F448635

General Info

Members Datasets Scaffolds Average Seq Length
460 282 920 135

Family's Representative Sequence

Representative Sequence 3300053140|Ga0500573_0000010|Ga0500573_0000010_187147_187593
Length 148
Sequence MQMRKSVPVVAALCAAAVTLGGCGSSMLDRKRPDEFAVSRQAPLVIPPDFALVPPQPGAPRPQERGAANQALDALFGGTAPRSASEAAAIDAAGPASAETGVRSAVGSPTTIVVDKGATTRDIVAAPEGDGQNASAGTAPAPVATPKP

Samples

Sample ID Description Type Environment
1 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
197 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
198 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
213 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
220 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
221 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
222 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
223 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
236 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
243 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
249 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
252 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
253 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
254 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
255 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
256 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
257 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
258 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
259 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
260 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
261 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
262 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
263 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
264 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
265 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
266 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
267 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
268 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
269 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
270 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
271 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
272 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
273 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
274 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
275 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
276 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
277 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
278 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
279 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
280 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
281 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
282 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 0.22
Isolates 6.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.35
Nodule 0.43
Rhizoplane 5.43
Rhizosphere 65.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500573_0000010 3300053140 Bacteria 210704
2 RicEn_FSXC54424_g1 2010549000 Bacteria 772
3 JGI24736J21556_1012762 3300001904 Bacteria 1359
4 JGI24741J21665_1000730 3300001915 Bacteria 9879
5 JGI24740J21852_10002532 3300001979 Bacteria 8249
6 JGI24739J22299_10011558 3300001989 Bacteria 3259
7 JGI24737J22298_10006085 3300001990 Bacteria 4135
8 JGI24735J21928_10004126 3300002067 Bacteria 4906
9 JGI24748J21848_1001527 3300002074 Bacteria 2567
10 JGI24738J21930_10002541 3300002075 Bacteria 4738
11 JGI25150J39212_1000190 3300002774 Bacteria 34736
12 JGI25150J39212_1000425 3300002774 Bacteria 19316
13 JGI25151J46595_10016760 3300003187 Bacteria 3196
14 JGI25153J46596_10000348 3300003215 Bacteria 32190
15 rootH2_10073486 3300003320 Bacteria 1303
16 Ga0055537_1010487 3300003773 Bacteria 1951
17 Ga0055536_1003883 3300003781 Bacteria 7854
18 Ga0055536_1016756 3300003781 Bacteria 2434
19 Ga0055536_1019218 3300003781 Bacteria 2157
20 Ga0055528_1062191 3300003790 Bacteria 701
21 Ga0055530_10000048 3300003791 Bacteria 107993
22 Ga0055530_10001208 3300003791 Bacteria 19993
23 Ga0055530_10010943 3300003791 Bacteria 3298
24 Ga0055540_1003141 3300003792 Bacteria 8172
25 Ga0055531_10000792 3300003794 Bacteria 26275
26 Ga0055531_10002519 3300003794 Bacteria 12205
27 Ga0065704_10010812 3300005289 Bacteria 5769
28 Ga0065704_10072415 3300005289 Bacteria 8563
