
| 195 | 3300025907 | Ga0207645_10152386 | Ga0207645_101523862 | 249 |
| 196 | 3300025908 | Ga0207643_10047908 | Ga0207643_100479083 | 249 |
| 197 | 3300025915 | Ga0207693_10006295 | Ga0207693_100062958 | 249 |
| 198 | 3300025915 | Ga0207693_10009157 | Ga0207693_100091573 | 249 |
| 199 | 3300025918 | Ga0207662_10122143 | Ga0207662_101221432 | 249 |
| 200 | 3300025919 | Ga0207657_10058167 | Ga0207657_100581672 | 249 |
| 201 | 3300025921 | Ga0207652_10497717 | Ga0207652_104977172 | 249 |
| 202 | 3300025922 | Ga0207646_10022680 | Ga0207646_100226806 | 249 |
| 203 | 3300025926 | Ga0207659_10055915 | Ga0207659_100559153 | 249 |
| 204 | 3300025927 | Ga0207687_10043101 | Ga0207687_100431014 | 249 |
| 205 | 3300025927 | Ga0207687_10134510 | Ga0207687_101345103 | 249 |
| 206 | 3300025928 | Ga0207700_10229957 | Ga0207700_102299571 | 249 |
| 207 | 3300025932 | Ga0207690_10061569 | Ga0207690_100615692 | 249 |
| 208 | 3300025932 | Ga0207690_10398266 | Ga0207690_103982662 | 249 |
| 209 | 3300025933 | Ga0207706_10008758 | Ga0207706_100087582 | 249 |
| 210 | 3300025933 | Ga0207706_10042968 | Ga0207706_100429683 | 249 |
| 211 | 3300025933 | Ga0207706_10052165 | Ga0207706_100521653 | 249 |
| 212 | 3300025937 | Ga0207669_10073460 | Ga0207669_100734601 | 249 |
| 213 | 3300025938 | Ga0207704_10653708 | Ga0207704_106537081 | 249 |
| 214 | 3300025939 | Ga0207665_10144486 | Ga0207665_101444862 | 249 |
| 215 | 3300025944 | Ga0207661_10019751 | Ga0207661_100197513 | 249 |
| 216 | 3300025949 | Ga0207667_10413289 | Ga0207667_104132892 | 249 |
| 217 | 3300025961 | Ga0207712_10042305 | Ga0207712_100423054 | 249 |
| 218 | 3300025961 | Ga0207712_10220788 | Ga0207712_102207881 | 249 |
| 219 | 3300025972 | Ga0207668_10036930 | Ga0207668_100369302 | 249 |
| 220 | 3300025981 | Ga0207640_10130749 | Ga0207640_101307493 | 249 |
| 221 | 3300025981 | Ga0207640_10185645 | Ga0207640_101856452 | 249 |
| 222 | 3300026023 | Ga0207677_10149773 | Ga0207677_101497732 | 249 |
| 223 | 3300026023 | Ga0207677_10231675 | Ga0207677_102316752 | 249 |
| 224 | 3300026035 | Ga0207703_10131085 | Ga0207703_101310852 | 249 |
| 225 | 3300026041 | Ga0207639_10097922 | Ga0207639_100979222 | 249 |
| 226 | 3300026075 | Ga0207708_10009212 | Ga0207708_100092127 | 249 |
| 227 | 3300026075 | Ga0207708_10038461 | Ga0207708_100384613 | 249 |
| 228 | 3300026078 | Ga0207702_10023418 | Ga0207702_100234184 | 249 |
| 229 | 3300026089 | Ga0207648_10031354 | Ga0207648_100313541 | 249 |
| 230 | 3300026089 | Ga0207648_10041718 | Ga0207648_100417183 | 249 |
| 231 | 3300026089 | Ga0207648_10178107 | Ga0207648_101781072 | 249 |
| 232 | 3300026116 | Ga0207674_10006223 | Ga0207674_1000622315 | 249 |
| 233 | 3300026116 | Ga0207674_10026768 | Ga0207674_100267683 | 249 |
| 234 | 3300026118 | Ga0207675_100007556 | Ga0207675_10000755611 | 249 |
