F448633

General Info

Members Datasets Scaffolds Average Seq Length
460 230 451 176

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0000541|Ga0500644_0000541_2943_3584
Length 213
Sequence MTSPDHDDAPSGEPQAGWVRRRIVHHGSIIAVPGYCRDMSLDRPVTPDPYDLLPGVPSFSVTSADVTDGQPLKDDQVNEFGDSSPQLSWSGFPDDTKSFTVTCFDPDAPTPSGFWHWVLVDLPPDVISLDAGAGAEGASLPGSAFMCRNDGGTKAFMGAAPPPGDQVHRYYFVVHAVKEESLGVDSDASAAVVSFNLAFKTAGRAIIHGTYQH

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221617 Nocardioides sp. Root79 Isolate Unclassified
3 2643221620 Nocardioides sp. Root240 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
6 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
7 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
8 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
9 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 1.74
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.96
Nodule 0
Rhizoplane 7.83
Rhizosphere 71.96
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10043520 3300001989 Bacteria 1484
2 JGI24738J21930_10001460 3300002075 Bacteria 6571
3 JGI24744J21845_10001693 3300002077 Bacteria 4418
4 Ga0007423J48922_100915 3300003285 Bacteria 855
5 Ga0070658_10047179 3300005327 Bacteria 3486
6 Ga0070658_10219311 3300005327 Bacteria 1608
7 Ga0070683_100357252 3300005329 Bacteria 1391
8 Ga0070683_101547594 3300005329 Bacteria 637
9 Ga0070682_100003020 3300005337 Bacteria 9340
10 Ga0068868_100311855 3300005338 Bacteria 1338
11 Ga0070660_100071607 3300005339 Bacteria 2707
12 Ga0070660_100247860 3300005339 Bacteria 1452
13 Ga0070660_100477275 3300005339 Bacteria 1036
14 Ga0070691_10012583 3300005341 Bacteria 3875
15 Ga0070687_100164758 3300005343 Bacteria 1314
16 Ga0070668_100097615 3300005347 Bacteria 2324
17 Ga0070675_100741920 3300005354 Bacteria 896
18 Ga0070674_100011843 3300005356 Bacteria 5328
19 Ga0070673_100330976 3300005364 Bacteria 1348
20 Ga0070659_100027811 3300005366 Bacteria 4360
21 Ga0070667_100038231 3300005367 Bacteria 4024
22 Ga0070701_10001815 3300005438 Bacteria 8065
23 Ga0070700_100004347 3300005441 Bacteria 7395
24 Ga0068867_100012645 3300005459 Bacteria 5968
25 Ga0070698_101384412 3300005471 Bacteria 654
26 Ga0070684_100125366 3300005535 Bacteria 2313
27 Ga0070684_100176629 3300005535 Bacteria 1941
28 Ga0070684_100631329 3300005535 Bacteria 997
29 Ga0068853_100365598 3300005539 Bacteria 1345
30 Ga0070672_100014089 3300005543 Bacteria 5658
31 Ga0070693_100062482 3300005547 Bacteria 2167
32 Ga0070693_100820828 3300005547 Bacteria 691
33 Ga0068855_100068555 3300005563 Bacteria 4130
34 Ga0068854_100040507 3300005578 Bacteria 3287
35 Ga0068854_100593710 3300005578 Bacteria 944
36 Ga0068856_100319106 3300005614 Bacteria 1571
37 Ga0070702_100024064 3300005615 Bacteria 3244
38 Ga0068852_100005131 3300005616 Bacteria 9332
39 Ga0068864_101328562 3300005618 Bacteria 720
40 Ga0068864_101407560 3300005618 Bacteria 699
41 Ga0068866_10009684 3300005718 Bacteria 4101
42 Ga0068861_100009670 3300005719 Bacteria 6661
43 Ga0068870_10051246 3300005840 Bacteria 2185
44 Ga0068858_100471628 3300005842 Bacteria 1211
45 Ga0068860_100000400 3300005843 Bacteria 56882
46 Ga0068862_100066686 3300005844 Bacteria 3102
47 Ga0081539_10072067 3300005985 Bacteria 1848
48 Ga0075365_10006599 3300006038 Bacteria 6403
49 Ga0075365_10015400 3300006038 Bacteria 4626
50 Ga0075365_10027377 3300006038 Bacteria 3627
51 Ga0075365_10030018 3300006038 Bacteria 3479
52 Ga0075365_10032502 3300006038 Bacteria 3355
53 Ga0075365_10034298 3300006038 Bacteria 3277
54 Ga0075365_10034602 3300006038 Bacteria 3263
55 Ga0075365_10040042 3300006038 Bacteria 3054
56 Ga0075365_10040643 3300006038 Bacteria 3033
57 Ga0075365_10066922 3300006038 Bacteria 2411
58 Ga0075365_10069587 3300006038 Bacteria 2365
59 Ga0075365_10080075 3300006038 Bacteria 2211
60 Ga0075365_10110897 3300006038 Bacteria 1885
61 Ga0075365_10186710 3300006038 Bacteria 1450
62 Ga0075365_10258731 3300006038 Bacteria 1223
63 Ga0075365_10273718 3300006038 Bacteria 1188
64 Ga0075365_10580456 3300006038 Bacteria 793
65 Ga0075365_10737447 3300006038 Bacteria 696
66 Ga0075365_10808706 3300006038 Bacteria 661
67 Ga0075368_10008393 3300006042 Bacteria 3677
68 Ga0075368_10202096 3300006042 Bacteria 841
69 Ga0075368_10245597 3300006042 Bacteria 764
70 Ga0075363_100006491 3300006048 Bacteria 5318
71 Ga0075363_100054187 3300006048 Bacteria 2145
72 Ga0075363_100080335 3300006048 Bacteria 1783
73 Ga0075363_100145970 3300006048 Bacteria 1334
74 Ga0075364_10013210 3300006051 Bacteria 5070
75 Ga0075364_10016186 3300006051 Bacteria 4637
76 Ga0075364_10082561 3300006051 Bacteria 2126
77 Ga0075364_10216932 3300006051 Bacteria 1298
78 Ga0075364_10248558 3300006051 Bacteria 1209
79 Ga0075364_10363448 3300006051 Bacteria 987
80 Ga0075364_10554161 3300006051 Bacteria 786
81 Ga0075432_10237595 3300006058 Bacteria 735
82 Ga0075362_10092072 3300006177 Bacteria 1408
83 Ga0075367_10007120 3300006178 Bacteria 5705
84 Ga0075367_10043165 3300006178 Bacteria 2641
85 Ga0075369_10005356 3300006186 Bacteria 4786
86 Ga0075370_10000475 3300006353 Bacteria 15085
87 Ga0075370_10000774 3300006353 Bacteria 12812
88 Ga0075370_10067911 3300006353 Bacteria 2035
89 Ga0068871_101265831 3300006358 Bacteria 693
90 Ga0075428_100014361 3300006844 Bacteria 8804
91 Ga0075428_100678888 3300006844 Bacteria 1098
92 Ga0075430_100011496 3300006846 Bacteria 7521
93 Ga0075429_100029240 3300006880 Bacteria 4786
94 Ga0068865_100004316 3300006881 Bacteria 8582
95 Ga0075436_100605975 3300006914 Bacteria 807
96 Ga0111539_10357173 3300009094 Bacteria 1700
97 Ga0111539_10383429 3300009094 Bacteria 1637
98 Ga0111539_10882875 3300009094 Bacteria 1040
99 Ga0111539_10901690 3300009094 Bacteria 1028
100 Ga0105245_10043991 3300009098 Bacteria 3984
101 Ga0105245_10529453 3300009098 Bacteria 1198
102 Ga0105245_10564478 3300009098 Bacteria 1161
103 Ga0105247_10739377 3300009101 Bacteria 744
104 Ga0114129_10015477 3300009147 Bacteria 10849
105 Ga0105243_10016682 3300009148 Bacteria 5552
106 Ga0105243_11291533 3300009148 Bacteria 747
107 Ga0105242_10077264 3300009176 Bacteria 2777
108 Ga0105248_10004942 3300009177 Bacteria 14722
109 Ga0105237_10284003 3300009545 Bacteria 1658
110 Ga0105238_10713332 3300009551 Bacteria 1015
111 Ga0105249_10152586 3300009553 Bacteria 2225
112 Ga0105249_10590125 3300009553 Bacteria 1165
113 Ga0105239_10066975 3300010375 Bacteria 3945
114 Ga0105246_10702699 3300011119 Bacteria 886
115 Ga0105246_10704409 3300011119 Bacteria 885
116 Ga0157370_11250007 3300013104 Bacteria 669
117 Ga0157369_10259292 3300013105 Bacteria 1813