29 Ga0065707_10118015 3300005295 Bacteria 2180
30 Ga0065707_10248718 3300005295 Bacteria 1132
31 Ga0070658_10459474 3300005327 Bacteria 1098
32 Ga0070670_100084786 3300005331 Bacteria 2722
33 Ga0070670_100285946 3300005331 Bacteria 1440
34 Ga0070666_10003875 3300005335 Bacteria 9086
35 Ga0070666_11058404 3300005335 Bacteria 602
36 Ga0070661_100095009 3300005344 Bacteria 2210
37 Ga0070668_100000172 3300005347 Bacteria 41511
38 Ga0070668_100001061 3300005347 Bacteria 19338
39 Ga0070669_100000061 3300005353 Bacteria 107718
40 Ga0070669_100016475 3300005353 Bacteria 5274
41 Ga0070669_100160117 3300005353 Bacteria 1748
42 Ga0070669_100310387 3300005353 Bacteria 1271
43 Ga0070671_100000831 3300005355 Bacteria 22418
44 Ga0070671_100025782 3300005355 Bacteria 4827
45 Ga0070659_100182135 3300005366 Bacteria 1724
46 Ga0070659_101108100 3300005366 Bacteria 698
47 Ga0070667_100000199 3300005367 Bacteria 71115
48 Ga0070667_100000276 3300005367 Bacteria 58397
49 Ga0070667_101190741 3300005367 Bacteria 713
50 Ga0070667_101348601 3300005367 Bacteria 669
51 Ga0070685_10027002 3300005466 Bacteria 3169
52 Ga0070679_100252475 3300005530 Bacteria 1720
53 Ga0068853_101711658 3300005539 Bacteria 609
54 Ga0070665_100000871 3300005548 Bacteria 38979
55 Ga0070665_100723913 3300005548 Bacteria 1008
56 Ga0068855_101309686 3300005563 Bacteria 749
57 Ga0070664_100039868 3300005564 Bacteria 3959
58 Ga0068857_100090470 3300005577 Bacteria 2739
59 Ga0068857_100385329 3300005577 Bacteria 1302
60 Ga0068857_100404759 3300005577 Bacteria 1270
61 Ga0068854_100037417 3300005578 Bacteria 3406
62 Ga0068854_100043538 3300005578 Bacteria 3183
63 Ga0068854_100668976 3300005578 Bacteria 893
64 Ga0068856_100013370 3300005614 Bacteria 7946
65 Ga0068859_100168036 3300005617 Bacteria 2273
66 Ga0068864_100084838 3300005618 Bacteria 2784
67 Ga0068861_100000032 3300005719 Bacteria 66248
68 Ga0068863_100000029 3300005841 Bacteria 177191
69 Ga0068863_100327848 3300005841 Bacteria 1488
70 Ga0068863_101638012 3300005841 Bacteria 653
71 Ga0068858_100094815 3300005842 Bacteria 2780
72 Ga0068858_100166234 3300005842 Bacteria 2079
73 Ga0068860_100015574 3300005843 Bacteria 7426
74 Ga0068860_100157202 3300005843 Bacteria 2191
75 Ga0068862_101421116 3300005844 Bacteria 697
76 Ga0075363_100017281 3300006048 Bacteria 3575
77 Ga0075362_10012700 3300006177 Bacteria 3352
78 Ga0075367_10011496 3300006178 Bacteria 4688
79 Ga0075370_10172517 3300006353 Bacteria 1271
80 Ga0097620_100168044 3300006931 Bacteria 2273
81 Ga0079104_1048589 3300006946 Bacteria 955
82 Ga0105251_10009219 3300009011 Bacteria 5850
83 Ga0105240_10246848 3300009093 Bacteria 2067
84 Ga0105247_10049847 3300009101 Bacteria 2576
85 Ga0114129_10471338 3300009147 Bacteria 1644
86 Ga0114129_11522477 3300009147 Bacteria 821
87 Ga0105241_10004454 3300009174 Bacteria 10359
88 Ga0105248_10000237 3300009177 Bacteria 63727
89 Ga0105248_10012241 3300009177 Bacteria 9460
90 Ga0105248_10250223 3300009177 Bacteria 1995
91 Ga0105237_10128555 3300009545 Bacteria 2528
92 Ga0105237_10376948 3300009545 Bacteria 1423
93 Ga0105238_10234165 3300009551 Bacteria 1813
94 Ga0105238_10642853 3300009551 Bacteria 1070
95 Ga0105249_10351033 3300009553 Bacteria 1494
96 Ga0105148_100240 3300009978 Bacteria 7627
97 Ga0105239_10434255 3300010375 Bacteria 1488
98 Ga0105239_10666176 3300010375 Bacteria 1189
99 Ga0157371_10665578 3300013102 Bacteria 778
100 Ga0157370_10036561 3300013104 Bacteria 4764
101 Ga0157370_10044495 3300013104 Bacteria 4266
102 Ga0157369_10562171 3300013105 Bacteria 1178
103 Ga0157369_11143464 3300013105 Bacteria 795
104 Ga0157374_10139024 3300013296 Bacteria 2357
105 Ga0163162_10026139 3300013306 Bacteria 5769
106 Ga0157372_11606682 3300013307 Bacteria 748
107 Ga0157380_10020251 3300014326 Bacteria 4972
108 Ga0157380_10144017 3300014326 Bacteria 2051
109 Ga0157379_10041698 3300014968 Bacteria 4097
110 Ga0183363_1002 3300015690 Bacteria 425040
111 Ga0163161_10034832 3300017792 Bacteria 3602
112 Ga0209147_102003 3300025229 Bacteria 5888
113 Ga0207425_1000025 3300025245 Bacteria 321872
114 Ga0209129_1002185 3300025258 Bacteria 9839
115 Ga0209565_1000121 3300025263 Bacteria 111264
116 Ga0209673_1030799 3300025273 Bacteria 1682
117 Ga0209675_1000181 3300025291 Bacteria 71490
118 Ga0209676_1000084 3300025292 Bacteria 274330
119 Ga0209676_1000113 3300025292 Bacteria 207931
120 Ga0209676_1001894 3300025292 Bacteria 17064