| 235 | 3300026118 | Ga0207675_100092754 | Ga0207675_1000927542 | 249 |
| 236 | 3300026121 | Ga0207683_10162696 | Ga0207683_101626963 | 249 |
| 237 | 3300027907 | Ga0207428_10009220 | Ga0207428_100092203 | 249 |
| 238 | 3300027907 | Ga0207428_10009605 | Ga0207428_100096055 | 249 |
| 239 | 3300028380 | Ga0268265_10051134 | Ga0268265_100511342 | 249 |
| 240 | 3300028381 | Ga0268264_10530423 | Ga0268264_105304232 | 249 |
| 241 | 3300031548 | Ga0307408_100025364 | Ga0307408_1000253643 | 249 |
| 242 | 3300031548 | Ga0307408_100298735 | Ga0307408_1002987352 | 249 |
| 243 | 3300031824 | Ga0307413_10003425 | Ga0307413_100034254 | 249 |
| 244 | 3300031852 | Ga0307410_10090673 | Ga0307410_100906732 | 249 |
| 245 | 3300031901 | Ga0307406_10030824 | Ga0307406_100308243 | 249 |
| 246 | 3300031901 | Ga0307406_10106086 | Ga0307406_101060862 | 249 |
| 247 | 3300031911 | Ga0307412_10097390 | Ga0307412_100973902 | 249 |
| 248 | 3300031995 | Ga0307409_100011218 | Ga0307409_1000112182 | 249 |
| 249 | 3300031995 | Ga0307409_100035980 | Ga0307409_1000359803 | 249 |
| 250 | 3300031995 | Ga0307409_100207906 | Ga0307409_1002079062 | 249 |
| 251 | 3300032002 | Ga0307416_100001425 | Ga0307416_1000014258 | 249 |
| 252 | 3300032002 | Ga0307416_100012791 | Ga0307416_1000127914 | 249 |
| 253 | 3300032002 | Ga0307416_100380294 | Ga0307416_1003802942 | 249 |
| 254 | 3300032002 | Ga0307416_101009881 | Ga0307416_1010098811 | 249 |
| 255 | 3300032004 | Ga0307414_10178078 | Ga0307414_101780782 | 249 |
| 256 | 3300032126 | Ga0307415_100000286 | Ga0307415_10000028610 | 249 |
| 257 | 3300032126 | Ga0307415_100014075 | Ga0307415_1000140753 | 249 |
| 258 | 3300035092 | Ga0373952_0029053 | Ga0373952_0029053_313_1062 | 249 |
| 259 | 3300037312 | Ga0395899_0003283 | Ga0395899_0003283_10087_10842 | 249 |
| 260 | 3300037312 | Ga0395899_0050094 | Ga0395899_0050094_1300_2052 | 249 |
| 261 | 3300037312 | Ga0395899_0066100 | Ga0395899_0066100_932_1687 | 249 |
| 262 | 3300037312 | Ga0395899_0077036 | Ga0395899_0077036_517_1272 | 249 |
| 263 | 3300037418 | Ga0395900_0005323 | Ga0395900_0005323_9281_10036 | 249 |
| 264 | 3300037418 | Ga0395900_0016923 | Ga0395900_0016923_4945_5700 | 249 |
| 265 | 3300037418 | Ga0395900_0039832 | Ga0395900_0039832_1064_1816 | 249 |
| 266 | 3300037418 | Ga0395900_0044318 | Ga0395900_0044318_354_1103 | 249 |
| 267 | 3300037418 | Ga0395900_0066125 | Ga0395900_0066125_2338_3090 | 249 |
| 268 | 3300037418 | Ga0395900_0568422 | Ga0395900_0568422_267_1016 | 249 |
| 269 | 3300037466 | Ga0395898_0002616 | Ga0395898_0002616_9917_10669 | 249 |
| 270 | 3300037466 | Ga0395898_0005906 | Ga0395898_0005906_12283_13032 | 249 |
| 271 | 3300037466 | Ga0395898_0007257 | Ga0395898_0007257_5677_6432 | 249 |