118 Ga0157369_11217388 3300013105 Bacteria 768
119 Ga0157369_11507673 3300013105 Bacteria 684
120 Ga0157372_10044954 3300013307 Bacteria 4895
121 Ga0157372_10746791 3300013307 Bacteria 1138
122 Ga0157375_10443034 3300013308 Bacteria 1464
123 Ga0157375_10813302 3300013308 Bacteria 1083
124 Ga0163163_10013816 3300014325 Bacteria 7406
125 Ga0163163_10816685 3300014325 Bacteria 996
126 Ga0157380_10022917 3300014326 Bacteria 4708
127 Ga0157380_10790418 3300014326 Bacteria 965
128 Ga0182008_10122718 3300014497 Bacteria 1292
129 Ga0157377_10019742 3300014745 Bacteria 3524
130 Ga0157376_10962103 3300014969 Bacteria 875
131 Ga0206356_10740864 3300020070 Bacteria 996
132 Ga0206350_10951756 3300020080 Bacteria 1156
133 Ga0206353_11088676 3300020082 Bacteria 769
134 Ga0206353_11793001 3300020082 Bacteria 5245
135 Ga0206353_12002282 3300020082 Bacteria 615
136 Ga0154015_1102419 3300020610 Bacteria 1094
137 Ga0213875_10186414 3300021388 Bacteria 975
138 Ga0224712_10075905 3300022467 Bacteria 1376
139 Ga0207642_10010439 3300025899 Bacteria 3274
140 Ga0207642_10281461 3300025899 Bacteria 957
141 Ga0207688_10048477 3300025901 Bacteria 2374
142 Ga0207647_10163027 3300025904 Bacteria 1300
143 Ga0207647_10494213 3300025904 Bacteria 683
144 Ga0207643_10006825 3300025908 Bacteria 6126
145 Ga0207705_10047040 3300025909 Bacteria 3101
146 Ga0207705_10991258 3300025909 Bacteria 649
147 Ga0207662_10010825 3300025918 Bacteria 5041
148 Ga0207657_10016338 3300025919 Bacteria 7161
149 Ga0207657_10175962 3300025919 Bacteria 1732
150 Ga0207657_10218165 3300025919 Bacteria 1529
151 Ga0207681_10271296 3300025923 Bacteria 1332
152 Ga0207687_10059569 3300025927 Bacteria 2690
153 Ga0207687_10112951 3300025927 Bacteria 2020
154 Ga0207644_10265484 3300025931 Bacteria 1374
155 Ga0207690_10068638 3300025932 Bacteria 2436
156 Ga0207690_10093220 3300025932 Bacteria 2133
157 Ga0207690_10653099 3300025932 Bacteria 862
158 Ga0207686_10072257 3300025934 Bacteria 2223
159 Ga0207709_10161806 3300025935 Bacteria 1562
160 Ga0207669_10002749 3300025937 Bacteria 7544
161 Ga0207704_10457559 3300025938 Bacteria 1020
162 Ga0207691_10006151 3300025940 Bacteria 11606
163 Ga0207689_10254300 3300025942 Bacteria 1453
164 Ga0207689_11140273 3300025942 Bacteria 657
165 Ga0207661_10069709 3300025944 Bacteria 2868
166 Ga0207661_10150627 3300025944 Bacteria 2010
167 Ga0207661_10537076 3300025944 Bacteria 1070
168 Ga0207661_10556524 3300025944 Bacteria 1051
169 Ga0207679_10084350 3300025945 Bacteria 2438
170 Ga0207667_10182719 3300025949 Bacteria 2153
171 Ga0207712_10090656 3300025961 Bacteria 2250
172 Ga0207668_10143766 3300025972 Bacteria 1838
173 Ga0207640_10195061 3300025981 Bacteria 1529
174 Ga0207640_10909465 3300025981 Bacteria 769
175 Ga0207658_10028370 3300025986 Bacteria 3942
176 Ga0207677_10219706 3300026023 Bacteria 1523
177 Ga0207677_10332938 3300026023 Bacteria 1266
178 Ga0207677_10601908 3300026023 Bacteria 965
179 Ga0207703_10978187 3300026035 Bacteria 812
180 Ga0207678_10016344 3300026067 Bacteria 6515
181 Ga0207678_10125306 3300026067 Bacteria 2192
182 Ga0207678_10202507 3300026067 Bacteria 1697
183 Ga0207678_10417362 3300026067 Bacteria 1163
184 Ga0207708_10000379 3300026075 Bacteria 34728
185 Ga0207702_10518486 3300026078 Bacteria 1163
186 Ga0207641_11073728 3300026088 Bacteria 803
187 Ga0207648_10002445 3300026089 Bacteria 19971
188 Ga0207676_10374890 3300026095 Bacteria 1323
189 Ga0207675_100047376 3300026118 Bacteria 4013
190 Ga0207698_10014572 3300026142 Bacteria 5233
191 Ga0209813_10001441 3300027866 Bacteria 5371
192 Ga0209813_10108637 3300027866 Bacteria 953
193 Ga0209813_10167841 3300027866 Bacteria 795
194 Ga0207428_10250482 3300027907 Bacteria 1321
195 Ga0268265_10283667 3300028380 Bacteria 1483
196 Ga0268264_10000320 3300028381 Bacteria 75931
197 Ga0307406_10510009 3300031901 Bacteria 977
198 Ga0307407_10026025 3300031903 Bacteria 3093
199 Ga0307412_10274968 3300031911 Bacteria 1320
200 Ga0307409_100783306 3300031995 Bacteria 960
201 Ga0307409_101734597 3300031995 Bacteria 653
202 Ga0307416_100084995 3300032002 Bacteria 2691
203 Ga0307416_101678402 3300032002 Bacteria 740
204 Ga0307416_101729349 3300032002 Bacteria 730
205 Ga0307414_10537129 3300032004 Bacteria 1040
206 Ga0307411_10116055 3300032005 Bacteria 1927
207 Ga0307411_10149400 3300032005 Bacteria 1734
208 Ga0307415_100246137 3300032126 Bacteria 1450
209 Ga0307415_100509052 3300032126 Bacteria 1054
210 Ga0307415_100767740 3300032126 Bacteria 877
211 Ga0395899_0063357 3300037312 Bacteria 2720
212 Ga0395900_0124064 3300037418 Bacteria 2649
213 Ga0395900_0184246 3300037418 Bacteria 2120
214 Ga0395898_0283446 3300037466 Bacteria 1580
215 Ga0436364_0119901 3300037853 Bacteria 1652
216 Ga0395901_0166582 3300038443 Bacteria 2313
217 Ga0451804_0384194 3300041463 Bacteria 799
218 Ga0451807_2689973 3300041486 Bacteria 743
219 Ga0451833_0465057 3300041491 Bacteria 942
220 Ga0451835_0144173 3300041492 Bacteria 917
221 Ga0451837_0249568 3300041494 Bacteria 884
222 Ga0451853_3410788 3300041512 Bacteria 901
223 Ga0439449_0031499 3300042007 Bacteria 1977
224 Ga0439449_0071243 3300042007 Bacteria 1281
225 Ga0466969_0110520 3300044656 Bacteria 1287
226 Ga0466972_0050411 3300044658 Bacteria 2010
227 Ga0466972_0076131 3300044658 Bacteria 1598
228 Ga0466972_0333612 3300044658 Bacteria 709
229 Ga0466965_0084792 3300044683 Bacteria 1605
230 Ga0466965_0321699 3300044683 Bacteria 843
231 Ga0466965_0511272 3300044683 Bacteria 674
232 Ga0466966_0003626 3300044684 Bacteria 10189
233 Ga0466966_0064535 3300044684 Bacteria 2305
234 Ga0466966_0142895 3300044684 Bacteria 1462
235 Ga0466961_0028905 3300044693 Bacteria 3564
236 Ga0466961_0192114 3300044693 Bacteria 1265
237 Ga0466961_0229752 3300044693 Bacteria 1142
238 Ga0466961_0267558 3300044693 Bacteria 1048
239 Ga0466963_0025379 3300044694 Bacteria 3779
240 Ga0466963_0051764 3300044694 Bacteria 2723
241 Ga0466963_0111597 3300044694 Bacteria 1877
242 Ga0466963_0204255 3300044694 Bacteria 1382
243 Ga0466963_0338791 3300044694 Bacteria 1059
244 Ga0466971_0004707 3300044719 Bacteria 5899
245 Ga0466971_0047021 3300044719 Bacteria 1939
246 Ga0466968_0140042 3300044735 Bacteria 1106
247 Ga0466970_0096672 3300044765 Bacteria 1606
248 Ga0466970_0096993 3300044765 Bacteria 1604
249 Ga0466957_0096319 3300044842 Bacteria 1859
250 Ga0466957_0191628 3300044842 Bacteria 1339
251 Ga0466960_0000222 3300044901 Bacteria 19771
252 Ga0466960_0000917 3300044901 Bacteria 10449
253 Ga0466960_0016887 3300044901 Bacteria 3174
254 Ga0466960_0057880 3300044901 Bacteria 1892