121 Ga0209676_1019559 3300025292 Bacteria 2328
122 Ga0209025_1001013 3300025294 Bacteria 41356
123 Ga0209025_1006722 3300025294 Bacteria 8821
124 Ga0209025_1087538 3300025294 Bacteria 1031
125 Ga0209564_1004531 3300025295 Bacteria 8444
126 Ga0209758_1000002 3300025297 Bacteria 1400310
127 Ga0209758_1000108 3300025297 Bacteria 216541
128 Ga0209758_1103835 3300025297 Bacteria 801
129 Ga0209050_1000001 3300025298 Bacteria 3563507
130 Ga0209050_1000071 3300025298 Bacteria 295478
131 Ga0209050_1000126 3300025298 Bacteria 188438
132 Ga0207426_1011718 3300025302 Bacteria 3323
133 Ga0209051_1002730 3300025303 Bacteria 12250
134 Ga0209257_1000027 3300025304 Bacteria 703541
135 Ga0209257_1000083 3300025304 Bacteria 296207
136 Ga0209257_1000113 3300025304 Bacteria 233523
137 Ga0209257_1002052 3300025304 Bacteria 21376
138 Ga0209257_1044055 3300025304 Bacteria 1304
139 Ga0207656_10226376 3300025321 Bacteria 910
140 Ga0207696_1007829 3300025711 Bacteria 4142
141 Ga0207713_1009984 3300025735 Bacteria 5299
142 Ga0207710_10128137 3300025900 Bacteria 1217
143 Ga0207680_10001224 3300025903 Bacteria 12130
144 Ga0207647_10063505 3300025904 Bacteria 2246
145 Ga0207705_10557952 3300025909 Bacteria 890
146 Ga0207654_10010124 3300025911 Bacteria 4797
147 Ga0207695_10092090 3300025913 Bacteria 3043
148 Ga0207671_10023838 3300025914 Bacteria 4610
149 Ga0207671_10059820 3300025914 Bacteria 2826
150 Ga0207657_10022579 3300025919 Bacteria 5883
151 Ga0207649_10165359 3300025920 Bacteria 1536
152 Ga0207681_10000019 3300025923 Bacteria 243902
153 Ga0207681_10011936 3300025923 Bacteria 5351
154 Ga0207681_10113655 3300025923 Bacteria 1974
155 Ga0207681_10209948 3300025923 Bacteria 1500
156 Ga0207681_11189225 3300025923 Bacteria 640
157 Ga0207694_10128516 3300025924 Bacteria 2029
158 Ga0207650_10156836 3300025925 Bacteria 1800
159 Ga0207650_10240499 3300025925 Bacteria 1463
160 Ga0207644_10000832 3300025931 Bacteria 19608
161 Ga0207644_10005000 3300025931 Bacteria 8654
162 Ga0207690_10138857 3300025932 Bacteria 1788
163 Ga0207690_10613777 3300025932 Bacteria 889
164 Ga0207706_10066435 3300025933 Bacteria 3174
165 Ga0207711_10038862 3300025941 Bacteria 4046
166 Ga0207679_10439260 3300025945 Bacteria 1155
167 Ga0207712_10233247 3300025961 Bacteria 1478
168 Ga0207668_10000700 3300025972 Bacteria 20551
169 Ga0207668_10004005 3300025972 Bacteria 8676
170 Ga0207668_10007679 3300025972 Bacteria 6418
171 Ga0207640_10017104 3300025981 Bacteria 4235
172 Ga0207640_10029993 3300025981 Bacteria 3346
173 Ga0207640_10067592 3300025981 Bacteria 2392
174 Ga0207640_10104365 3300025981 Bacteria 1995
175 Ga0207640_10937041 3300025981 Bacteria 758
176 Ga0207658_10000159 3300025986 Bacteria 71280
177 Ga0207658_10000262 3300025986 Bacteria 55229
178 Ga0207658_10711567 3300025986 Bacteria 908
179 Ga0207639_10000269 3300026041 Bacteria 37143
180 Ga0207678_10000400 3300026067 Bacteria 39732
181 Ga0207702_10123044 3300026078 Bacteria 2324
182 Ga0207641_10000049 3300026088 Bacteria 177222
183 Ga0207641_10123436 3300026088 Bacteria 2315
184 Ga0207676_10715294 3300026095 Bacteria 971
185 Ga0207674_10045552 3300026116 Bacteria 4511
186 Ga0207674_10082308 3300026116 Bacteria 3220
187 Ga0207674_10408964 3300026116 Bacteria 1311
188 Ga0207674_10420350 3300026116 Bacteria 1292
189 Ga0207675_100000058 3300026118 Bacteria 81487
190 Ga0207698_10013335 3300026142 Bacteria 5418
191 Ga0207698_10386752 3300026142 Bacteria 1333
192 Ga0209281_1055324 3300027111 Bacteria 620
193 Ga0209813_10000052 3300027866 Bacteria 47473
194 Ga0268266_10000675 3300028379 Bacteria 46130
195 Ga0268266_10443026 3300028379 Bacteria 1234
196 Ga0268264_10012973 3300028381 Bacteria 6851
197 Ga0268264_10077984 3300028381 Bacteria 2823
198 Ga0316182_1229157 3300030745 Bacteria 786
199 Ga0307513_10515362 3300031456 Bacteria 912
200 Ga0307408_100021631 3300031548 Bacteria 4356
201 Ga0307408_100046926 3300031548 Bacteria 3091
202 Ga0307408_100120760 3300031548 Bacteria 2029
203 Ga0307408_100486579 3300031548 Bacteria 1077
204 Ga0307408_101703125 3300031548 Bacteria 601
205 Ga0307405_10002430 3300031731 Bacteria 8203
206 Ga0307405_10013597 3300031731 Bacteria 4346
207 Ga0307405_10086469 3300031731 Bacteria 2064
208 Ga0307405_10150079 3300031731 Bacteria 1637
209 Ga0307405_10980499 3300031731 Bacteria 720
210 Ga0307413_10030771 3300031824 Bacteria 3019
211 Ga0307413_10044975 3300031824 Bacteria 2613
212 Ga0307413_10096119 3300031824 Bacteria 1944