| 272 | 3300037466 | Ga0395898_0025937 | Ga0395898_0025937_3892_4647 | 249 |
| 273 | 3300037466 | Ga0395898_0083514 | Ga0395898_0083514_820_1575 | 249 |
| 274 | 3300037466 | Ga0395898_0533117 | Ga0395898_0533117_203_952 | 249 |
| 275 | 3300037471 | Ga0395905_0007137 | Ga0395905_0007137_1398_2153 | 249 |
| 276 | 3300037471 | Ga0395905_0014937 | Ga0395905_0014937_5653_6408 | 249 |
| 277 | 3300037471 | Ga0395905_0018631 | Ga0395905_0018631_898_1647 | 249 |
| 278 | 3300037471 | Ga0395905_0147780 | Ga0395905_0147780_777_1529 | 249 |
| 279 | 3300038443 | Ga0395901_0001394 | Ga0395901_0001394_10362_11111 | 249 |
| 280 | 3300038443 | Ga0395901_0002239 | Ga0395901_0002239_5273_6028 | 249 |
| 281 | 3300038443 | Ga0395901_0014181 | Ga0395901_0014181_2953_3705 | 249 |
| 282 | 3300038443 | Ga0395901_0024380 | Ga0395901_0024380_3794_4549 | 249 |
| 283 | 3300038443 | Ga0395901_0150080 | Ga0395901_0150080_695_1450 | 249 |
| 284 | 3300041496 | Ga0451839_0176762 | Ga0451839_0176762_379_1140 | 249 |
| 285 | 3300041512 | Ga0451853_0445709 | Ga0451853_0445709_4721_5470 | 249 |
| 286 | 3300042005 | Ga0439448_0004097 | Ga0439448_0004097_1619_2371 | 249 |
| 287 | 3300042122 | Ga0450920_015127 | Ga0450920_015127_208_957 | 249 |
| 288 | 3300042157 | Ga0439458_0009648 | Ga0439458_0009648_771_1523 | 249 |
| 289 | 3300044694 | Ga0466963_0441874 | Ga0466963_0441874_29_790 | 249 |
| 290 | 3300044706 | Ga0466964_0001299 | Ga0466964_0001299_2231_2992 | 249 |
| 291 | 3300044706 | Ga0466964_0136606 | Ga0466964_0136606_319_1068 | 249 |
| 292 | 3300045051 | Ga0451576_0009834 | Ga0451576_0009834_79_831 | 249 |
| 293 | 3300046474 | Ga0495605_0026177 | Ga0495605_0026177_1531_2280 | 249 |
| 294 | 3300046491 | Ga0495584_0096775 | Ga0495584_0096775_286_1038 | 249 |
| 295 | 3300046491 | Ga0495584_0230953 | Ga0495584_0230953_119_868 | 249 |
| 296 | 3300046492 | Ga0495585_0064516 | Ga0495585_0064516_1241_1990 | 249 |
| 297 | 3300046499 | Ga0495594_0293189 | Ga0495594_0293189_118_870 | 249 |
| 298 | 3300046514 | Ga0495618_0068013 | Ga0495618_0068013_319_1077 | 249 |
| 299 | 3300046515 | Ga0495620_0072700 | Ga0495620_0072700_36_788 | 249 |
| 300 | 3300046515 | Ga0495620_0127157 | Ga0495620_0127157_50_799 | 249 |
| 301 | 3300046517 | Ga0495630_0084869 | Ga0495630_0084869_646_1404 | 249 |
| 302 | 3300046542 | Ga0495597_0136554 | Ga0495597_0136554_247_996 | 249 |
| 303 | 3300046615 | Ga0495656_0062599 | Ga0495656_0062599_850_1599 | 249 |
| 304 | 3300046664 | Ga0495659_0002767 | Ga0495659_0002767_1410_2159 | 249 |
| 305 | 3300046691 | Ga0495670_0068348 | Ga0495670_0068348_846_1595 | 249 |
| 306 | 3300047319 | Ga0495674_0037621 | Ga0495674_0037621_2100_2858 | 249 |
| 307 | 3300047471 | Ga0495684_0029206 | Ga0495684_0029206_774_1532 | 249 |
| 308 | 3300048091 | Ga0495626_0028167 | Ga0495626_0028167_1384_2133 | 249 |