255 Ga0466960_0081006 3300044901 Bacteria 1636
256 Ga0466959_0016320 3300045049 Bacteria 5424
257 Ga0466958_0046855 3300045836 Bacteria 2609
258 Ga0466958_0071690 3300045836 Bacteria 2121
259 Ga0466958_0468699 3300045836 Bacteria 816
260 Ga0466958_0594986 3300045836 Bacteria 719
261 Ga0466967_0057903 3300045976 Bacteria 3423
262 Ga0466967_0060606 3300045976 Bacteria 3354
263 Ga0466967_0122942 3300045976 Bacteria 2401
264 Ga0466967_0196752 3300045976 Bacteria 1907
265 Ga0466967_0454215 3300045976 Bacteria 1252
266 Ga0466967_1892469 3300045976 Bacteria 593
267 Ga0495627_055031 3300046453 Bacteria 1188
268 Ga0495641_0369797 3300046461 Bacteria 649
269 Ga0495662_0263239 3300046476 Bacteria 849
270 Ga0495585_0112815 3300046492 Bacteria 1444
271 Ga0496100_0600726 3300048903 Bacteria 854
272 Ga0496101_0240301 3300048904 Bacteria 1409
273 Ga0496101_0279400 3300048904 Bacteria 1305
274 Ga0496101_0739123 3300048904 Bacteria 776
275 Ga0496101_0869921 3300048904 Bacteria 710
276 Ga0496102_0084679 3300048905 Bacteria 2926
277 Ga0496102_0435877 3300048905 Bacteria 1230
278 Ga0496103_0020969 3300048906 Bacteria 3929
279 Ga0496103_0023712 3300048906 Bacteria 3701
280 Ga0496104_0839380 3300048907 Bacteria 824
281 Ga0496105_0259120 3300048908 Bacteria 1407
282 Ga0496105_0594797 3300048908 Bacteria 859
283 Ga0496107_0038771 3300048910 Bacteria 3417
284 Ga0496107_0500669 3300048910 Bacteria 901
285 Ga0496108_0017093 3300048911 Bacteria 5932
286 Ga0496108_0136799 3300048911 Bacteria 2108
287 Ga0496108_0150267 3300048911 Bacteria 2009
288 Ga0496108_0155220 3300048911 Bacteria 1976
289 Ga0496109_0035443 3300048912 Bacteria 4501
290 Ga0496109_0203293 3300048912 Bacteria 1862
291 Ga0496109_0207037 3300048912 Bacteria 1844
292 Ga0496109_0554817 3300048912 Bacteria 1084
293 Ga0496110_0247800 3300048913 Bacteria 1621
294 Ga0496110_0411410 3300048913 Bacteria 1233
295 Ga0496110_0993545 3300048913 Bacteria 746
296 Ga0496110_1018038 3300048913 Bacteria 736
297 Ga0496110_1316553 3300048913 Bacteria 632
298 Ga0496111_0085924 3300048914 Bacteria 2301
299 Ga0496111_0127169 3300048914 Bacteria 1884
300 Ga0496113_0062176 3300048916 Bacteria 2819
301 Ga0496114_0005146 3300048917 Bacteria 10200
302 Ga0496114_0058561 3300048917 Bacteria 3217
303 Ga0496114_0074723 3300048917 Bacteria 2853
304 Ga0496114_0562322 3300048917 Bacteria 1007
305 Ga0496124_0049041 3300048927 Bacteria 3604
306 Ga0496126_0718847 3300048929 Bacteria 774
307 Ga0501031_0008451 3300049568 Bacteria 6699
308 Ga0501031_0039055 3300049568 Bacteria 3097
309 Ga0501031_0070884 3300049568 Bacteria 2270
310 Ga0501031_0805787 3300049568 Bacteria 602
311 Ga0501032_0054944 3300049569 Bacteria 2679
312 Ga0501032_0057737 3300049569 Bacteria 2607
313 Ga0501032_0233963 3300049569 Bacteria 1194
314 Ga0501032_0294270 3300049569 Bacteria 1050
315 Ga0501032_0389202 3300049569 Bacteria 896
316 Ga0501033_0138344 3300049570 Bacteria 1761
317 Ga0501033_0416439 3300049570 Bacteria 936
318 Ga0501033_0759867 3300049570 Bacteria 657
319 Ga0501034_0004891 3300049571 Bacteria 14775
320 Ga0501034_0522368 3300049571 Bacteria 1099
321 Ga0501034_0569170 3300049571 Bacteria 1041
322 Ga0501034_0808071 3300049571 Bacteria 830
323 Ga0501034_0897347 3300049571 Bacteria 774
324 Ga0501036_0120965 3300049572 Bacteria 2211
325 Ga0501036_0534793 3300049572 Bacteria 974
326 Ga0501037_0002911 3300049573 Bacteria 12414
327 Ga0501037_0181670 3300049573 Bacteria 1492
328 Ga0501037_0191503 3300049573 Bacteria 1448
329 Ga0501038_0041595 3300049574 Bacteria 4007
330 Ga0501038_0086346 3300049574 Bacteria 2636
331 Ga0501038_0111628 3300049574 Bacteria 2264
332 Ga0501039_0086638 3300049575 Bacteria 2439
333 Ga0501039_0108431 3300049575 Bacteria 2170
334 Ga0501039_0606952 3300049575 Bacteria 858
335 Ga0501039_0951828 3300049575 Bacteria 668
336 Ga0501042_0093216 3300049578 Bacteria 2163
337 Ga0501043_0009280 3300049579 Bacteria 7731
338 Ga0501043_0057869 3300049579 Bacteria 3043
339 Ga0501043_0185140 3300049579 Bacteria 1621
340 Ga0501046_0000400 3300049580 Bacteria 43372
341 Ga0501046_0011157 3300049580 Bacteria 7697
342 Ga0501046_0103946 3300049580 Bacteria 2177
343 Ga0501047_0043554 3300049581 Bacteria 4336
344 Ga0501047_0139482 3300049581 Bacteria 2303
345 Ga0501047_0804018 3300049581 Bacteria 755
346 Ga0501048_0003895 3300049582 Bacteria 11349
347 Ga0501048_0106440 3300049582 Bacteria 1979
348 Ga0501067_0000678 3300049583 Bacteria 18332
349 Ga0501067_0013375 3300049583 Bacteria 4544
350 Ga0501067_0059839 3300049583 Bacteria 2109
351 Ga0501068_0114731 3300049584 Bacteria 1677
352 Ga0501068_0283727 3300049584 Bacteria 1059
353 Ga0501069_0111623 3300049585 Bacteria 1557
354 Ga0501069_0180856 3300049585 Bacteria 1219
355 Ga0501069_0518125 3300049585 Bacteria 712
356 Ga0501070_0007806 3300049586 Bacteria 9072
357 Ga0501070_0014590 3300049586 Bacteria 6612
358 Ga0501070_0023090 3300049586 Bacteria 5209
359 Ga0501070_0103604 3300049586 Bacteria 2353
360 Ga0501070_0137004 3300049586 Bacteria 2021
361 Ga0501070_0189996 3300049586 Bacteria 1688
362 Ga0501070_0579328 3300049586 Bacteria 896
363 Ga0501070_0739344 3300049586 Bacteria 776
364 Ga0501071_0023497 3300049587 Bacteria 4306
365 Ga0501071_0256991 3300049587 Bacteria 1319
366 Ga0501072_0032045 3300049588 Bacteria 4115
367 Ga0501072_0055624 3300049588 Bacteria 3118
368 Ga0501072_0113040 3300049588 Bacteria 2162
369 Ga0501072_0213953 3300049588 Bacteria 1536
370 Ga0501073_0071421 3300049589 Bacteria 2418
371 Ga0501073_0091163 3300049589 Bacteria 2118
372 Ga0501073_0113062 3300049589 Bacteria 1883
373 Ga0501073_0288859 3300049589 Bacteria 1131
374 Ga0501074_0002190 3300049590 Bacteria 13535
375 Ga0501074_0099204 3300049590 Bacteria 2085
376 Ga0501074_0313519 3300049590 Bacteria 1114
377 Ga0501074_0683480 3300049590 Bacteria 725
378 Ga0501075_0111828 3300049591 Bacteria 2077
379 Ga0501077_0066569 3300049593 Bacteria 2285
380 Ga0501079_0602782 3300049741 Bacteria 864
381 Ga0501080_0011811 3300049742 Bacteria 8002
382 Ga0501080_0037253 3300049742 Bacteria 4541
383 Ga0501080_0461965 3300049742 Bacteria 1137
384 Ga0501080_1043679 3300049742 Bacteria 707
385 Ga0501081_0161365 3300049743 Bacteria 1615
386 Ga0501081_1012860 3300049743 Bacteria 628
387 Ga0501083_0089384 3300049744 Bacteria 2035
388 Ga0501035_0091395 3300049822 Bacteria 2679
389 Ga0501035_0198800 3300049822 Bacteria 1720
390 Ga0501035_0285221 3300049822 Bacteria 1395
391 Ga0501035_0320392 3300049822 Bacteria 1302
392 Ga0501035_0589268 3300049822 Bacteria 907
393 Ga0501035_0820568 3300049822 Bacteria 742