213 Ga0307413_10464918 3300031824 Bacteria 1007
214 Ga0307413_10797643 3300031824 Bacteria 793
215 Ga0307413_10977263 3300031824 Bacteria 724
216 Ga0307410_10013871 3300031852 Bacteria 4719
217 Ga0307410_10022337 3300031852 Bacteria 3908
218 Ga0307410_10664099 3300031852 Bacteria 875
219 Ga0307406_10073729 3300031901 Bacteria 2246
220 Ga0307406_10111207 3300031901 Bacteria 1886
221 Ga0307406_10376772 3300031901 Bacteria 1117
222 Ga0307406_10378635 3300031901 Bacteria 1115
223 Ga0307406_10533620 3300031901 Bacteria 957
224 Ga0307407_10047199 3300031903 Bacteria 2442
225 Ga0307407_10195318 3300031903 Bacteria 1352
226 Ga0307412_10001328 3300031911 Bacteria 13834
227 Ga0307412_10004178 3300031911 Bacteria 8051
228 Ga0307412_10009752 3300031911 Bacteria 5514
229 Ga0307412_10009800 3300031911 Bacteria 5500
230 Ga0307412_10056486 3300031911 Bacteria 2616
231 Ga0307412_10360277 3300031911 Bacteria 1171
232 Ga0307412_10384409 3300031911 Bacteria 1137
233 Ga0307412_11335879 3300031911 Bacteria 646
234 Ga0307409_100051257 3300031995 Bacteria 3157
235 Ga0307409_100115487 3300031995 Bacteria 2260
236 Ga0307409_100316179 3300031995 Bacteria 1459
237 Ga0307409_100830889 3300031995 Bacteria 933
238 Ga0307416_100022767 3300032002 Bacteria 4531
239 Ga0307416_100031777 3300032002 Bacteria 3979
240 Ga0307416_100268726 3300032002 Bacteria 1672
241 Ga0307416_101165861 3300032002 Bacteria 876
242 Ga0307414_10001410 3300032004 Bacteria 12474
243 Ga0307414_10027160 3300032004 Bacteria 3695
244 Ga0307414_10045248 3300032004 Bacteria 3013
245 Ga0307414_10160462 3300032004 Bacteria 1785
246 Ga0307414_10358783 3300032004 Bacteria 1253
247 Ga0307414_10361523 3300032004 Bacteria 1249
248 Ga0307414_10406018 3300032004 Bacteria 1184
249 Ga0307414_11021879 3300032004 Bacteria 761
250 Ga0307414_12131953 3300032004 Bacteria 523
251 Ga0307411_10008897 3300032005 Bacteria 5238
252 Ga0307411_10091931 3300032005 Bacteria 2121
253 Ga0307411_10449634 3300032005 Bacteria 1077
254 Ga0307411_11426683 3300032005 Bacteria 634
255 Ga0307415_100228636 3300032126 Bacteria 1496
256 Ga0307415_100265507 3300032126 Bacteria 1403
257 Ga0395905_1157833 3300037471 Bacteria 677
258 Ga0436364_1510842 3300037853 Bacteria 1025
259 Ga0495617_058517 3300046452 Bacteria 1277
260 Ga0495627_000089 3300046453 Bacteria 110113
261 Ga0495627_000108 3300046453 Bacteria 102455
262 Ga0495638_0000012 3300046460 Bacteria 435577
263 Ga0495638_0001432 3300046460 Bacteria 21598
264 Ga0495650_0002268 3300046471 Bacteria 16025
265 Ga0495605_0143894 3300046474 Bacteria 1068
266 Ga0495584_0018681 3300046491 Bacteria 3524
267 Ga0495583_0001229 3300046506 Bacteria 27263
268 Ga0495610_0000662 3300046512 Bacteria 33529
269 Ga0495610_0131428 3300046512 Bacteria 1086
270 Ga0495616_0000030 3300046513 Bacteria 132950
271 Ga0495631_0341515 3300046518 Bacteria 637
272 Ga0495632_0000001 3300046519 Bacteria 873295
273 Ga0495632_0015570 3300046519 Bacteria 4255
274 Ga0495637_0000330 3300046520 Bacteria 36746
275 Ga0495643_0000020 3300046522 Bacteria 294973
276 Ga0495643_0033742 3300046522 Bacteria 2829
277 Ga0495648_0000295 3300046524 Bacteria 55574
278 Ga0495648_0015712 3300046524 Bacteria 5483
279 Ga0495648_0063733 3300046524 Bacteria 2175
280 Ga0495648_0082605 3300046524 Bacteria 1823
281 Ga0495663_0000002 3300046525 Bacteria 495384
282 Ga0495654_0050246 3300046530 Bacteria 2039
283 Ga0495633_0000213 3300046558 Bacteria 72710
284 Ga0495633_0000544 3300046558 Bacteria 37513
285 Ga0495633_0246756 3300046558 Bacteria 815
286 Ga0495668_0000004 3300046616 Bacteria 574236
287 Ga0495668_0109445 3300046616 Bacteria 1511
288 Ga0495625_0003158 3300046660 Bacteria 16785
289 Ga0495661_0021514 3300046665 Bacteria 4205
290 Ga0495670_0016526 3300046691 Bacteria 3628
291 Ga0495670_0111955 3300046691 Bacteria 1413
292 Ga0495671_0000016 3300046692 Bacteria 294821
293 Ga0495671_0000111 3300046692 Bacteria 72744
294 Ga0495660_0308922 3300046810 Bacteria 714
295 Ga0495687_123316 3300047443 Bacteria 931
296 Ga0495673_0000013 3300047469 Bacteria 612902
297 Ga0495673_0216721 3300047469 Bacteria 710
298 Ga0495681_0000129 3300047470 Bacteria 66033
299 Ga0495681_0008782 3300047470 Bacteria 6297
300 Ga0495686_0022507 3300047472 Bacteria 4171
301 Ga0496100_0041237 3300048903 Bacteria 2941
302 Ga0496100_0707995 3300048903 Bacteria 786
303 Ga0496101_0367289 3300048904 Bacteria 1131
304 Ga0496102_0000634 3300048905 Bacteria 35771