| 309 | 3300048904 | Ga0496101_0186795 | Ga0496101_0186795_177_929 | 249 |
| 310 | 3300048905 | Ga0496102_0073132 | Ga0496102_0073132_1293_2045 | 249 |
| 311 | 3300048906 | Ga0496103_0052054 | Ga0496103_0052054_1348_2097 | 249 |
| 312 | 3300048907 | Ga0496104_0000772 | Ga0496104_0000772_24255_25007 | 249 |
| 313 | 3300048907 | Ga0496104_0053971 | Ga0496104_0053971_1382_2131 | 249 |
| 314 | 3300048908 | Ga0496105_0000542 | Ga0496105_0000542_22618_23370 | 249 |
| 315 | 3300048909 | Ga0496106_0052710 | Ga0496106_0052710_361_1113 | 249 |
| 316 | 3300048909 | Ga0496106_0209375 | Ga0496106_0209375_331_1083 | 249 |
| 317 | 3300048911 | Ga0496108_0002080 | Ga0496108_0002080_10660_11412 | 249 |
| 318 | 3300048911 | Ga0496108_0004739 | Ga0496108_0004739_3609_4358 | 249 |
| 319 | 3300048912 | Ga0496109_0001642 | Ga0496109_0001642_14355_15107 | 249 |
| 320 | 3300048912 | Ga0496109_0013491 | Ga0496109_0013491_456_1205 | 249 |
| 321 | 3300048912 | Ga0496109_0087585 | Ga0496109_0087585_283_1035 | 249 |
| 322 | 3300048913 | Ga0496110_0000787 | Ga0496110_0000787_8296_9048 | 249 |
| 323 | 3300048913 | Ga0496110_0002026 | Ga0496110_0002026_10970_11719 | 249 |
| 324 | 3300048913 | Ga0496110_0008121 | Ga0496110_0008121_772_1524 | 249 |
| 325 | 3300048913 | Ga0496110_0012389 | Ga0496110_0012389_887_1639 | 249 |
| 326 | 3300048914 | Ga0496111_0000234 | Ga0496111_0000234_6976_7725 | 249 |
| 327 | 3300048914 | Ga0496111_0001318 | Ga0496111_0001318_10632_11384 | 249 |
| 328 | 3300048915 | Ga0496112_0034001 | Ga0496112_0034001_2918_3670 | 249 |
| 329 | 3300048915 | Ga0496112_0585730 | Ga0496112_0585730_147_899 | 249 |
| 330 | 3300048916 | Ga0496113_0021005 | Ga0496113_0021005_2946_3698 | 249 |
| 331 | 3300048916 | Ga0496113_0215746 | Ga0496113_0215746_467_1219 | 249 |
| 332 | 3300048916 | Ga0496113_0293846 | Ga0496113_0293846_115_924 | 249 |
| 333 | 3300048918 | Ga0496115_0007169 | Ga0496115_0007169_1350_2102 | 249 |
| 334 | 3300049568 | Ga0501031_0000640 | Ga0501031_0000640_17229_17990 | 249 |
| 335 | 3300049568 | Ga0501031_0000679 | Ga0501031_0000679_15867_16619 | 249 |
| 336 | 3300049568 | Ga0501031_0004457 | Ga0501031_0004457_8160_8909 | 249 |
| 337 | 3300049569 | Ga0501032_0006634 | Ga0501032_0006634_5145_5906 | 249 |
| 338 | 3300049569 | Ga0501032_0051185 | Ga0501032_0051185_584_1336 | 249 |
| 339 | 3300049570 | Ga0501033_0004461 | Ga0501033_0004461_7855_8616 | 249 |
| 340 | 3300049570 | Ga0501033_0007690 | Ga0501033_0007690_828_1577 | 249 |
| 341 | 3300049570 | Ga0501033_0084620 | Ga0501033_0084620_706_1458 | 249 |
| 342 | 3300049571 | Ga0501034_0046112 | Ga0501034_0046112_250_1011 | 249 |
| 343 | 3300049572 | Ga0501036_0000260 | Ga0501036_0000260_2521_3282 | 249 |
| 344 | 3300049572 | Ga0501036_0000438 | Ga0501036_0000438_10823_11575 | 249 |