394 Ga0501035_1003025 3300049822 Bacteria 656
395 Ga0501044_0180597 3300049823 Bacteria 2077
396 Ga0501044_0599058 3300049823 Bacteria 995
397 Ga0501044_0684179 3300049823 Bacteria 912
398 Ga0501044_0692539 3300049823 Bacteria 905
399 Ga0501045_0061686 3300049824 Bacteria 2751
400 Ga0501045_0142555 3300049824 Bacteria 1782
401 nmdc:mga03n38_10355_c1 3300050490 Bacteria 3426
402 nmdc:mga03n38_127953_c1 3300050490 Bacteria 1256
403 nmdc:mga03n38_476443_c1 3300050490 Bacteria 697
404 nmdc:mga03n38_98920_c1 3300050490 Bacteria 1404
405 nmdc:mga00v17_107307_c1 3300050491 Bacteria 1768
406 nmdc:mga00v17_11327_c1 3300050491 Bacteria 4902
407 nmdc:mga00v17_205502_c1 3300050491 Bacteria 1274
408 nmdc:mga00v17_35957_c1 3300050491 Bacteria 2950
409 nmdc:mga00v17_36907_c1 3300050491 Bacteria 2915
410 nmdc:mga00v17_4491_c1 3300050491 Bacteria 7264
411 nmdc:mga00v17_57250_c1 3300050491 Bacteria 2385
412 nmdc:mga00v17_58933_c1 3300050491 Bacteria 2354
413 nmdc:mga00v17_93500_c1 3300050491 Bacteria 1891
414 nmdc:mga0yw44_115899_c1 3300050492 Bacteria 1721
415 nmdc:mga0yw44_170838_c1 3300050492 Bacteria 1427
416 nmdc:mga0yw44_174985_c1 3300050492 Bacteria 1411
417 nmdc:mga0yw44_197894_c1 3300050492 Bacteria 1326
418 nmdc:mga0yw44_2650_c1 3300050492 Bacteria 7708
419 nmdc:mga0yw44_320121_c1 3300050492 Bacteria 1041
420 nmdc:mga0yw44_36221_c1 3300050492 Bacteria 2906
421 nmdc:mga0yw44_422433_c1 3300050492 Bacteria 903
422 nmdc:mga0yw44_485903_c1 3300050492 Bacteria 838
423 nmdc:mga0yw44_58129_c1 3300050492 Bacteria 1257
424 nmdc:mga0yw44_72688_c1 3300050492 Bacteria 2138
425 nmdc:mga06z11_51666_c1 3300050494 Bacteria 2106
426 nmdc:mga06z11_671691_c1 3300050494 Bacteria 631
427 nmdc:mga04h51_194558_c1 3300050495 Bacteria 794
428 nmdc:mga04h51_9778_c1 3300050495 Bacteria 2613
429 nmdc:mga07m45_13123_c1 3300050496 Bacteria 4387
430 nmdc:mga07m45_411900_c1 3300050496 Bacteria 784
431 nmdc:mga05p37_354755_c1 3300050507 Bacteria 1726
432 nmdc:mga09592_126863_c1 3300050508 Bacteria 2194
433 nmdc:mga06r32_436609_c1 3300050510 Bacteria 1290
434 nmdc:mga08y16_1044008_c1 3300050511 Bacteria 795
435 nmdc:mga08y16_1405765_c1 3300050511 Bacteria 661
436 nmdc:mga08y16_285921_c1 3300050511 Bacteria 1700
437 nmdc:mga08x19_795893_c1 3300050514 Bacteria 671
438 nmdc:mga0sz30_74616_c1 3300050516 Bacteria 1027
439 Ga0500644_0000541 3300053088 Bacteria 15557
440 Ga0500556_0000971 3300053104 Bacteria 15299
441 Ga0500593_000263 3300053117 Bacteria 21458
442 Ga0500573_0140908 3300053140 Bacteria 1328
443 Ga0501084_0105515 3300054114 Bacteria 2367
444 Ga0501084_0130651 3300054114 Bacteria 2114
445 Ga0501082_0136066 3300060353 Bacteria 2132
446 Ga0501082_0446795 3300060353 Bacteria 1129
447 Ga0466962_0007072 3300061719 Bacteria 5378
448 Ga0466962_0026294 3300061719 Bacteria 2794
449 Ga0466962_0141516 3300061719 Bacteria 1165
450 Ga0530510_0108532 3300061734 Bacteria 2032
451 Ga0530510_0374807 3300061734 Bacteria 1071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003285 Ga0007423J48922_100915 Ga0007423J48922_1009151 169
2 3300049568 Ga0501031_0039055 Ga0501031_0039055_2398_2940 169
3 3300049823 Ga0501044_0684179 Ga0501044_0684179_51_593 169
4 iso_pu_bacteria 2643221615 2644089074 170
5 iso_pu_bacteria 2643221617 2644101835 170
6 iso_pu_bacteria 2643221620 2644115897 170
7 iso_pu_bacteria 2643221657 2644318919 170
8 iso_pu_bacteria 2751185734 2753070796 170
9 iso_pu_bacteria 2857481737 2857482512 170
10 iso_pu_bacteria 2870721527 2870726639 170
11 iso_pu_bacteria 2855386786 2855387158 171
12 3300006038 Ga0075365_10006599 Ga0075365_100065994 172
13 3300006051 Ga0075364_10013210 Ga0075364_100132104 172
14 3300006186 Ga0075369_10005356 Ga0075369_100053564 172
15 3300009551 Ga0105238_10713332 Ga0105238_107133322 172
16 3300013104 Ga0157370_11250007 Ga0157370_112500071 172
17 3300013105 Ga0157369_11217388 Ga0157369_112173882 172
18 3300026088 Ga0207641_11073728 Ga0207641_110737281 172
19 3300027866 Ga0209813_10167841 Ga0209813_101678412 172
20 3300048908 Ga0496105_0259120 Ga0496105_0259120_440_964 172
21 3300049575 Ga0501039_0951828 Ga0501039_0951828_53_577 172
22 3300049578 Ga0501042_0093216 Ga0501042_0093216_916_1440 172
23 3300050491 nmdc:mga00v17_4491_c1 nmdc:mga00v17_4491_c1_4629_5153 172
24 3300050495 nmdc:mga04h51_194558_c1 nmdc:mga04h51_194558_c1_44_568 172
25 3300050516 nmdc:mga0sz30_74616_c1 nmdc:mga0sz30_74616_c1_106_630 172
26 iso_pu_bacteria 2811994880 2812364971 172
27 3300006058 Ga0075432_10237595 Ga0075432_102375952 173
28 3300032002 Ga0307416_101678402 Ga0307416_1016784021 173
29 3300037418 Ga0395900_0184246 Ga0395900_0184246_1574_2098 173
30 3300049569 Ga0501032_0294270 Ga0501032_0294270_95_619 173
31 3300049572 Ga0501036_0120965 Ga0501036_0120965_236_760 173
32 3300049575 Ga0501039_0086638 Ga0501039_0086638_746_1270 173
33 3300049588 Ga0501072_0113040 Ga0501072_0113040_1113_1637 173
34 3300049822 Ga0501035_0589268 Ga0501035_0589268_129_653 173
35 3300049824 Ga0501045_0061686 Ga0501045_0061686_2173_2697 173
36 3300050511 nmdc:mga08y16_1405765_c1 nmdc:mga08y16_1405765_c1_111_635 173
37 3300054114 Ga0501084_0105515 Ga0501084_0105515_968_1492 173
38 3300002075 JGI24738J21930_10001460 JGI24738J21930_100014605 174
39 3300002077 JGI24744J21845_10001693 JGI24744J21845_100016932 174
40 3300005327 Ga0070658_10047179 Ga0070658_100471792 174
41 3300005327 Ga0070658_10219311 Ga0070658_102193113 174
42 3300005329 Ga0070683_100357252 Ga0070683_1003572522 174
43 3300005329 Ga0070683_101547594 Ga0070683_1015475941 174
44 3300005337 Ga0070682_100003020 Ga0070682_1000030207 174
45 3300005338 Ga0068868_100311855 Ga0068868_1003118552 174
46 3300005339 Ga0070660_100071607 Ga0070660_1000716074 174
47 3300005339 Ga0070660_100247860 Ga0070660_1002478602 174
48 3300005339 Ga0070660_100477275 Ga0070660_1004772752 174
49 3300005341 Ga0070691_10012583 Ga0070691_100125832 174
50 3300005343 Ga0070687_100164758 Ga0070687_1001647582 174
51 3300005347 Ga0070668_100097615 Ga0070668_1000976152 174
52 3300005354 Ga0070675_100741920 Ga0070675_1007419202 174
53 3300005356 Ga0070674_100011843 Ga0070674_1000118432 174
54 3300005364 Ga0070673_100330976 Ga0070673_1003309762 174
55 3300005366 Ga0070659_100027811 Ga0070659_1000278114 174
56 3300005367 Ga0070667_100038231 Ga0070667_1000382314 174
57 3300005438 Ga0070701_10001815 Ga0070701_100018153 174
58 3300005441 Ga0070700_100004347 Ga0070700_1000043479 174
59 3300005459 Ga0068867_100012645 Ga0068867_1000126452 174
60 3300005471 Ga0070698_101384412 Ga0070698_1013844121 174
61 3300005535 Ga0070684_100125366 Ga0070684_1001253661 174
62 3300005535 Ga0070684_100176629 Ga0070684_1001766292 174
63 3300005535 Ga0070684_100631329 Ga0070684_1006313291 174
64 3300005539 Ga0068853_100365598 Ga0068853_1003655982 174
65 3300005543 Ga0070672_100014089 Ga0070672_1000140892 174
66 3300005547 Ga0070693_100062482 Ga0070693_1000624822 174
67 3300005547 Ga0070693_100820828 Ga0070693_1008208281 174
68 3300005563 Ga0068855_100068555 Ga0068855_1000685552 174
69 3300005578 Ga0068854_100040507 Ga0068854_1000405072 174
70 3300005615 Ga0070702_100024064 Ga0070702_1000240644 174
71 3300005616 Ga0068852_100005131 Ga0068852_1000051318 174
72 3300005618 Ga0068864_101407560 Ga0068864_1014075601 174
73 3300005718 Ga0068866_10009684 Ga0068866_100096842 174
74 3300005719 Ga0068861_100009670 Ga0068861_1000096702 174
75 3300005840 Ga0068870_10051246 Ga0068870_100512462 174
76 3300005842 Ga0068858_100471628 Ga0068858_1004716282 174
77 3300005843 Ga0068860_100000400 Ga0068860_10000040050 174
78 3300005844 Ga0068862_100066686 Ga0068862_1000666863 174
79 3300005985 Ga0081539_10072067 Ga0081539_100720672 174
80 3300006038 Ga0075365_10015400 Ga0075365_100154003 174
81 3300006038 Ga0075365_10027377 Ga0075365_100273773 174
82 3300006038 Ga0075365_10030018 Ga0075365_100300183 174
83 3300006038 Ga0075365_10032502 Ga0075365_100325024 174
84 3300006038 Ga0075365_10034298 Ga0075365_100342982 174
85 3300006038 Ga0075365_10034602 Ga0075365_100346025 174
86 3300006038 Ga0075365_10040042 Ga0075365_100400423 174
87 3300006038 Ga0075365_10040643 Ga0075365_100406431 174
88 3300006038 Ga0075365_10066922 Ga0075365_100669223 174
89 3300006038 Ga0075365_10069587 Ga0075365_100695873 174
90 3300006038 Ga0075365_10080075 Ga0075365_100800752 174
91 3300006038 Ga0075365_10110897 Ga0075365_101108973 174
92 3300006038 Ga0075365_10186710 Ga0075365_101867102 174
93 3300006038 Ga0075365_10258731 Ga0075365_102587312 174
94 3300006038 Ga0075365_10273718 Ga0075365_102737181 174
95 3300006038 Ga0075365_10580456 Ga0075365_105804562 174
96 3300006038 Ga0075365_10737447 Ga0075365_107374472 174
97 3300006038 Ga0075365_10808706 Ga0075365_108087062 174
98 3300006042 Ga0075368_10008393 Ga0075368_100083934 174
99 3300006042 Ga0075368_10202096 Ga0075368_102020962 174
100 3300006042 Ga0075368_10245597 Ga0075368_102455971 174
101 3300006048 Ga0075363_100006491 Ga0075363_1000064912 174
102 3300006048 Ga0075363_100054187 Ga0075363_1000541873 174
103 3300006048 Ga0075363_100080335 Ga0075363_1000803352 174
104 3300006048 Ga0075363_100145970 Ga0075363_1001459702 174
105 3300006051 Ga0075364_10016186 Ga0075364_100161862 174
106 3300006051 Ga0075364_10082561 Ga0075364_100825613 174
107 3300006051 Ga0075364_10216932 Ga0075364_102169322 174
108 3300006051 Ga0075364_10248558 Ga0075364_102485582 174
109 3300006051 Ga0075364_10363448 Ga0075364_103634482 174
110 3300006051 Ga0075364_10554161 Ga0075364_105541612 174
111 3300006177 Ga0075362_10092072 Ga0075362_100920722 174
112 3300006178 Ga0075367_10007120 Ga0075367_100071204 174
113 3300006178 Ga0075367_10043165 Ga0075367_100431652 174
114 3300006353 Ga0075370_10000475 Ga0075370_100004751 174
115 3300006353 Ga0075370_10000774 Ga0075370_100007747 174
116 3300006353 Ga0075370_10067911 Ga0075370_100679112 174
117 3300006358 Ga0068871_101265831 Ga0068871_1012658311 174
118 3300006844 Ga0075428_100014361 Ga0075428_1000143613 174
119 3300006844 Ga0075428_100678888 Ga0075428_1006788882 174
120 3300006846 Ga0075430_100011496 Ga0075430_1000114969 174
121 3300006880 Ga0075429_100029240 Ga0075429_1000292403 174
122 3300006881 Ga0068865_100004316 Ga0068865_1000043164 174
123 3300006914 Ga0075436_100605975 Ga0075436_1006059752 174
124 3300009094 Ga0111539_10357173 Ga0111539_103571732 174
125 3300009094 Ga0111539_10383429 Ga0111539_103834292 174
126 3300009094 Ga0111539_10882875 Ga0111539_108828751 174
127 3300009098 Ga0105245_10043991 Ga0105245_100439913 174
128 3300009098 Ga0105245_10529453 Ga0105245_105294531 174
129 3300009098 Ga0105245_10564478 Ga0105245_105644782 174
130 3300009101 Ga0105247_10739377 Ga0105247_107393772 174
131 3300009147 Ga0114129_10015477 Ga0114129_100154779 174
132 3300009148 Ga0105243_10016682 Ga0105243_100166824 174
133 3300009148 Ga0105243_11291533 Ga0105243_112915331 174
134 3300009176 Ga0105242_10077264 Ga0105242_100772642 174
135 3300009177 Ga0105248_10004942 Ga0105248_1000494214 174
136 3300009545 Ga0105237_10284003 Ga0105237_102840032 174
137 3300009553 Ga0105249_10152586 Ga0105249_101525862 174
138 3300010375 Ga0105239_10066975 Ga0105239_100669753 174
139 3300011119 Ga0105246_10702699 Ga0105246_107026991 174
140 3300011119 Ga0105246_10704409 Ga0105246_107044092 174
141 3300013105 Ga0157369_11507673 Ga0157369_115076731 174
142 3300013307 Ga0157372_10044954 Ga0157372_100449542 174
143 3300013307 Ga0157372_10746791 Ga0157372_107467911 174
144 3300013308 Ga0157375_10443034 Ga0157375_104430342 174
145 3300013308 Ga0157375_10813302 Ga0157375_108133021 174
146 3300014325 Ga0163163_10013816 Ga0163163_100138165 174
147 3300014325 Ga0163163_10816685 Ga0163163_108166852 174
148 3300014326 Ga0157380_10022917 Ga0157380_100229172 174
149 3300014326 Ga0157380_10790418 Ga0157380_107904181 174
150 3300014497 Ga0182008_10122718 Ga0182008_101227182 174
151 3300014745 Ga0157377_10019742 Ga0157377_100197424 174
152 3300014969 Ga0157376_10962103 Ga0157376_109621032 174
153 3300020080 Ga0206350_10951756 Ga0206350_109517562 174
154 3300020082 Ga0206353_11088676 Ga0206353_110886761 174
155 3300020082 Ga0206353_11793001 Ga0206353_117930015 174
156 3300020082 Ga0206353_12002282 Ga0206353_120022821 174
157 3300020610 Ga0154015_1102419 Ga0154015_11024192 174
158 3300021388 Ga0213875_10186414 Ga0213875_101864142 174
159 3300022467 Ga0224712_10075905 Ga0224712_100759053 174
160 3300025899 Ga0207642_10010439 Ga0207642_100104393 174
161 3300025899 Ga0207642_10281461 Ga0207642_102814612 174
162 3300025901 Ga0207688_10048477 Ga0207688_100484772 174
163 3300025904 Ga0207647_10163027 Ga0207647_101630271 174
164 3300025904 Ga0207647_10494213 Ga0207647_104942132 174
165 3300025908 Ga0207643_10006825 Ga0207643_100068252 174
166 3300025909 Ga0207705_10047040 Ga0207705_100470402 174
167 3300025909 Ga0207705_10991258 Ga0207705_109912581 174
168 3300025918 Ga0207662_10010825 Ga0207662_100108255 174
169 3300025919 Ga0207657_10016338 Ga0207657_100163384 174
170 3300025919 Ga0207657_10175962 Ga0207657_101759622 174
171 3300025919 Ga0207657_10218165 Ga0207657_102181652 174
172 3300025923 Ga0207681_10271296 Ga0207681_102712962 174
173 3300025927 Ga0207687_10059569 Ga0207687_100595692 174
174 3300025927 Ga0207687_10112951 Ga0207687_101129512 174
175 3300025931 Ga0207644_10265484 Ga0207644_102654842 174
176 3300025932 Ga0207690_10068638 Ga0207690_100686382 174
177 3300025932 Ga0207690_10093220 Ga0207690_100932201 174
178 3300025932 Ga0207690_10653099 Ga0207690_106530992 174
179 3300025934 Ga0207686_10072257 Ga0207686_100722572 174
180 3300025935 Ga0207709_10161806 Ga0207709_101618062 174
181 3300025937 Ga0207669_10002749 Ga0207669_100027492 174
182 3300025938 Ga0207704_10457559 Ga0207704_104575592 174
183 3300025940 Ga0207691_10006151 Ga0207691_100061515 174
184 3300025942 Ga0207689_10254300 Ga0207689_102543003 174
185 3300025944 Ga0207661_10069709 Ga0207661_100697092 174
186 3300025944 Ga0207661_10150627 Ga0207661_101506272 174
187 3300025944 Ga0207661_10537076 Ga0207661_105370762 174
188 3300025944 Ga0207661_10556524 Ga0207661_105565242 174
189 3300025945 Ga0207679_10084350 Ga0207679_100843502 174
190 3300025949 Ga0207667_10182719 Ga0207667_101827193 174
191 3300025961 Ga0207712_10090656 Ga0207712_100906562 174
192 3300025972 Ga0207668_10143766 Ga0207668_101437662 174
193 3300025981 Ga0207640_10195061 Ga0207640_101950612 174
194 3300025986 Ga0207658_10028370 Ga0207658_100283704 174
195 3300026023 Ga0207677_10219706 Ga0207677_102197062 174
196 3300026023 Ga0207677_10332938 Ga0207677_103329382 174
197 3300026023 Ga0207677_10601908 Ga0207677_106019081 174
198 3300026035 Ga0207703_10978187 Ga0207703_109781871 174
199 3300026067 Ga0207678_10016344 Ga0207678_100163444 174
200 3300026067 Ga0207678_10125306 Ga0207678_101253064 174
201 3300026067 Ga0207678_10202507 Ga0207678_102025072 174
202 3300026075 Ga0207708_10000379 Ga0207708_100003799 174
203 3300026078 Ga0207702_10518486 Ga0207702_105184862 174
204 3300026089 Ga0207648_10002445 Ga0207648_1000244511 174
205 3300026095 Ga0207676_10374890 Ga0207676_103748902 174
206 3300026118 Ga0207675_100047376 Ga0207675_1000473762 174
207 3300026142 Ga0207698_10014572 Ga0207698_100145726 174
208 3300027866 Ga0209813_10001441 Ga0209813_100014415 174
209 3300027866 Ga0209813_10108637 Ga0209813_101086371 174
210 3300027907 Ga0207428_10250482 Ga0207428_102504822 174
211 3300028380 Ga0268265_10283667 Ga0268265_102836671 174
212 3300028381 Ga0268264_10000320 Ga0268264_1000032072 174
213 3300031901 Ga0307406_10510009 Ga0307406_105100092 174
214 3300031903 Ga0307407_10026025 Ga0307407_100260252 174
215 3300031911 Ga0307412_10274968 Ga0307412_102749682 174
216 3300031995 Ga0307409_100783306 Ga0307409_1007833062 174
217 3300031995 Ga0307409_101734597 Ga0307409_1017345972 174
218 3300032002 Ga0307416_100084995 Ga0307416_1000849952 174
219 3300032004 Ga0307414_10537129 Ga0307414_105371292 174
220 3300032005 Ga0307411_10116055 Ga0307411_101160551 174
221 3300032005 Ga0307411_10149400 Ga0307411_101494001 174
222 3300032126 Ga0307415_100246137 Ga0307415_1002461372 174
223 3300037312 Ga0395899_0063357 Ga0395899_0063357_221_748 174
224 3300037418 Ga0395900_0124064 Ga0395900_0124064_1864_2391 174
225 3300037466 Ga0395898_0283446 Ga0395898_0283446_683_1210 174
226 3300037853 Ga0436364_0119901 Ga0436364_0119901_478_1017 174
227 3300038443 Ga0395901_0166582 Ga0395901_0166582_1644_2171 174
228 3300041463 Ga0451804_0384194 Ga0451804_0384194_254_781 174
229 3300041486 Ga0451807_2689973 Ga0451807_2689973_126_653 174
230 3300041491 Ga0451833_0465057 Ga0451833_0465057_321_848 174
231 3300041492 Ga0451835_0144173 Ga0451835_0144173_211_738 174
232 3300041494 Ga0451837_0249568 Ga0451837_0249568_228_755 174
233 3300041512 Ga0451853_3410788 Ga0451853_3410788_46_573 174
234 3300042007 Ga0439449_0031499 Ga0439449_0031499_816_1343 174
235 3300044656 Ga0466969_0110520 Ga0466969_0110520_91_618 174
236 3300044658 Ga0466972_0050411 Ga0466972_0050411_1268_1795 174
237 3300044658 Ga0466972_0076131 Ga0466972_0076131_483_1013 174
238 3300044658 Ga0466972_0333612 Ga0466972_0333612_21_548 174
239 3300044683 Ga0466965_0084792 Ga0466965_0084792_485_1015 174
240 3300044683 Ga0466965_0321699 Ga0466965_0321699_289_816 174
241 3300044683 Ga0466965_0511272 Ga0466965_0511272_57_584 174
242 3300044684 Ga0466966_0003626 Ga0466966_0003626_2317_2844 174
243 3300044684 Ga0466966_0064535 Ga0466966_0064535_119_646 174
244 3300044684 Ga0466966_0142895 Ga0466966_0142895_198_725 174
245 3300044693 Ga0466961_0028905 Ga0466961_0028905_1319_1846 174
246 3300044693 Ga0466961_0192114 Ga0466961_0192114_186_716 174
247 3300044693 Ga0466961_0229752 Ga0466961_0229752_364_891 174
248 3300044693 Ga0466961_0267558 Ga0466961_0267558_181_708 174
249 3300044694 Ga0466963_0025379 Ga0466963_0025379_296_823 174
250 3300044694 Ga0466963_0051764 Ga0466963_0051764_931_1458 174
251 3300044694 Ga0466963_0111597 Ga0466963_0111597_1324_1851 174
252 3300044694 Ga0466963_0204255 Ga0466963_0204255_699_1226 174
253 3300044694 Ga0466963_0338791 Ga0466963_0338791_134_664 174
254 3300044719 Ga0466971_0004707 Ga0466971_0004707_1681_2208 174
255 3300044719 Ga0466971_0047021 Ga0466971_0047021_627_1157 174
256 3300044735 Ga0466968_0140042 Ga0466968_0140042_130_657 174
257 3300044765 Ga0466970_0096672 Ga0466970_0096672_64_591 174
258 3300044765 Ga0466970_0096993 Ga0466970_0096993_640_1167 174
259 3300044842 Ga0466957_0096319 Ga0466957_0096319_33_560 174
260 3300044842 Ga0466957_0191628 Ga0466957_0191628_104_634 174
261 3300044901 Ga0466960_0000222 Ga0466960_0000222_6588_7115 174
262 3300044901 Ga0466960_0000917 Ga0466960_0000917_46_573 174
263 3300044901 Ga0466960_0016887 Ga0466960_0016887_1555_2082 174
264 3300044901 Ga0466960_0057880 Ga0466960_0057880_953_1480 174
265 3300044901 Ga0466960_0081006 Ga0466960_0081006_677_1207 174
266 3300045049 Ga0466959_0016320 Ga0466959_0016320_2173_2700 174
267 3300045836 Ga0466958_0046855 Ga0466958_0046855_1453_1983 174
268 3300045836 Ga0466958_0071690 Ga0466958_0071690_36_563 174
269 3300045836 Ga0466958_0468699 Ga0466958_0468699_107_634 174
270 3300045836 Ga0466958_0594986 Ga0466958_0594986_92_619 174
271 3300045976 Ga0466967_0057903 Ga0466967_0057903_1192_1719 174
272 3300045976 Ga0466967_0060606 Ga0466967_0060606_2340_2867 174
273 3300045976 Ga0466967_0122942 Ga0466967_0122942_283_810 174
274 3300045976 Ga0466967_0196752 Ga0466967_0196752_798_1340 174
275 3300045976 Ga0466967_0454215 Ga0466967_0454215_639_1166 174
276 3300045976 Ga0466967_1892469 Ga0466967_1892469_16_543 174
277 3300046461 Ga0495641_0369797 Ga0495641_0369797_77_604 174
278 3300046476 Ga0495662_0263239 Ga0495662_0263239_131_673 174
279 3300048903 Ga0496100_0600726 Ga0496100_0600726_155_682 174
280 3300048904 Ga0496101_0240301 Ga0496101_0240301_46_573 174
281 3300048904 Ga0496101_0279400 Ga0496101_0279400_107_634 174
282 3300048904 Ga0496101_0739123 Ga0496101_0739123_118_645 174
283 3300048904 Ga0496101_0869921 Ga0496101_0869921_75_602 174
284 3300048905 Ga0496102_0084679 Ga0496102_0084679_1642_2169 174
285 3300048905 Ga0496102_0435877 Ga0496102_0435877_679_1206 174
286 3300048906 Ga0496103_0020969 Ga0496103_0020969_1111_1638 174
287 3300048906 Ga0496103_0023712 Ga0496103_0023712_2286_2849 174
288 3300048907 Ga0496104_0839380 Ga0496104_0839380_245_772 174
289 3300048908 Ga0496105_0594797 Ga0496105_0594797_39_566 174
290 3300048910 Ga0496107_0038771 Ga0496107_0038771_12_539 174
291 3300048910 Ga0496107_0500669 Ga0496107_0500669_325_852 174
292 3300048911 Ga0496108_0017093 Ga0496108_0017093_1044_1571 174
293 3300048911 Ga0496108_0136799 Ga0496108_0136799_72_599 174
294 3300048911 Ga0496108_0150267 Ga0496108_0150267_1064_1591 174
295 3300048911 Ga0496108_0155220 Ga0496108_0155220_1140_1667 174
296 3300048912 Ga0496109_0035443 Ga0496109_0035443_3765_4292 174
297 3300048912 Ga0496109_0203293 Ga0496109_0203293_745_1272 174
298 3300048912 Ga0496109_0207037 Ga0496109_0207037_36_563 174
299 3300048912 Ga0496109_0554817 Ga0496109_0554817_171_698 174
300 3300048913 Ga0496110_0247800 Ga0496110_0247800_145_672 174
301 3300048913 Ga0496110_0411410 Ga0496110_0411410_96_623 174
302 3300048913 Ga0496110_0993545 Ga0496110_0993545_186_713 174
303 3300048913 Ga0496110_1018038 Ga0496110_1018038_109_636 174
304 3300048913 Ga0496110_1316553 Ga0496110_1316553_65_592 174
305 3300048914 Ga0496111_0085924 Ga0496111_0085924_1337_1864 174
306 3300048914 Ga0496111_0127169 Ga0496111_0127169_293_820 174
307 3300048916 Ga0496113_0062176 Ga0496113_0062176_1311_1838 174
308 3300048917 Ga0496114_0005146 Ga0496114_0005146_104_631 174
309 3300048917 Ga0496114_0058561 Ga0496114_0058561_2527_3054 174
310 3300048917 Ga0496114_0074723 Ga0496114_0074723_2160_2687 174
311 3300048917 Ga0496114_0562322 Ga0496114_0562322_210_737 174
312 3300048927 Ga0496124_0049041 Ga0496124_0049041_1001_1528 174
313 3300048929 Ga0496126_0718847 Ga0496126_0718847_178_741 174
314 3300049568 Ga0501031_0008451 Ga0501031_0008451_5128_5670 174
315 3300049568 Ga0501031_0070884 Ga0501031_0070884_1434_1961 174
316 3300049568 Ga0501031_0805787 Ga0501031_0805787_64_591 174
317 3300049569 Ga0501032_0054944 Ga0501032_0054944_2098_2625 174
318 3300049569 Ga0501032_0057737 Ga0501032_0057737_1949_2491 174
319 3300049569 Ga0501032_0233963 Ga0501032_0233963_620_1147 174
320 3300049569 Ga0501032_0389202 Ga0501032_0389202_310_837 174
321 3300049570 Ga0501033_0138344 Ga0501033_0138344_431_958 174
322 3300049570 Ga0501033_0416439 Ga0501033_0416439_132_674 174
323 3300049570 Ga0501033_0759867 Ga0501033_0759867_63_590 174
324 3300049571 Ga0501034_0004891 Ga0501034_0004891_2078_2605 174
325 3300049571 Ga0501034_0522368 Ga0501034_0522368_367_894 174
326 3300049571 Ga0501034_0569170 Ga0501034_0569170_37_564 174
327 3300049571 Ga0501034_0808071 Ga0501034_0808071_110_640 174
328 3300049571 Ga0501034_0897347 Ga0501034_0897347_96_623 174
329 3300049572 Ga0501036_0534793 Ga0501036_0534793_264_806 174
330 3300049573 Ga0501037_0002911 Ga0501037_0002911_11303_11830 174
331 3300049573 Ga0501037_0181670 Ga0501037_0181670_19_546 174
332 3300049573 Ga0501037_0191503 Ga0501037_0191503_696_1238 174
333 3300049574 Ga0501038_0041595 Ga0501038_0041595_537_1064 174
334 3300049574 Ga0501038_0086346 Ga0501038_0086346_1983_2525 174
335 3300049574 Ga0501038_0111628 Ga0501038_0111628_48_575 174
336 3300049575 Ga0501039_0108431 Ga0501039_0108431_192_719 174
337 3300049575 Ga0501039_0606952 Ga0501039_0606952_321_848 174
338 3300049579 Ga0501043_0009280 Ga0501043_0009280_7173_7700 174
339 3300049579 Ga0501043_0057869 Ga0501043_0057869_1883_2425 174
340 3300049579 Ga0501043_0185140 Ga0501043_0185140_844_1371 174
341 3300049580 Ga0501046_0000400 Ga0501046_0000400_33904_34431 174
342 3300049580 Ga0501046_0011157 Ga0501046_0011157_3220_3747 174
343 3300049580 Ga0501046_0103946 Ga0501046_0103946_1452_1994 174
344 3300049581 Ga0501047_0043554 Ga0501047_0043554_2191_2733 174
345 3300049581 Ga0501047_0139482 Ga0501047_0139482_1266_1793 174
346 3300049581 Ga0501047_0804018 Ga0501047_0804018_200_727 174
347 3300049582 Ga0501048_0003895 Ga0501048_0003895_8921_9463 174
348 3300049582 Ga0501048_0106440 Ga0501048_0106440_14_541 174
349 3300049583 Ga0501067_0000678 Ga0501067_0000678_16238_16765 174
350 3300049583 Ga0501067_0013375 Ga0501067_0013375_2455_2982 174
351 3300049583 Ga0501067_0059839 Ga0501067_0059839_1124_1651 174
352 3300049584 Ga0501068_0114731 Ga0501068_0114731_236_763 174
353 3300049584 Ga0501068_0283727 Ga0501068_0283727_298_825 174
354 3300049585 Ga0501069_0111623 Ga0501069_0111623_426_953 174
355 3300049585 Ga0501069_0180856 Ga0501069_0180856_670_1197 174
356 3300049585 Ga0501069_0518125 Ga0501069_0518125_87_614 174
357 3300049586 Ga0501070_0007806 Ga0501070_0007806_7315_7857 174
358 3300049586 Ga0501070_0014590 Ga0501070_0014590_4530_5057 174
359 3300049586 Ga0501070_0023090 Ga0501070_0023090_706_1233 174
360 3300049586 Ga0501070_0103604 Ga0501070_0103604_636_1163 174
361 3300049586 Ga0501070_0137004 Ga0501070_0137004_40_567 174
362 3300049586 Ga0501070_0189996 Ga0501070_0189996_781_1308 174
363 3300049586 Ga0501070_0579328 Ga0501070_0579328_284_811 174
364 3300049586 Ga0501070_0739344 Ga0501070_0739344_197_739 174
365 3300049587 Ga0501071_0023497 Ga0501071_0023497_3682_4209 174
366 3300049587 Ga0501071_0256991 Ga0501071_0256991_636_1163 174
367 3300049588 Ga0501072_0032045 Ga0501072_0032045_876_1403 174
368 3300049588 Ga0501072_0055624 Ga0501072_0055624_2292_2819 174
369 3300049588 Ga0501072_0213953 Ga0501072_0213953_974_1501 174
370 3300049589 Ga0501073_0071421 Ga0501073_0071421_1568_2095 174
371 3300049589 Ga0501073_0091163 Ga0501073_0091163_342_869 174
372 3300049589 Ga0501073_0113062 Ga0501073_0113062_48_575 174
373 3300049589 Ga0501073_0288859 Ga0501073_0288859_112_639 174
374 3300049590 Ga0501074_0002190 Ga0501074_0002190_12554_13081 174
375 3300049590 Ga0501074_0099204 Ga0501074_0099204_673_1200 174
376 3300049590 Ga0501074_0313519 Ga0501074_0313519_180_707 174
377 3300049590 Ga0501074_0683480 Ga0501074_0683480_136_663 174
378 3300049591 Ga0501075_0111828 Ga0501075_0111828_1067_1594 174
379 3300049593 Ga0501077_0066569 Ga0501077_0066569_1142_1669 174
380 3300049741 Ga0501079_0602782 Ga0501079_0602782_248_775 174
381 3300049742 Ga0501080_0011811 Ga0501080_0011811_4136_4663 174
382 3300049742 Ga0501080_0037253 Ga0501080_0037253_32_559 174
383 3300049742 Ga0501080_0461965 Ga0501080_0461965_473_1000 174
384 3300049742 Ga0501080_1043679 Ga0501080_1043679_29_556 174
385 3300049743 Ga0501081_0161365 Ga0501081_0161365_884_1426 174
386 3300049743 Ga0501081_1012860 Ga0501081_1012860_90_617 174
387 3300049744 Ga0501083_0089384 Ga0501083_0089384_1467_1994 174
388 3300049822 Ga0501035_0091395 Ga0501035_0091395_181_723 174
389 3300049822 Ga0501035_0198800 Ga0501035_0198800_69_596 174
390 3300049822 Ga0501035_0285221 Ga0501035_0285221_237_764 174
391 3300049822 Ga0501035_0320392 Ga0501035_0320392_225_752 174
392 3300049822 Ga0501035_0820568 Ga0501035_0820568_181_723 174
393 3300049822 Ga0501035_1003025 Ga0501035_1003025_42_569 174
394 3300049823 Ga0501044_0180597 Ga0501044_0180597_32_559 174
395 3300049823 Ga0501044_0599058 Ga0501044_0599058_303_845 174
396 3300049823 Ga0501044_0692539 Ga0501044_0692539_21_551 174
397 3300049824 Ga0501045_0142555 Ga0501045_0142555_35_562 174
398 3300050490 nmdc:mga03n38_10355_c1 nmdc:mga03n38_10355_c1_1500_2027 174
399 3300050490 nmdc:mga03n38_127953_c1 nmdc:mga03n38_127953_c1_604_1131 174
400 3300050490 nmdc:mga03n38_476443_c1 nmdc:mga03n38_476443_c1_129_656 174
401 3300050490 nmdc:mga03n38_98920_c1 nmdc:mga03n38_98920_c1_404_931 174
402 3300050491 nmdc:mga00v17_107307_c1 nmdc:mga00v17_107307_c1_645_1172 174
403 3300050491 nmdc:mga00v17_11327_c1 nmdc:mga00v17_11327_c1_1516_2043 174
404 3300050491 nmdc:mga00v17_205502_c1 nmdc:mga00v17_205502_c1_30_557 174
405 3300050491 nmdc:mga00v17_35957_c1 nmdc:mga00v17_35957_c1_1275_1802 174
406 3300050491 nmdc:mga00v17_36907_c1 nmdc:mga00v17_36907_c1_2281_2808 174
407 3300050491 nmdc:mga00v17_57250_c1 nmdc:mga00v17_57250_c1_193_720 174
408 3300050491 nmdc:mga00v17_58933_c1 nmdc:mga00v17_58933_c1_513_1040 174
409 3300050491 nmdc:mga00v17_93500_c1 nmdc:mga00v17_93500_c1_1194_1721 174
410 3300050492 nmdc:mga0yw44_115899_c1 nmdc:mga0yw44_115899_c1_54_581 174
411 3300050492 nmdc:mga0yw44_170838_c1 nmdc:mga0yw44_170838_c1_153_680 174
412 3300050492 nmdc:mga0yw44_174985_c1 nmdc:mga0yw44_174985_c1_69_596 174
413 3300050492 nmdc:mga0yw44_197894_c1 nmdc:mga0yw44_197894_c1_148_675 174
414 3300050492 nmdc:mga0yw44_2650_c1 nmdc:mga0yw44_2650_c1_4443_4970 174
415 3300050492 nmdc:mga0yw44_320121_c1 nmdc:mga0yw44_320121_c1_36_563 174
416 3300050492 nmdc:mga0yw44_36221_c1 nmdc:mga0yw44_36221_c1_1171_1698 174
417 3300050492 nmdc:mga0yw44_422433_c1 nmdc:mga0yw44_422433_c1_338_865 174
418 3300050492 nmdc:mga0yw44_485903_c1 nmdc:mga0yw44_485903_c1_283_810 174
419 3300050492 nmdc:mga0yw44_58129_c1 nmdc:mga0yw44_58129_c1_153_683 174
420 3300050492 nmdc:mga0yw44_72688_c1 nmdc:mga0yw44_72688_c1_1043_1570 174
421 3300050494 nmdc:mga06z11_51666_c1 nmdc:mga06z11_51666_c1_129_656 174
422 3300050494 nmdc:mga06z11_671691_c1 nmdc:mga06z11_671691_c1_52_579 174
423 3300050495 nmdc:mga04h51_9778_c1 nmdc:mga04h51_9778_c1_85_612 174
424 3300050496 nmdc:mga07m45_13123_c1 nmdc:mga07m45_13123_c1_988_1521 174
425 3300050496 nmdc:mga07m45_411900_c1 nmdc:mga07m45_411900_c1_59_586 174
426 3300050507 nmdc:mga05p37_354755_c1 nmdc:mga05p37_354755_c1_711_1253 174
427 3300050508 nmdc:mga09592_126863_c1 nmdc:mga09592_126863_c1_1036_1578 174
428 3300050510 nmdc:mga06r32_436609_c1 nmdc:mga06r32_436609_c1_112_654 174
429 3300050511 nmdc:mga08y16_285921_c1 nmdc:mga08y16_285921_c1_362_889 174
430 3300050514 nmdc:mga08x19_795893_c1 nmdc:mga08x19_795893_c1_43_570 174
431 3300053088 Ga0500644_0000541 Ga0500644_0000541_2943_3584 174
432 3300053104 Ga0500556_0000971 Ga0500556_0000971_11209_11736 174
433 3300053117 Ga0500593_000263 Ga0500593_000263_10331_10858 174
434 3300053140 Ga0500573_0140908 Ga0500573_0140908_115_642 174
435 3300054114 Ga0501084_0130651 Ga0501084_0130651_546_1073 174
436 3300060353 Ga0501082_0136066 Ga0501082_0136066_730_1257 174
437 3300060353 Ga0501082_0446795 Ga0501082_0446795_368_895 174
438 3300061719 Ga0466962_0007072 Ga0466962_0007072_4053_4580 174
439 3300061719 Ga0466962_0026294 Ga0466962_0026294_2185_2712 174
440 3300061719 Ga0466962_0141516 Ga0466962_0141516_483_1013 174
441 3300061734 Ga0530510_0108532 Ga0530510_0108532_1133_1660 174
442 3300061734 Ga0530510_0374807 Ga0530510_0374807_335_862 174
443 3300013105 Ga0157369_10259292 Ga0157369_102592921 175
444 3300020070 Ga0206356_10740864 Ga0206356_107408642 175
445 3300001989 JGI24739J22299_10043520 JGI24739J22299_100435202 176
446 3300005578 Ga0068854_100593710 Ga0068854_1005937102 176
447 3300005614 Ga0068856_100319106 Ga0068856_1003191062 176
448 3300005618 Ga0068864_101328562 Ga0068864_1013285622 176
449 3300009094 Ga0111539_10901690 Ga0111539_109016902 176
450 3300009553 Ga0105249_10590125 Ga0105249_105901252 176
451 3300025942 Ga0207689_11140273 Ga0207689_111402731 176
452 3300025981 Ga0207640_10909465 Ga0207640_109094651 176
453 3300026067 Ga0207678_10417362 Ga0207678_104173622 176
454 3300032002 Ga0307416_101729349 Ga0307416_1017293491 176
455 3300032126 Ga0307415_100509052 Ga0307415_1005090522 176
456 3300032126 Ga0307415_100767740 Ga0307415_1007677401 176
457 3300042007 Ga0439449_0071243 Ga0439449_0071243_137_667 176
458 3300046453 Ga0495627_055031 Ga0495627_055031_94_624 176
459 3300046492 Ga0495585_0112815 Ga0495585_0112815_210_740 176
460 3300050511 nmdc:mga08y16_1044008_c1 nmdc:mga08y16_1044008_c1_193_723 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

67

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.968 8 174
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9639 20 173
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9617 20 173
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.9603 19 174
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9263 20 173
ID Description Score Start End Superfamily
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9659 8 174 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9619 19 174 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9443 22 170 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9175 8 174 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9103 19 174 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A4Q4CZU4-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9829 30 173
AF-C0W0I7-F1-model_v4 Raf-like protein 0.9824 5 175
AF-W1VB69-F1-model_v4 PBP family phospholipid-binding protein 0.9811 34 176
AF-C0W383-F1-model_v4 Raf-like protein 0.9804 3 175
AF-A0A838P262-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9798 16 173

Feature Viewer

pLDDT pTM Quality
94.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map