305 Ga0496102_0470993 3300048905 Bacteria 1177
306 Ga0496103_0000269 3300048906 Bacteria 49279
307 Ga0496103_0671211 3300048906 Bacteria 658
308 Ga0496104_0001869 3300048907 Bacteria 18228
309 Ga0496105_0000758 3300048908 Bacteria 21934
310 Ga0496107_0225903 3300048910 Bacteria 1393
311 Ga0496108_0038101 3300048911 Bacteria 4005
312 Ga0496109_0053131 3300048912 Bacteria 3694
313 Ga0496110_0028721 3300048913 Bacteria 4779
314 Ga0496110_0155877 3300048913 Bacteria 2069
315 Ga0496111_0094156 3300048914 Bacteria 2197
316 Ga0496111_0097329 3300048914 Bacteria 2160
317 Ga0496111_0126061 3300048914 Bacteria 1893
318 Ga0496112_0015609 3300048915 Bacteria 7092
319 Ga0496113_0001136 3300048916 Bacteria 14474
320 Ga0496113_0075024 3300048916 Bacteria 2580
321 Ga0496114_1727913 3300048917 Bacteria 514
322 Ga0496115_0000534 3300048918 Bacteria 29632
323 Ga0496115_0111840 3300048918 Bacteria 2244
324 Ga0496117_0058786 3300048920 Bacteria 2660
325 Ga0496118_0085299 3300048921 Bacteria 2199
326 Ga0496119_0001886 3300048922 Bacteria 24141
327 Ga0496120_0003916 3300048923 Bacteria 12992
328 Ga0496120_0332961 3300048923 Bacteria 686
329 Ga0496121_0046485 3300048924 Bacteria 3714
330 Ga0496121_0150771 3300048924 Bacteria 1711
331 Ga0496121_0201930 3300048924 Bacteria 1416
332 Ga0496122_0002825 3300048925 Bacteria 23803
333 Ga0496122_0008867 3300048925 Bacteria 10729
334 Ga0496122_0347880 3300048925 Bacteria 775
335 Ga0496123_0002804 3300048926 Bacteria 20694
336 Ga0496123_0004578 3300048926 Bacteria 14408
337 Ga0496123_0222130 3300048926 Bacteria 952
338 Ga0496124_0000889 3300048927 Bacteria 48520
339 Ga0496124_0012060 3300048927 Bacteria 8580
340 Ga0496124_0022883 3300048927 Bacteria 5720
341 Ga0496124_0199810 3300048927 Bacteria 1521
342 Ga0496125_0001515 3300048928 Bacteria 33290
343 Ga0496125_0010999 3300048928 Bacteria 9084
344 Ga0496125_0085874 3300048928 Bacteria 2382
345 Ga0496126_0000051 3300048929 Bacteria 313169
346 Ga0496126_0024571 3300048929 Bacteria 5814
347 Ga0496126_0068438 3300048929 Bacteria 3170
348 Ga0495678_045012 3300049459 Bacteria 1743
349 Ga0501290_000084 3300049513 Bacteria 13312
350 Ga0501292_000041 3300049515 Bacteria 30091
351 Ga0501294_000714 3300049517 Bacteria 3694
352 Ga0501297_066267 3300049520 Bacteria 562
353 Ga0501317_016375 3300049533 Bacteria 961
354 Ga0501032_0189977 3300049569 Bacteria 1342
355 Ga0501032_0488150 3300049569 Bacteria 788
356 Ga0501032_0868052 3300049569 Bacteria 569
357 Ga0501033_0011138 3300049570 Bacteria 6889
358 Ga0501033_0509657 3300049570 Bacteria 832
359 Ga0501034_0074993 3300049571 Bacteria 3390
360 Ga0501036_0023441 3300049572 Bacteria 5200
361 Ga0501037_0101081 3300049573 Bacteria 2081
362 Ga0501038_0026092 3300049574 Bacteria 5204
363 Ga0501039_0120903 3300049575 Bacteria 2052
364 Ga0501043_0584032 3300049579 Bacteria 827
365 Ga0501046_0228940 3300049580 Bacteria 1374
366 Ga0501047_0158760 3300049581 Bacteria 2133
367 Ga0501047_0304542 3300049581 Bacteria 1435
368 Ga0501047_0334698 3300049581 Bacteria 1352
369 Ga0501071_0116604 3300049587 Bacteria 1977
370 Ga0501206_003163 3300049653 Bacteria 2092
371 Ga0501207_008786 3300049654 Bacteria 1466
372 Ga0501222_004541 3300049662 Bacteria 1885
373 Ga0501223_000315 3300049663 Bacteria 12017
374 Ga0501224_004290 3300049664 Bacteria 2020
375 Ga0501233_183838 3300049668 Bacteria 600
376 Ga0501235_010300 3300049669 Bacteria 2044
377 Ga0501235_012211 3300049669 Bacteria 1888
378 Ga0501259_000236 3300049688 Bacteria 8594
379 Ga0501225_0006125 3300049705 Bacteria 3513
380 Ga0501225_0011594 3300049705 Bacteria 2479
381 Ga0501245_002567 3300049708 Bacteria 2432
382 Ga0501279_000094 3300049775 Bacteria 14206
383 Ga0501280_000113 3300049776 Bacteria 21120
384 Ga0501282_000040 3300049778 Bacteria 17093
385 Ga0501283_070696 3300049779 Bacteria 643
386 Ga0501044_0115758 3300049823 Bacteria 2686
387 Ga0501044_0525387 3300049823 Bacteria 1083
388 nmdc:mga0yw44_915557_c1 3300050492 Bacteria 594
389 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
390 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
391 nmdc:mga07m45_176286_c1 3300050496 Bacteria 1243
392 nmdc:mga05p37_357031_c1 3300050507 Bacteria 1719
393 nmdc:mga05p37_471117_c1 3300050507 Bacteria 1449
394 Ga0500643_000151 3300053087 Bacteria 70674
395 Ga0500643_000201 3300053087 Bacteria 56872
396 Ga0500647_0060814 3300053091 Bacteria 1818
397 Ga0500651_0265446 3300053093 Bacteria 994