| 345 | 3300049572 | Ga0501036_0325210 | Ga0501036_0325210_323_1075 | 249 |
| 346 | 3300049573 | Ga0501037_0000275 | Ga0501037_0000275_36382_37143 | 249 |
| 347 | 3300049573 | Ga0501037_0120338 | Ga0501037_0120338_198_950 | 249 |
| 348 | 3300049573 | Ga0501037_0283196 | Ga0501037_0283196_205_954 | 249 |
| 349 | 3300049574 | Ga0501038_0000230 | Ga0501038_0000230_32604_33365 | 249 |
| 350 | 3300049574 | Ga0501038_0001135 | Ga0501038_0001135_7159_7908 | 249 |
| 351 | 3300049574 | Ga0501038_0008509 | Ga0501038_0008509_8430_9182 | 249 |
| 352 | 3300049575 | Ga0501039_0000406 | Ga0501039_0000406_21411_22172 | 249 |
| 353 | 3300049575 | Ga0501039_0180404 | Ga0501039_0180404_48_800 | 249 |
| 354 | 3300049575 | Ga0501039_0468547 | Ga0501039_0468547_121_873 | 249 |
| 355 | 3300049576 | Ga0501040_0000592 | Ga0501040_0000592_11441_12193 | 249 |
| 356 | 3300049576 | Ga0501040_0008421 | Ga0501040_0008421_2386_3147 | 249 |
| 357 | 3300049576 | Ga0501040_0359390 | Ga0501040_0359390_256_1017 | 249 |
| 358 | 3300049576 | Ga0501040_0382239 | Ga0501040_0382239_229_984 | 249 |
| 359 | 3300049577 | Ga0501041_0000272 | Ga0501041_0000272_17559_18311 | 249 |
| 360 | 3300049577 | Ga0501041_0000911 | Ga0501041_0000911_6432_7193 | 249 |
| 361 | 3300049577 | Ga0501041_0037419 | Ga0501041_0037419_1996_2757 | 249 |
| 362 | 3300049578 | Ga0501042_0000997 | Ga0501042_0000997_6203_6955 | 249 |
| 363 | 3300049578 | Ga0501042_0003497 | Ga0501042_0003497_8031_8780 | 249 |
| 364 | 3300049578 | Ga0501042_0014020 | Ga0501042_0014020_2425_3186 | 249 |
| 365 | 3300049579 | Ga0501043_0003228 | Ga0501043_0003228_9955_10716 | 249 |
| 366 | 3300049579 | Ga0501043_0204607 | Ga0501043_0204607_517_1269 | 249 |
| 367 | 3300049580 | Ga0501046_0001734 | Ga0501046_0001734_639_1388 | 249 |
| 368 | 3300049580 | Ga0501046_0004112 | Ga0501046_0004112_10113_10874 | 249 |
| 369 | 3300049580 | Ga0501046_0011277 | Ga0501046_0011277_1214_1966 | 249 |
| 370 | 3300049580 | Ga0501046_0056539 | Ga0501046_0056539_2229_2984 | 249 |
| 371 | 3300049580 | Ga0501046_0073540 | Ga0501046_0073540_1094_1855 | 249 |
| 372 | 3300049580 | Ga0501046_0353005 | Ga0501046_0353005_291_1040 | 249 |
| 373 | 3300049581 | Ga0501047_0026326 | Ga0501047_0026326_2227_2988 | 249 |
| 374 | 3300049582 | Ga0501048_0001139 | Ga0501048_0001139_14350_15102 | 249 |
| 375 | 3300049582 | Ga0501048_0001500 | Ga0501048_0001500_14525_15286 | 249 |
| 376 | 3300049582 | Ga0501048_0028556 | Ga0501048_0028556_1419_2168 | 249 |
| 377 | 3300049582 | Ga0501048_0318873 | Ga0501048_0318873_322_1077 | 249 |
| 378 | 3300049583 | Ga0501067_0000516 | Ga0501067_0000516_1450_2199 | 249 |
| 379 | 3300049583 | Ga0501067_0026821 | Ga0501067_0026821_1072_1824 | 249 |
| 380 | 3300049584 | Ga0501068_0000011 | Ga0501068_0000011_39043_39804 | 249 |