398 Ga0500555_050093 3300053103 Bacteria 1144
399 Ga0500562_001370 3300053108 Bacteria 6011
400 Ga0500562_109960 3300053108 Bacteria 751
401 Ga0500592_000124 3300053116 Bacteria 16659
402 Ga0500607_000023 3300053121 Bacteria 97892
403 Ga0500607_168959 3300053121 Bacteria 988
404 Ga0500608_000160 3300053122 Bacteria 28018
405 Ga0500618_048625 3300053125 Bacteria 963
406 Ga0500559_0000956 3300053136 Bacteria 18146
407 Ga0500559_0003080 3300053136 Bacteria 8322
408 Ga0500559_0006356 3300053136 Bacteria 5336
409 Ga0500559_0097403 3300053136 Bacteria 1352
410 Ga0500564_009112 3300053138 Bacteria 4302
411 Ga0500564_128765 3300053138 Bacteria 1097
412 Ga0500568_0011135 3300053139 Bacteria 4189
413 Ga0500568_0013275 3300053139 Bacteria 3758
414 Ga0500573_0215184 3300053140 Bacteria 1011
415 Ga0500590_001414 3300053148 Bacteria 9859
416 Ga0500590_100784 3300053148 Bacteria 1387
417 Ga0500604_0009545 3300053151 Bacteria 2586
418 Ga0500604_0045603 3300053151 Bacteria 1338
419 Ga0500616_0018851 3300053153 Bacteria 3898
420 Ga0500616_0175039 3300053153 Bacteria 971
421 Ga0500624_000068 3300053157 Bacteria 61139
422 Ga0500627_0000021 3300053158 Bacteria 108539
423 Ga0500627_0000158 3300053158 Bacteria 20062
424 Ga0500627_0000233 3300053158 Bacteria 15825
425 Ga0500637_0001524 3300053178 Bacteria 9884
426 Ga0500567_002667 3300053723 Bacteria 7725
427 Ga0500625_000025 3300053729 Bacteria 63535
428 Ga0500645_001036 3300053730 Bacteria 15569
429 Ga0500661_002057 3300055283 Bacteria 3799
430 2512642722 2512564014 Bacteria 4639632
431 2600201309 2599185354 Bacteria 4398675
432 2600228430 2599185359 Bacteria 4772316
433 2643819455 2643221560 Bacteria 4801179
434 2643836184 2643221563 Bacteria 4726935
435 2644052661 2643221608 Bacteria 4724829
436 2738710676 2738541275 Bacteria 4830863
437 2738849101 2738541301 Bacteria 4834102
438 2738864830 2738541304 Bacteria 4833665
439 2739297348 2738543022 Bacteria 4835059
440 2739359026 2738543033 Bacteria 4833336
441 2739651223 2739367664 Bacteria 4114334
442 2740029696 2739367865 Bacteria 4114482
443 2753767453 2751185897 Bacteria 5322941
444 2778124447 2775507255 Bacteria 3945731
445 2809061818 2808606401 Bacteria 4586670
446 2809077782 2808606404 Bacteria 4652788
447 2809082510 2808606405 Bacteria 4586632
448 2819715223 2818991466 Bacteria 4748179
449 2830078783 2830075706 Bacteria 3855215
450 2852653630 2852653556 Bacteria 4050083
451 2852682815 2852680915 Bacteria 4100189
452 2879163161 2879163058 Bacteria 4223965
453 2880519999 2880518877 Bacteria 5012590
454 2885431460 2885429604 Bacteria 3642894
455 2919710550 2919709256 Bacteria 4318106
456 2928100779 2928100450 Bacteria 4837635
457 2928528037 2928526807 Bacteria 4760224
458 2928960842 2928959182 Bacteria 4725774
459 2928971459 2928968154 Bacteria 4633371
460 2946791019 2946787523 Bacteria 4366789
461 Ga0500573_0000010
462 RicEn_FSXC54424_g1
463 JGI24736J21556_1012762
464 JGI24741J21665_1000730
465 JGI24740J21852_10002532
466 JGI24739J22299_10011558
467 JGI24737J22298_10006085
468 JGI24735J21928_10004126
469 JGI24748J21848_1001527
470 JGI24738J21930_10002541
471 JGI25150J39212_1000190
472 JGI25150J39212_1000425
473 JGI25151J46595_10016760
474 JGI25153J46596_10000348
475 rootH2_10073486
476 Ga0055537_1010487
477 Ga0055536_1003883
478 Ga0055536_1016756
479 Ga0055536_1019218
480 Ga0055528_1062191
481 Ga0055530_10000048
482 Ga0055530_10001208
483 Ga0055530_10010943
484 Ga0055540_1003141
485 Ga0055531_10000792
486 Ga0055531_10002519
487 Ga0065704_10010812
488 Ga0065704_10072415
489 Ga0065707_10118015
490 Ga0065707_10248718
491 Ga0070658_10459474
492 Ga0070670_100084786
493 Ga0070670_100285946
494 Ga0070666_10003875
495 Ga0070666_11058404
496 Ga0070661_100095009
497 Ga0070668_100000172
498 Ga0070668_100001061
499 Ga0070669_100000061
500 Ga0070669_100016475
501 Ga0070669_100160117
502 Ga0070669_100310387
503 Ga0070671_100000831
504 Ga0070671_100025782
505 Ga0070659_100182135
506 Ga0070659_101108100
507 Ga0070667_100000199
508 Ga0070667_100000276
509 Ga0070667_101190741
510 Ga0070667_101348601
511 Ga0070685_10027002
512 Ga0070679_100252475
513 Ga0068853_101711658
514 Ga0070665_100000871
515 Ga0070665_100723913
516 Ga0068855_101309686
517 Ga0070664_100039868
518 Ga0068857_100090470
519 Ga0068857_100385329
520 Ga0068857_100404759
521 Ga0068854_100037417
522 Ga0068854_100043538
523 Ga0068854_100668976
524 Ga0068856_100013370
525 Ga0068859_100168036
526 Ga0068864_100084838
527 Ga0068861_100000032
528 Ga0068863_100000029
529 Ga0068863_100327848
530 Ga0068863_101638012
531 Ga0068858_100094815
532 Ga0068858_100166234
533 Ga0068860_100015574
534 Ga0068860_100157202
535 Ga0068862_101421116
536 Ga0075363_100017281
537 Ga0075362_10012700
538 Ga0075367_10011496
539 Ga0075370_10172517
540 Ga0097620_100168044
541 Ga0079104_1048589
542 Ga0105251_10009219
543 Ga0105240_10246848
544 Ga0105247_10049847
545 Ga0114129_10471338
546 Ga0114129_11522477
547 Ga0105241_10004454
548 Ga0105248_10000237
549 Ga0105248_10012241
550 Ga0105248_10250223
551 Ga0105237_10128555
552 Ga0105237_10376948
553 Ga0105238_10234165
554 Ga0105238_10642853
555 Ga0105249_10351033
556 Ga0105148_100240
557 Ga0105239_10434255
558 Ga0105239_10666176
559 Ga0157371_10665578
560 Ga0157370_10036561
561 Ga0157370_10044495
562 Ga0157369_10562171
563 Ga0157369_11143464
564 Ga0157374_10139024
565 Ga0163162_10026139
566 Ga0157372_11606682
567 Ga0157380_10020251
568 Ga0157380_10144017
569 Ga0157379_10041698
570 Ga0183363_1002
571 Ga0163161_10034832
572 Ga0209147_102003
573 Ga0207425_1000025
574 Ga0209129_1002185
575 Ga0209565_1000121
576 Ga0209673_1030799
577 Ga0209675_1000181
578 Ga0209676_1000084
579 Ga0209676_1000113
580 Ga0209676_1001894
581 Ga0209676_1019559
582 Ga0209025_1001013
583 Ga0209025_1006722
584 Ga0209025_1087538
585 Ga0209564_1004531
586 Ga0209758_1000002
587 Ga0209758_1000108
588 Ga0209758_1103835
589 Ga0209050_1000001
590 Ga0209050_1000071
591 Ga0209050_1000126
592 Ga0207426_1011718
593 Ga0209051_1002730
594 Ga0209257_1000027
595 Ga0209257_1000083
596 Ga0209257_1000113
597 Ga0209257_1002052
598 Ga0209257_1044055
599 Ga0207656_10226376
600 Ga0207696_1007829
601 Ga0207713_1009984
602 Ga0207710_10128137
603 Ga0207680_10001224
604 Ga0207647_10063505
605 Ga0207705_10557952
606 Ga0207654_10010124
607 Ga0207695_10092090
608 Ga0207671_10023838
609 Ga0207671_10059820
610 Ga0207657_10022579
611 Ga0207649_10165359
612 Ga0207681_10000019
613 Ga0207681_10011936
614 Ga0207681_10113655
615 Ga0207681_10209948
616 Ga0207681_11189225
617 Ga0207694_10128516
618 Ga0207650_10156836
619 Ga0207650_10240499
620 Ga0207644_10000832
621 Ga0207644_10005000
622 Ga0207690_10138857
623 Ga0207690_10613777
624 Ga0207706_10066435
625 Ga0207711_10038862
626 Ga0207679_10439260
627 Ga0207712_10233247
628 Ga0207668_10000700
629 Ga0207668_10004005
630 Ga0207668_10007679
631 Ga0207640_10017104
632 Ga0207640_10029993
633 Ga0207640_10067592
634 Ga0207640_10104365
635 Ga0207640_10937041
636 Ga0207658_10000159
637 Ga0207658_10000262
638 Ga0207658_10711567
639 Ga0207639_10000269
640 Ga0207678_10000400
641 Ga0207702_10123044
642 Ga0207641_10000049
643 Ga0207641_10123436
644 Ga0207676_10715294
645 Ga0207674_10045552
646 Ga0207674_10082308
647 Ga0207674_10408964
648 Ga0207674_10420350
649 Ga0207675_100000058
650 Ga0207698_10013335
651 Ga0207698_10386752
652 Ga0209281_1055324
653 Ga0209813_10000052
654 Ga0268266_10000675
655 Ga0268266_10443026
656 Ga0268264_10012973
657 Ga0268264_10077984
658 Ga0316182_1229157
659 Ga0307513_10515362
660 Ga0307408_100021631
661 Ga0307408_100046926
662 Ga0307408_100120760
663 Ga0307408_100486579
664 Ga0307408_101703125
665 Ga0307405_10002430
666 Ga0307405_10013597
667 Ga0307405_10086469
668 Ga0307405_10150079
669 Ga0307405_10980499
670 Ga0307413_10030771
671 Ga0307413_10044975
672 Ga0307413_10096119
673 Ga0307413_10464918
674 Ga0307413_10797643
675 Ga0307413_10977263
676 Ga0307410_10013871
677 Ga0307410_10022337
678 Ga0307410_10664099
679 Ga0307406_10073729
680 Ga0307406_10111207
681 Ga0307406_10376772
682 Ga0307406_10378635
683 Ga0307406_10533620
684 Ga0307407_10047199
685 Ga0307407_10195318
686 Ga0307412_10001328
687 Ga0307412_10004178
688 Ga0307412_10009752
689 Ga0307412_10009800
690 Ga0307412_10056486
691 Ga0307412_10360277
692 Ga0307412_10384409
693 Ga0307412_11335879
694 Ga0307409_100051257
695 Ga0307409_100115487
696 Ga0307409_100316179
697 Ga0307409_100830889
698 Ga0307416_100022767
699 Ga0307416_100031777
700 Ga0307416_100268726
701 Ga0307416_101165861
702 Ga0307414_10001410
703 Ga0307414_10027160
704 Ga0307414_10045248
705 Ga0307414_10160462
706 Ga0307414_10358783
707 Ga0307414_10361523
708 Ga0307414_10406018
709 Ga0307414_11021879
710 Ga0307414_12131953
711 Ga0307411_10008897
712 Ga0307411_10091931
713 Ga0307411_10449634
714 Ga0307411_11426683
715 Ga0307415_100228636
716 Ga0307415_100265507
717 Ga0395905_1157833
718 Ga0436364_1510842
719 Ga0495617_058517
720 Ga0495627_000089
721 Ga0495627_000108
722 Ga0495638_0000012
723 Ga0495638_0001432
724 Ga0495650_0002268
725 Ga0495605_0143894
726 Ga0495584_0018681
727 Ga0495583_0001229
728 Ga0495610_0000662
729 Ga0495610_0131428
730 Ga0495616_0000030
731 Ga0495631_0341515
732 Ga0495632_0000001
733 Ga0495632_0015570
734 Ga0495637_0000330
735 Ga0495643_0000020
736 Ga0495643_0033742
737 Ga0495648_0000295
738 Ga0495648_0015712
739 Ga0495648_0063733
740 Ga0495648_0082605
741 Ga0495663_0000002
742 Ga0495654_0050246
743 Ga0495633_0000213
744 Ga0495633_0000544
745 Ga0495633_0246756
746 Ga0495668_0000004
747 Ga0495668_0109445
748 Ga0495625_0003158
749 Ga0495661_0021514
750 Ga0495670_0016526
751 Ga0495670_0111955
752 Ga0495671_0000016
753 Ga0495671_0000111
754 Ga0495660_0308922
755 Ga0495687_123316
756 Ga0495673_0000013
757 Ga0495673_0216721
758 Ga0495681_0000129
759 Ga0495681_0008782
760 Ga0495686_0022507
761 Ga0496100_0041237
762 Ga0496100_0707995
763 Ga0496101_0367289
764 Ga0496102_0000634
765 Ga0496102_0470993
766 Ga0496103_0000269
767 Ga0496103_0671211
768 Ga0496104_0001869
769 Ga0496105_0000758
770 Ga0496107_0225903
771 Ga0496108_0038101
772 Ga0496109_0053131
773 Ga0496110_0028721
774 Ga0496110_0155877
775 Ga0496111_0094156
776 Ga0496111_0097329
777 Ga0496111_0126061
778 Ga0496112_0015609
779 Ga0496113_0001136
780 Ga0496113_0075024
781 Ga0496114_1727913
782 Ga0496115_0000534
783 Ga0496115_0111840
784 Ga0496117_0058786
785 Ga0496118_0085299
786 Ga0496119_0001886
787 Ga0496120_0003916
788 Ga0496120_0332961
789 Ga0496121_0046485
790 Ga0496121_0150771
791 Ga0496121_0201930
792 Ga0496122_0002825
793 Ga0496122_0008867
794 Ga0496122_0347880
795 Ga0496123_0002804
796 Ga0496123_0004578
797 Ga0496123_0222130
798 Ga0496124_0000889
799 Ga0496124_0012060
800 Ga0496124_0022883
801 Ga0496124_0199810
802 Ga0496125_0001515
803 Ga0496125_0010999
804 Ga0496125_0085874
805 Ga0496126_0000051
806 Ga0496126_0024571
807 Ga0496126_0068438
808 Ga0495678_045012
809 Ga0501290_000084
810 Ga0501292_000041
811 Ga0501294_000714
812 Ga0501297_066267
813 Ga0501317_016375
814 Ga0501032_0189977
815 Ga0501032_0488150
816 Ga0501032_0868052
817 Ga0501033_0011138
818 Ga0501033_0509657
819 Ga0501034_0074993
820 Ga0501036_0023441
821 Ga0501037_0101081
822 Ga0501038_0026092
823 Ga0501039_0120903
824 Ga0501043_0584032
825 Ga0501046_0228940
826 Ga0501047_0158760
827 Ga0501047_0304542
828 Ga0501047_0334698
829 Ga0501071_0116604
830 Ga0501206_003163
831 Ga0501207_008786
832 Ga0501222_004541
833 Ga0501223_000315
834 Ga0501224_004290
835 Ga0501233_183838
836 Ga0501235_010300
837 Ga0501235_012211
838 Ga0501259_000236
839 Ga0501225_0006125
840 Ga0501225_0011594
841 Ga0501245_002567
842 Ga0501279_000094
843 Ga0501280_000113
844 Ga0501282_000040
845 Ga0501283_070696
846 Ga0501044_0115758
847 Ga0501044_0525387
848 nmdc:mga0yw44_915557_c1
849 nmdc:mga06z11_4_c1
850 nmdc:mga04h51_7_c1
851 nmdc:mga07m45_176286_c1
852 nmdc:mga05p37_357031_c1
853 nmdc:mga05p37_471117_c1
854 Ga0500643_000151
855 Ga0500643_000201
856 Ga0500647_0060814
857 Ga0500651_0265446
858 Ga0500555_050093
859 Ga0500562_001370
860 Ga0500562_109960
861 Ga0500592_000124
862 Ga0500607_000023
863 Ga0500607_168959
864 Ga0500608_000160
865 Ga0500618_048625
866 Ga0500559_0000956
867 Ga0500559_0003080
868 Ga0500559_0006356
869 Ga0500559_0097403
870 Ga0500564_009112
871 Ga0500564_128765
872 Ga0500568_0011135
873 Ga0500568_0013275
874 Ga0500573_0215184
875 Ga0500590_001414
876 Ga0500590_100784
877 Ga0500604_0009545
878 Ga0500604_0045603
879 Ga0500616_0018851
880 Ga0500616_0175039
881 Ga0500624_000068
882 Ga0500627_0000021
883 Ga0500627_0000158
884 Ga0500627_0000233
885 Ga0500637_0001524
886 Ga0500567_002667
887 Ga0500625_000025
888 Ga0500645_001036
889 Ga0500661_002057
890 2512642722
891 2600201309
892 2600228430
893 2643819455
894 2643836184
895 2644052661
896 2738710676
897 2738849101
898 2738864830
899 2739297348
900 2739359026
901 2739651223
902 2740029696
903 2753767453
904 2778124447
905 2809061818
906 2809077782
907 2809082510
908 2819715223
909 2830078783
910 2852653630
911 2852682815
912 2879163161
913 2880519999
914 2885431460
915 2919710550
916 2928100779
917 2928528037
918 2928960842
919 2928971459
920 2946791019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11233

DUF3035

Protein of unknown function (DUF3035)

25

141

0.87

Map