| 381 | 3300049585 | Ga0501069_0000482 | Ga0501069_0000482_845_1594 | 249 |
| 382 | 3300049585 | Ga0501069_0002134 | Ga0501069_0002134_2616_3368 | 249 |
| 383 | 3300049585 | Ga0501069_0004504 | Ga0501069_0004504_2386_3147 | 249 |
| 384 | 3300049585 | Ga0501069_0005912 | Ga0501069_0005912_1820_2569 | 249 |
| 385 | 3300049585 | Ga0501069_0075950 | Ga0501069_0075950_634_1383 | 249 |
| 386 | 3300049586 | Ga0501070_0003288 | Ga0501070_0003288_4857_5606 | 249 |
| 387 | 3300049586 | Ga0501070_0010643 | Ga0501070_0010643_2722_3483 | 249 |
| 388 | 3300049586 | Ga0501070_0012724 | Ga0501070_0012724_2886_3638 | 249 |
| 389 | 3300049587 | Ga0501071_0006394 | Ga0501071_0006394_6813_7565 | 249 |
| 390 | 3300049587 | Ga0501071_0007457 | Ga0501071_0007457_3682_4443 | 249 |
| 391 | 3300049587 | Ga0501071_0060487 | Ga0501071_0060487_1598_2359 | 249 |
| 392 | 3300049587 | Ga0501071_0136118 | Ga0501071_0136118_381_1130 | 249 |
| 393 | 3300049588 | Ga0501072_0000354 | Ga0501072_0000354_9101_9853 | 249 |
| 394 | 3300049588 | Ga0501072_0002880 | Ga0501072_0002880_2386_3147 | 249 |
| 395 | 3300049588 | Ga0501072_0006422 | Ga0501072_0006422_375_1124 | 249 |
| 396 | 3300049589 | Ga0501073_0032970 | Ga0501073_0032970_2074_2835 | 249 |
| 397 | 3300049589 | Ga0501073_0051970 | Ga0501073_0051970_1149_1901 | 249 |
| 398 | 3300049590 | Ga0501074_0000438 | Ga0501074_0000438_20413_21174 | 249 |
| 399 | 3300049590 | Ga0501074_0046401 | Ga0501074_0046401_2165_2926 | 249 |
| 400 | 3300049590 | Ga0501074_0080284 | Ga0501074_0080284_1154_1903 | 249 |
| 401 | 3300049591 | Ga0501075_0000040 | Ga0501075_0000040_5807_6568 | 249 |
| 402 | 3300049591 | Ga0501075_0028861 | Ga0501075_0028861_1249_2010 | 249 |
| 403 | 3300049592 | Ga0501076_0000089 | Ga0501076_0000089_26138_26899 | 249 |
| 404 | 3300049592 | Ga0501076_0008506 | Ga0501076_0008506_6498_7250 | 249 |
| 405 | 3300049592 | Ga0501076_0041762 | Ga0501076_0041762_1264_2025 | 249 |
| 406 | 3300049592 | Ga0501076_0218325 | Ga0501076_0218325_636_1385 | 249 |
| 407 | 3300049592 | Ga0501076_0317113 | Ga0501076_0317113_250_1002 | 249 |
| 408 | 3300049593 | Ga0501077_0000172 | Ga0501077_0000172_15958_16719 | 249 |
| 409 | 3300049593 | Ga0501077_0005913 | Ga0501077_0005913_687_1439 | 249 |
| 410 | 3300049593 | Ga0501077_0020179 | Ga0501077_0020179_639_1388 | 249 |
| 411 | 3300049593 | Ga0501077_0064592 | Ga0501077_0064592_249_1010 | 249 |
| 412 | 3300049593 | Ga0501077_0156551 | Ga0501077_0156551_10_765 | 249 |
| 413 | 3300049741 | Ga0501079_0002976 | Ga0501079_0002976_4543_5304 | 249 |
| 414 | 3300049741 | Ga0501079_0004229 | Ga0501079_0004229_4702_5454 | 249 |
| 415 | 3300049741 | Ga0501079_0092544 | Ga0501079_0092544_197_958 | 249 |
| 416 | 3300049742 | Ga0501080_0000142 | Ga0501080_0000142_35460_36221 | 249 |
| 417 | 3300049742 | Ga0501080_0018136 | Ga0501080_0018136_4923_5675 | 249 |
| 418 | 3300049742 | Ga0501080_0055738 | Ga0501080_0055738_1664_2413 | 249 |
| 419 | 3300049743 | Ga0501081_0006516 | Ga0501081_0006516_4543_5304 | 249 |
| 420 | 3300049743 | Ga0501081_0010258 | Ga0501081_0010258_3576_4328 | 249 |
| 421 | 3300049743 | Ga0501081_0014393 | Ga0501081_0014393_3461_4216 | 249 |
| 422 | 3300049743 | Ga0501081_0030509 | Ga0501081_0030509_506_1267 | 249 |
| 423 | 3300049743 | Ga0501081_0322341 | Ga0501081_0322341_42_791 | 249 |
| 424 | 3300049744 | Ga0501083_0001626 | Ga0501083_0001626_8820_9581 | 249 |
| 425 | 3300049744 | Ga0501083_0070369 | Ga0501083_0070369_555_1307 | 249 |
| 426 | 3300049744 | Ga0501083_0188900 | Ga0501083_0188900_422_1171 | 249 |
| 427 | 3300049744 | Ga0501083_0203833 | Ga0501083_0203833_178_933 | 249 |
| 428 | 3300049822 | Ga0501035_0005187 | Ga0501035_0005187_9179_9940 | 249 |
| 429 | 3300049822 | Ga0501035_0008094 | Ga0501035_0008094_1554_2303 | 249 |
| 430 | 3300049822 | Ga0501035_0144670 | Ga0501035_0144670_766_1518 | 249 |
| 431 | 3300049823 | Ga0501044_0019579 | Ga0501044_0019579_3916_4677 | 249 |
| 432 | 3300049823 | Ga0501044_0070013 | Ga0501044_0070013_1049_1798 | 249 |
| 433 | 3300049824 | Ga0501045_0000357 | Ga0501045_0000357_11593_12345 | 249 |
| 434 | 3300049824 | Ga0501045_0008579 | Ga0501045_0008579_3620_4381 | 249 |
| 435 | 3300049824 | Ga0501045_0021415 | Ga0501045_0021415_1483_2244 | 249 |
| 436 | 3300049824 | Ga0501045_0602341 | Ga0501045_0602341_10_771 | 249 |
| 437 | 3300050492 | nmdc:mga0yw44_53407_c1 | nmdc:mga0yw44_53407_c1_86_838 | 249 |
| 438 | 3300050507 | nmdc:mga05p37_498140_c1 | nmdc:mga05p37_498140_c1_248_1003 | 249 |
| 439 | 3300050507 | nmdc:mga05p37_831558_c1 | nmdc:mga05p37_831558_c1_124_873 | 249 |
| 440 | 3300050508 | nmdc:mga09592_394182_c1 | nmdc:mga09592_394182_c1_206_964 | 249 |
| 441 | 3300050510 | nmdc:mga06r32_672918_c1 | nmdc:mga06r32_672918_c1_24_782 | 249 |
| 442 | 3300050511 | nmdc:mga08y16_16896_c1 | nmdc:mga08y16_16896_c1_6516_7265 | 249 |
| 443 | 3300050511 | nmdc:mga08y16_17863_c1 | nmdc:mga08y16_17863_c1_3774_4523 | 249 |
| 444 | 3300050512 | nmdc:mga0n895_18537_c1 | nmdc:mga0n895_18537_c1_4771_5523 | 249 |
| 445 | 3300050515 | nmdc:mga0a205_321354_c1 | nmdc:mga0a205_321354_c1_377_1129 | 249 |
| 446 | 3300053077 | Ga0495601_0049162 | Ga0495601_0049162_824_1582 | 249 |
| 447 | 3300054114 | Ga0501084_0000144 | Ga0501084_0000144_42338_43090 | 249 |
| 448 | 3300054114 | Ga0501084_0013228 | Ga0501084_0013228_2386_3147 | 249 |
| 449 | 3300054114 | Ga0501084_0039678 | Ga0501084_0039678_1312_2073 | 249 |
| 450 | 3300054114 | Ga0501084_0127428 | Ga0501084_0127428_235_984 | 249 |
| 451 | 3300054114 | Ga0501084_0202722 | Ga0501084_0202722_235_987 | 249 |
| 452 | 3300060353 | Ga0501082_0000730 | Ga0501082_0000730_14042_14803 | 249 |
| 453 | 3300060353 | Ga0501082_0001289 | Ga0501082_0001289_17550_18302 | 249 |
| 454 | 3300060353 | Ga0501082_0052277 | Ga0501082_0052277_1463_2224 | 249 |
| 455 | 3300060353 | Ga0501082_0055411 | Ga0501082_0055411_2447_3202 | 249 |
| 456 | 3300060353 | Ga0501082_0121746 | Ga0501082_0121746_302_1051 | 249 |
| 457 | 3300061734 | Ga0530510_0000612 | Ga0530510_0000612_12144_12905 | 249 |
| 458 | 3300061734 | Ga0530510_0002207 | Ga0530510_0002207_1689_2441 | 249 |
| 459 | 3300061734 | Ga0530510_0102748 | Ga0530510_0102748_257_1006 | 249 |
| 460 | 3300061734 | Ga0530510_0296545 | Ga0530510_0296545_259_1020 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5n9m-assembly2.cif.gz_B | crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation | 0.9267 | 2 | 242 |
| 6fqb-assembly4.cif.gz_H | murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 | 0.9151 | 2 | 235 |
| 5n9m-assembly2.cif.gz_B | crystal structure of gatd - a glutamine amidotransferase from staphylococcus aureus involved in peptidoglycan amidation | 0.9046 | 2 | 242 |
| 6fqb-assembly4.cif.gz_H | murt/gatd peptidoglycan amidotransferase complex from streptococcus pneumoniae r6 | 0.8514 | 2 | 235 |
| 5f9y-assembly3.cif.gz_B | crystal structure of prolyl-trna synthetase from cryptosporidium parvum complexed with l-proline and amp | 0.7601 | 1 | 39 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FX00_16_208_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9478 | 15 | 212 | 3.40.50.880 |
| af_Q2FX00_16_208_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9384 | 15 | 212 | 3.40.50.880 |
| af_I6XI14_15_209_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9291 | 16 | 212 | 3.40.50.880 |
| af_I6XI14_15_209_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9201 | 16 | 212 | 3.40.50.880 |
| af_Q54VK0_115_197_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.8579 | 2 | 42 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538G3M5-F1-model_v4 | Glutamine amidotransferase | 0.9953 | 2 | 182 |
GO:0006541
GO:0016740 |
| AF-A0A838FFP9-F1-model_v4 | Glutamine amidotransferase | 0.9837 | 1 | 95 |
GO:0016740
|
| AF-A0A7W0SYC4-F1-model_v4 | Glutamine amidotransferase | 0.9825 | 86 | 249 |
GO:0006541
GO:0016740 |
| AF-A0A7W1IKL4-F1-model_v4 | Glutamine amidotransferase | 0.9817 | 2 | 194 |
GO:0004359
GO:0006541 GO:0009236 GO:0016740 GO:0071555 |
| AF-A0A2E7MPV6-F1-model_v4 | Lipid II isoglutaminyl synthase (glutamine-hydrolyzing) subunit GatD (EC 6.3.5.13) (Lipid II isoglutaminyl synthase glutaminase subunit) (EC 3.5.1.2) | 0.9776 | 1 | 243 |
GO:0004359
GO:0006541 GO:0008360 GO:0009236 GO:0009252 GO:0016740 GO:0071555 GO:0140282 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar