F448637

General Info

Members Datasets Scaffolds Average Seq Length
460 304 920 69

Family's Representative Sequence

Representative Sequence 3300053739|Ga0500587_034280|Ga0500587_034280_40_297
Length 85
Sequence MSARLVHKRINARKAKMATGTVKFFNAQKGFGFIQPADGSKDVFVHISAVERAGLGSLNEGQKVSFEATVDSKRGKTSAENLRAM

Samples

Sample ID Description Type Environment
1 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
141 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
227 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
242 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
256 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
262 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
267 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
271 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
284 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
294 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
295 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
298 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.57
Nodule 0
Rhizoplane 4.78
Rhizosphere 63.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500587_034280 3300053739 Bacteria 708
2 JGI25153J46596_10039473 3300003215 Bacteria 1475
3 Ga0055536_1008093 3300003781 Bacteria 4586
4 Ga0055530_10000337 3300003791 Bacteria 42372
5 Ga0055530_10015205 3300003791 Bacteria 2526
6 Ga0055531_10000915 3300003794 Bacteria 23931
7 Ga0055531_10012998 3300003794 Bacteria 3871
8 Ga0055531_10017100 3300003794 Bacteria 3081
9 Ga0055531_10057166 3300003794 Bacteria 979
10 Ga0065165_1017934 3300005262 Bacteria 2585
11 Ga0065165_1122586 3300005262 Bacteria 629
12 Ga0070658_10949209 3300005327 Bacteria 748
13 Ga0070683_101614217 3300005329 Bacteria 624
14 Ga0070683_102071723 3300005329 Bacteria 547
15 Ga0070670_101076986 3300005331 Bacteria 732
16 Ga0068869_100234594 3300005334 Bacteria 1459
17 Ga0070666_11358144 3300005335 Bacteria 531
18 Ga0070680_100670477 3300005336 Bacteria 892
19 Ga0070682_100879420 3300005337 Bacteria 734
20 Ga0070660_100026203 3300005339 Bacteria 4339
21 Ga0070689_100541909 3300005340 Bacteria 1002
22 Ga0070689_100584363 3300005340 Bacteria 966
23 Ga0070661_100546111 3300005344 Bacteria 932
24 Ga0070668_100080095 3300005347 Bacteria 2558
25 Ga0070668_100376961 3300005347 Bacteria 1206
26 Ga0070668_101448208 3300005347 Bacteria 627
27 Ga0070669_100317966 3300005353 Bacteria 1256
28 Ga0070669_100633028 3300005353 Bacteria 899
29 Ga0070675_101679735 3300005354 Bacteria 586
30 Ga0070667_100793782 3300005367 Bacteria 879
31 Ga0070714_100326147 3300005435 Bacteria 1437
32 Ga0070714_100378000 3300005435 Bacteria 1335
33 Ga0070663_100029850 3300005455 Bacteria 3730
34 Ga0070678_101483133 3300005456 Bacteria 635
35 Ga0070681_10199509 3300005458 Bacteria 1919
36 Ga0070681_11590773 3300005458 Bacteria 579
37 Ga0068867_101027515 3300005459 Bacteria 749
38 Ga0068867_101503387 3300005459 Bacteria 627
39 Ga0070698_101404935 3300005471 Bacteria 649
40 Ga0070684_101623619 3300005535 Bacteria 610
41 Ga0070672_100805281 3300005543 Bacteria 827
42 Ga0070686_101583762 3300005544 Bacteria 554
43 Ga0070695_100288233 3300005545 Bacteria 1209
44 Ga0070693_100738918 3300005547 Bacteria 724
45 Ga0070665_100005904 3300005548 Bacteria 12540
46 Ga0070665_100464623 3300005548 Bacteria 1276
47 Ga0068855_100060409 3300005563 Bacteria 4433
48 Ga0068855_100146673 3300005563 Bacteria 2686
49 Ga0068855_100540840 3300005563 Bacteria 1262
50 Ga0068855_100989877 3300005563 Bacteria 884
51 Ga0068857_101012417 3300005577 Bacteria 800
52 Ga0068854_100245352 3300005578 Bacteria 1428
53 Ga0068854_101382101 3300005578 Bacteria 636
54 Ga0068854_101581571 3300005578 Bacteria 597
55 Ga0068854_102232237 3300005578 Bacteria 507
56 Ga0068856_100011504 3300005614 Bacteria 8588
57 Ga0068856_100309582 3300005614 Bacteria 1597
58 Ga0068856_100673893 3300005614 Bacteria 1055
59 Ga0068856_102349778 3300005614 Bacteria 541
60 Ga0068852_100013033 3300005616 Bacteria 6346
61 Ga0068859_102417112 3300005617 Bacteria 579
62 Ga0068866_10594438 3300005718 Bacteria 746
63 Ga0068861_101524187 3300005719 Bacteria 656
64 Ga0068863_100917160 3300005841 Bacteria 877
65 Ga0068863_101326413 3300005841 Bacteria 727
66 Ga0068863_101417389 3300005841 Bacteria 703
67 Ga0068858_102156860 3300005842 Bacteria 551
68 Ga0068860_100000037 3300005843 Bacteria 234524
69 Ga0068862_100054756 3300005844 Bacteria 3415
70 Ga0068862_100260857 3300005844 Bacteria 1582
71 Ga0081455_10001951 3300005937 Bacteria 24782
72 Ga0070717_10118798 3300006028 Bacteria 2263
73 Ga0075365_10023371 3300006038 Bacteria 3887
74 Ga0075363_100039586 3300006048 Bacteria 2481
75 Ga0075364_10246667 3300006051 Bacteria 1213
76 Ga0075364_10279124 3300006051 Bacteria 1136
77 Ga0070712_100974651 3300006175 Bacteria 733
78 Ga0075367_10022115 3300006178 Bacteria 3563
79 Ga0075369_10195233 3300006186 Bacteria 933
80 Ga0075369_10384901 3300006186 Bacteria 660
81 Ga0075366_10509985 3300006195 Bacteria 744
82 Ga0097621_100344937 3300006237 Bacteria 1323
83 Ga0075370_10079587 3300006353 Bacteria 1882
84 Ga0075370_10108230 3300006353 Bacteria 1613
85 Ga0075370_10185246 3300006353 Bacteria 1226
86 Ga0068871_100300072 3300006358 Bacteria 1410
87 Ga0068871_100570836 3300006358 Bacteria 1026
88 Ga0068871_101128480 3300006358 Bacteria 734
89 Ga0075428_102574753 3300006844 Bacteria 520
90 Ga0075433_10450118 3300006852 Bacteria 1135
91 Ga0068865_100002490 3300006881 Bacteria 10907
92 Ga0068865_100509048 3300006881 Bacteria 1005
93 Ga0075436_101426886 3300006914 Bacteria 525
94 Ga0097620_102416754 3300006931 Bacteria 579
95 Ga0099795_10079903 3300007788 Bacteria 1249
96 Ga0105240_11682394 3300009093 Bacteria 663
97 Ga0105240_12069702 3300009093 Bacteria 591
98 Ga0111539_13443358 3300009094 Bacteria 508
99 Ga0105245_11376453 3300009098 Bacteria 755
100 Ga0105247_10360574 3300009101 Bacteria 1025
101 Ga0105248_10741995 3300009177 Bacteria 1108
102 Ga0105237_11530400 3300009545 Bacteria 674
103 Ga0105238_12162816 3300009551 Bacteria 591
104 Ga0105249_11204986 3300009553 Bacteria 828
105 Ga0099796_10014563 3300010159 Bacteria 2275
106 Ga0105246_10372721 3300011119 Bacteria 1177
107 Ga0105246_10709144 3300011119 Bacteria 883
108 Ga0157369_10064024 3300013105 Bacteria 3960
109 Ga0157369_10901797 3300013105 Bacteria 907
110 Ga0163162_10501172 3300013306 Bacteria 1345
111 Ga0163162_12874535 3300013306 Bacteria 554
112 Ga0157375_11466552 3300013308 Bacteria 805
113 Ga0163163_10542515 3300014325 Bacteria 1225
114 Ga0163163_12900816 3300014325 Bacteria 535
115 Ga0157380_10921799 3300014326 Bacteria 901
116 Ga0157380_11041165 3300014326 Bacteria 854
117 Ga0157380_11280522 3300014326 Bacteria 780
118 Ga0157380_11361511 3300014326 Bacteria 759
119 Ga0157380_11601540 3300014326 Bacteria 707
120 Ga0157380_11751543 3300014326 Bacteria 680
121 Ga0157380_12233478 3300014326 Bacteria 611
122 Ga0182008_10143737 3300014497 Bacteria 1194
123 Ga0157377_10613212 3300014745 Bacteria 778
124 Ga0157379_10654342 3300014968 Bacteria 984
125 Ga0157379_10766713 3300014968 Bacteria 909
126 Ga0157376_10461238 3300014969 Bacteria 1241
127 Ga0182007_10012367 3300015262 Bacteria 3284
128 Ga0163161_10375478 3300017792 Bacteria 1135
129 Ga0163161_11292726 3300017792 Bacteria 634
130 Ga0213872_10075297 3300021361 Bacteria 1519
131 Ga0213875_10037946 3300021388 Bacteria 2270
132 Ga0209026_1004463 3300025250 Bacteria 4132
133 Ga0209148_1020118 3300025254 Bacteria 1101
134 Ga0209233_1053394 3300025261 Bacteria 811
135 Ga0209455_1041381 3300025272 Bacteria 698
136 Ga0209676_1000282 3300025292 Bacteria 105777
137 Ga0209564_1010399 3300025295 Bacteria 4292
138 Ga0209758_1003525 3300025297 Bacteria 14108
139 Ga0209050_1000095 3300025298 Bacteria 242722
140 Ga0209050_1001911 3300025298 Bacteria 19933
141 Ga0209257_1000106 3300025304 Bacteria 242634
142 Ga0209257_1000332 3300025304 Bacteria 98632
143 Ga0209257_1000641 3300025304 Bacteria 55911
144 Ga0207688_10246264 3300025901 Bacteria 1082
145 Ga0207654_10222856 3300025911 Bacteria 1252
146 Ga0207707_10457787 3300025912 Bacteria 1091
147 Ga0207695_10383141 3300025913 Bacteria 1292
148 Ga0207695_11063388 3300025913 Bacteria 689
149 Ga0207695_11257804 3300025913 Bacteria 620
150 Ga0207671_10897630 3300025914 Bacteria 701
151 Ga0207657_10028470 3300025919 Bacteria 5096
152 Ga0207657_10995826 3300025919 Bacteria 643
153 Ga0207657_11027570 3300025919 Bacteria 632
154 Ga0207681_10322349 3300025923 Bacteria 1229
155 Ga0207681_10804391 3300025923 Bacteria 785
156 Ga0207694_10037753 3300025924 Bacteria 3712
157 Ga0207694_10320212 3300025924 Bacteria 1280
158 Ga0207650_10329371 3300025925 Bacteria 1252
159 Ga0207650_11022772 3300025925 Bacteria 703
160 Ga0207650_11644062 3300025925 Bacteria 545
161 Ga0207659_10795104 3300025926 Bacteria 812
162 Ga0207659_11443643 3300025926 Bacteria 589
163 Ga0207664_11009887 3300025929 Bacteria 745
164 Ga0207670_11053952 3300025936 Bacteria 685
165 Ga0207704_10023565 3300025938 Bacteria 3320
166 Ga0207704_10499026 3300025938 Bacteria 981
167 Ga0207691_11112307 3300025940 Bacteria 657
168 Ga0207661_11198285 3300025944 Bacteria 699
169 Ga0207661_11668391 3300025944 Bacteria 582
170 Ga0207667_10111987 3300025949 Bacteria 2815
171 Ga0207667_10228837 3300025949 Bacteria 1904
172 Ga0207667_10289251 3300025949 Bacteria 1674
173 Ga0207667_10820046 3300025949 Bacteria 926
174 Ga0207667_10829305 3300025949 Bacteria 920
175 Ga0207667_11587597 3300025949 Bacteria 623
176 Ga0207668_10130453 3300025972 Bacteria 1918
177 Ga0207668_11211633 3300025972 Bacteria 679
178 Ga0207668_11585544 3300025972 Bacteria 591
179 Ga0207640_10013118 3300025981 Bacteria 4740
180 Ga0207640_11570031 3300025981 Bacteria 592
181 Ga0207658_10411778 3300025986 Bacteria 1190
182 Ga0207678_10027553 3300026067 Bacteria 4958
183 Ga0207702_10034487 3300026078 Bacteria 4231
184 Ga0207702_10203336 3300026078 Bacteria 1837
185 Ga0207702_10316145 3300026078 Bacteria 1486
186 Ga0207702_10894247 3300026078 Bacteria 880
187 Ga0207702_10943505 3300026078 Bacteria 855
188 Ga0207641_10618680 3300026088 Bacteria 1062
189 Ga0207648_10532371 3300026089 Bacteria 1077
190 Ga0207648_11645839 3300026089 Bacteria 603
191 Ga0207674_11247145 3300026116 Bacteria 713
192 Ga0207674_11402948 3300026116 Bacteria 668
193 Ga0207675_102328974 3300026118 Bacteria 549
194 Ga0207683_10897424 3300026121 Bacteria 823
195 Ga0207698_10047667 3300026142 Bacteria 3248
196 Ga0207698_11001791 3300026142 Bacteria 846
197 Ga0209179_1026856 3300027512 Bacteria 1158
198 Ga0268266_10002702 3300028379 Bacteria 18611
199 Ga0268266_10130329 3300028379 Bacteria 2249
200 Ga0268265_10005623 3300028380 Bacteria 8562
201 Ga0268265_10128073 3300028380 Bacteria 2105
202 Ga0268265_10178342 3300028380 Bacteria 1823
203 Ga0268265_10494293 3300028380 Bacteria 1151
204 Ga0268264_10000002 3300028381 Bacteria 1153045
205 Ga0307515_10147271 3300028794 Bacteria 2486
206 Ga0307511_10009257 3300030521 Bacteria 9811
207 Ga0265330_10339156 3300031235 Bacteria 634
208 Ga0307513_10122822 3300031456 Bacteria 2560
209 Ga0307408_102529699 3300031548 Bacteria 500
210 Ga0316579_10040909 3300031691 Bacteria 2151
211 Ga0316579_10103418 3300031691 Bacteria 1365
212 Ga0265314_10144092 3300031711 Bacteria 1469
213 Ga0307405_10101846 3300031731 Bacteria 1928
214 Ga0307405_11467339 3300031731 Bacteria 598
215 Ga0307405_11908103 3300031731 Bacteria 530
216 Ga0307405_12048939 3300031731 Bacteria 513
217 Ga0307413_10155204 3300031824 Bacteria 1600
218 Ga0307413_10367673 3300031824 Bacteria 1116
219 Ga0307406_11387418 3300031901 Bacteria 615
220 Ga0307409_102054729 3300031995 Bacteria 601
221 Ga0307416_102888180 3300032002 Bacteria 575
222 Ga0307414_10218288 3300032004 Bacteria 1563
223 Ga0307411_10137932 3300032005 Bacteria 1794
224 Ga0307411_10236234 3300032005 Bacteria 1428
225 Ga0316583_10000048 3300032133 Bacteria 23093
226 Ga0316593_10037294 3300032168 Bacteria 1606
227 Ga0316593_10161695 3300032168 Bacteria 818
228 Ga0316593_10226330 3300032168 Bacteria 696
229 Ga0307510_10054322 3300033180 Bacteria 4197
230 Ga0307510_10149207 3300033180 Bacteria 1962
231 Ga0373934_0054909 3300035086 Bacteria 1582
232 Ga0373924_0582914 3300035410 Bacteria 504
233 Ga0373933_0631117 3300035724 Bacteria 704
234 Ga0373925_0113154 3300037068 Bacteria 2098
235 Ga0395898_0257306 3300037466 Bacteria 1665
236 Ga0395905_0279921 3300037471 Bacteria 1554
237 Ga0395905_0554713 3300037471 Bacteria 1050
238 Ga0395905_0872781 3300037471 Bacteria 803
239 Ga0395905_1581827 3300037471 Bacteria 560
240 Ga0316581_0153903 3300037588 Bacteria 709
241 Ga0436364_1205445 3300037853 Bacteria 4539
242 Ga0395901_1222831 3300038443 Bacteria 716
243 Ga0436365_0332337 3300039437 Bacteria 581
244 Ga0451793_1733260 3300041452 Bacteria 603
245 Ga0451841_0587899 3300041498 Bacteria 712
246 Ga0451855_1514446 3300041511 Bacteria 530
247 Ga0451853_0315559 3300041512 Bacteria 555
248 Ga0451853_2618744 3300041512 Bacteria 509
249 Ga0439431_0019146 3300041997 Bacteria 1624
250 Ga0453684_0457212 3300044712 Bacteria 1420
251 Ga0495603_0021713 3300046455 Bacteria 3888
252 Ga0495638_0084882 3300046460 Bacteria 1915
253 Ga0495638_0099278 3300046460 Bacteria 1743
254 Ga0495650_0060370 3300046471 Bacteria 1523
255 Ga0495639_0117027 3300046475 Bacteria 1269
256 Ga0495607_0211014 3300046501 Bacteria 955
257 Ga0495583_0054853 3300046506 Bacteria 1803
258 Ga0495606_0289302 3300046507 Bacteria 892
259 Ga0495606_0591326 3300046507 Bacteria 546
260 Ga0495610_0079773 3300046512 Bacteria 1506
261 Ga0495616_0033362 3300046513 Bacteria 2683
262 Ga0495620_0033380 3300046515 Bacteria 2337
263 Ga0495628_0213659 3300046516 Bacteria 1450
264 Ga0495630_0906438 3300046517 Bacteria 671
265 Ga0495631_0189527 3300046518 Bacteria 880
266 Ga0495632_0064449 3300046519 Bacteria 1772
267 Ga0495637_0148318 3300046520 Bacteria 886
268 Ga0495643_0130520 3300046522 Bacteria 1262
269 Ga0495643_0340730 3300046522 Bacteria 673
270 Ga0495648_0000580 3300046524 Bacteria 39129
271 Ga0495648_0240396 3300046524 Bacteria 880
272 Ga0495666_0303304 3300046526 Bacteria 722
273 Ga0495654_0023909 3300046530 Bacteria 3161
274 Ga0495609_0090384 3300046538 Bacteria 1332
275 Ga0495621_0154455 3300046539 Bacteria 904
276 Ga0495597_0063998 3300046542 Bacteria 1598
277 Ga0495645_0061511 3300046543 Bacteria 2720
278 Ga0495668_0000037 3300046616 Bacteria 233981
279 Ga0495668_0044827 3300046616 Bacteria 2458
280 Ga0495668_0134058 3300046616 Bacteria 1355
281 Ga0495668_0184923 3300046616 Bacteria 1141
282 Ga0495668_0546499 3300046616 Bacteria 639
283 Ga0495611_0083825 3300046648 Bacteria 1469
284 Ga0495625_0205883 3300046660 Bacteria 1296
285 Ga0495625_0209604 3300046660 Bacteria 1281
286 Ga0495659_0293472 3300046664 Bacteria 686
287 Ga0495661_0167295 3300046665 Bacteria 1175
288 Ga0495588_0182761 3300046674 Bacteria 1108
289 Ga0495658_0476425 3300046683 Bacteria 798
290 Ga0495670_0063486 3300046691 Bacteria 1859
291 Ga0495670_0370750 3300046691 Bacteria 772
292 Ga0495671_0069471 3300046692 Bacteria 1731
293 Ga0495660_0089247 3300046810 Bacteria 1605
294 Ga0495674_1248187 3300047319 Bacteria 560
295 Ga0495672_0517392 3300047320 Bacteria 528
296 Ga0495673_0000191 3300047469 Bacteria 96817
297 Ga0495681_0117065 3300047470 Bacteria 1147
298 Ga0495686_0138549 3300047472 Bacteria 1437
299 Ga0495686_0177123 3300047472 Bacteria 1237
300 Ga0495686_0306569 3300047472 Bacteria 874
301 Ga0495686_0366145 3300047472 Bacteria 780
302 Ga0495686_0393412 3300047472 Bacteria 745
303 Ga0495686_0456106 3300047472 Bacteria 678
304 Ga0495686_0660918 3300047472 Bacteria 536
305 Ga0495626_0223030 3300048091 Bacteria 765
306 Ga0496100_0131602 3300048903 Bacteria 1763
307 Ga0496100_0149359 3300048903 Bacteria 1665
308 Ga0496100_0507851 3300048903 Bacteria 929
309 Ga0496102_0200750 3300048905 Bacteria 1880
310 Ga0496102_1044327 3300048905 Bacteria 737
311 Ga0496103_0681367 3300048906 Bacteria 652
312 Ga0496104_1538263 3300048907 Bacteria 568
313 Ga0496105_1089907 3300048908 Bacteria 593
314 Ga0496106_0472933 3300048909 Bacteria 1007
315 Ga0496107_0862791 3300048910 Bacteria 661
316 Ga0496108_0473908 3300048911 Bacteria 1094
317 Ga0496108_0841170 3300048911 Bacteria 790
318 Ga0496109_0556628 3300048912 Bacteria 1082
319 Ga0496110_0023917 3300048913 Bacteria 5202
320 Ga0496111_1186162 3300048914 Bacteria 541
321 Ga0496112_0090897 3300048915 Bacteria 3022
322 Ga0496112_0228214 3300048915 Bacteria 1817
323 Ga0496112_0571638 3300048915 Bacteria 1063
324 Ga0496113_0217892 3300048916 Bacteria 1521
325 Ga0496114_1681055 3300048917 Bacteria 523
326 Ga0496115_1223373 3300048918 Bacteria 563
327 Ga0496116_0002966 3300048919 Bacteria 17265
328 Ga0496116_0192452 3300048919 Bacteria 1078
329 Ga0496117_0091572 3300048920 Bacteria 1955
330 Ga0496118_0070949 3300048921 Bacteria 2511
331 Ga0496118_0151844 3300048921 Bacteria 1448
332 Ga0496119_0377553 3300048922 Bacteria 680
333 Ga0496120_0012249 3300048923 Bacteria 5845
334 Ga0496121_0006360 3300048924 Bacteria 14719
335 Ga0496121_0012038 3300048924 Bacteria 9504
336 Ga0496122_0027335 3300048925 Bacteria 4882
337 Ga0496123_0012473 3300048926 Bacteria 7244
338 Ga0496123_0123285 3300048926 Bacteria 1452
339 Ga0496124_0022257 3300048927 Bacteria 5817
340 Ga0496124_0316771 3300048927 Bacteria 1119
341 Ga0496125_0045576 3300048928 Bacteria 3688
342 Ga0496125_0072227 3300048928 Bacteria 2690
343 Ga0496125_0520966 3300048928 Bacteria 664
344 Ga0496126_0023915 3300048929 Bacteria 5908
345 Ga0496126_0044792 3300048929 Bacteria 4071
346 Ga0496126_0428547 3300048929 Bacteria 1068
347 Ga0501306_045825 3300049127 Bacteria 690
348 Ga0501306_073932 3300049127 Bacteria 579
349 Ga0501343_024323 3300049132 Bacteria 544
350 Ga0495678_063370 3300049459 Bacteria 1381
351 Ga0501316_081007 3300049532 Bacteria 502
352 Ga0501317_071148 3300049533 Bacteria 587
353 Ga0501319_023815 3300049535 Bacteria 562
354 Ga0501320_015656 3300049536 Bacteria 831
355 Ga0501320_041686 3300049536 Bacteria 603
356 Ga0501320_045908 3300049536 Bacteria 584
357 Ga0501321_031487 3300049537 Bacteria 711
358 Ga0501323_023887 3300049539 Bacteria 823
359 Ga0501323_050245 3300049539 Bacteria 631
360 Ga0501324_006409 3300049540 Bacteria 991
361 Ga0501324_025039 3300049540 Bacteria 628
362 Ga0501325_035543 3300049541 Bacteria 588
363 Ga0501325_053934 3300049541 Bacteria 517
364 Ga0501329_03055 3300049545 Bacteria 833
365 Ga0501047_1017092 3300049581 Bacteria 642
366 Ga0501070_0696324 3300049586 Bacteria 804
367 Ga0501073_0734234 3300049589 Bacteria 681
368 Ga0501074_0516773 3300049590 Bacteria 846
369 Ga0501080_0188462 3300049742 Bacteria 1896
370 Ga0501241_098287 3300049758 Bacteria 628
371 Ga0501269_067686 3300049766 Bacteria 514
372 nmdc:mga03683_95265_c1 3300050489 Bacteria 1303
373 nmdc:mga03n38_186224_c1 3300050490 Bacteria 1067
374 nmdc:mga03n38_764186_c1 3300050490 Bacteria 561
375 nmdc:mga00v17_187603_c1 3300050491 Bacteria 1335
376 nmdc:mga0yw44_220863_c1 3300050492 Bacteria 1256
377 nmdc:mga0yw44_4055_c1 3300050492 Bacteria 6630
378 nmdc:mga0yw44_893201_c1 3300050492 Bacteria 603
379 nmdc:mga06z11_541356_c1 3300050494 Bacteria 707
380 nmdc:mga07m45_40638_c1 3300050496 Bacteria 2602
381 nmdc:mga07m45_558820_c1 3300050496 Bacteria 662
382 nmdc:mga07m45_614948_c1 3300050496 Bacteria 627
383 nmdc:mga07m45_78543_c1 3300050496 Bacteria 1883
384 nmdc:mga0n895_1100334_c1 3300050512 Bacteria 772
385 nmdc:mga0a205_880589_c1 3300050515 Bacteria 742
386 nmdc:mga0sz30_13911_c1 3300050516 Bacteria 3159
387 nmdc:mga0sz30_7935_c1 3300050516 Bacteria 3995
388 Ga0500635_0110332 3300053080 Bacteria 1021
389 Ga0500643_041656 3300053087 Bacteria 1347
390 Ga0500643_093981 3300053087 Bacteria 816
391 Ga0500644_0000187 3300053088 Bacteria 39159
392 Ga0500644_0168901 3300053088 Bacteria 888
393 Ga0500581_083483 3300053089 Bacteria 1591
394 Ga0500646_0049813 3300053090 Bacteria 1205
395 Ga0500651_0018719 3300053093 Bacteria 4289
396 Ga0500651_0075557 3300053093 Bacteria 2093
397 Ga0500651_0549756 3300053093 Bacteria 631
398 Ga0500566_0000474 3300053094 Bacteria 22351
399 Ga0500566_0247505 3300053094 Bacteria 869
400 Ga0500641_0226320 3300053096 Bacteria 791
401 Ga0500650_0099254 3300053098 Bacteria 1362
402 Ga0500650_0493270 3300053098 Bacteria 521
403 Ga0500654_196690 3300053099 Bacteria 615
404 Ga0500554_000457 3300053102 Bacteria 8572
405 Ga0500554_104201 3300053102 Bacteria 951
406 Ga0500556_0000029 3300053104 Bacteria 165326
407 Ga0500562_069532 3300053108 Bacteria 949
408 Ga0500569_019245 3300053109 Bacteria 1774
409 Ga0500592_003760 3300053116 Bacteria 2420
410 Ga0500593_224053 3300053117 Bacteria 658
411 Ga0500594_0009753 3300053118 Bacteria 2217
412 Ga0500594_0021347 3300053118 Bacteria 1623
413 Ga0500595_001500 3300053119 Bacteria 12403
414 Ga0500595_089940 3300053119 Bacteria 889
415 Ga0500607_053935 3300053121 Bacteria 2130
416 Ga0500608_000022 3300053122 Bacteria 72979
417 Ga0500608_002234 3300053122 Bacteria 6992
418 Ga0500618_006496 3300053125 Bacteria 3426
419 Ga0500642_0000020 3300053130 Bacteria 159498
420 Ga0500642_0007119 3300053130 Bacteria 3739
421 Ga0500642_0013646 3300053130 Bacteria 2995
422 Ga0500652_007586 3300053131 Bacteria 3561
423 Ga0500658_0217967 3300053134 Bacteria 874
424 Ga0500559_0000593 3300053136 Bacteria 24618
425 Ga0500559_0004746 3300053136 Bacteria 6378
426 Ga0500564_000079 3300053138 Bacteria 25002
427 Ga0500564_290234 3300053138 Bacteria 632
428 Ga0500568_0000521 3300053139 Bacteria 28398
429 Ga0500568_0001940 3300053139 Bacteria 12677
430 Ga0500568_0175801 3300053139 Bacteria 788
431 Ga0500577_0166737 3300053142 Bacteria 940
432 Ga0500586_114418 3300053145 Bacteria 941
433 Ga0500588_0120154 3300053146 Bacteria 926
434 Ga0500590_004588 3300053148 Bacteria 6537
435 Ga0500603_000474 3300053150 Bacteria 10282
436 Ga0500604_0004356 3300053151 Bacteria 3761
437 Ga0500616_0000112 3300053153 Bacteria 151210
438 Ga0500622_0000717 3300053156 Bacteria 28993
439 Ga0500622_0012486 3300053156 Bacteria 4598
440 Ga0500627_0131462 3300053158 Bacteria 1130
441 Ga0500633_0043783 3300053160 Bacteria 1516
442 Ga0500634_0044297 3300053161 Bacteria 2409
443 Ga0500634_0333752 3300053161 Bacteria 586
444 Ga0500639_178119 3300053163 Bacteria 944
445 Ga0500636_0377057 3300053177 Bacteria 666
446 Ga0500637_0077801 3300053178 Bacteria 1913
447 Ga0500567_057661 3300053723 Bacteria 1751
448 Ga0500570_222923 3300053724 Bacteria 537
449 Ga0500611_099405 3300053727 Bacteria 751
450 Ga0500645_002004 3300053730 Bacteria 9558
451 Ga0500645_048766 3300053730 Bacteria 1239
452 Ga0500609_003288 3300053731 Bacteria 2281
453 Ga0500609_003661 3300053731 Bacteria 2144
454 Ga0590075_002461 3300059424 Bacteria 4428
455 Ga0590077_020797 3300059426 Bacteria 1395
456 Ga0587066_144466 3300059490 Bacteria 584
457 Ga0587080_154573 3300059503 Bacteria 534
458 Ga0587111_0016459 3300060346 Bacteria 1365
459 Ga0501082_0557152 3300060353 Bacteria 1003
460 Ga0530510_1279447 3300061734 Bacteria 562
461 Ga0500587_034280
462 JGI25153J46596_10039473
463 Ga0055536_1008093
464 Ga0055530_10000337
465 Ga0055530_10015205
466 Ga0055531_10000915
467 Ga0055531_10012998
468 Ga0055531_10017100
469 Ga0055531_10057166
470 Ga0065165_1017934
471 Ga0065165_1122586
472 Ga0070658_10949209
473 Ga0070683_101614217
474 Ga0070683_102071723
475 Ga0070670_101076986
476 Ga0068869_100234594
477 Ga0070666_11358144
478 Ga0070680_100670477
479 Ga0070682_100879420
480 Ga0070660_100026203
481 Ga0070689_100541909
482 Ga0070689_100584363
483 Ga0070661_100546111
484 Ga0070668_100080095
485 Ga0070668_100376961
486 Ga0070668_101448208
487 Ga0070669_100317966
488 Ga0070669_100633028
489 Ga0070675_101679735
490 Ga0070667_100793782
491 Ga0070714_100326147
492 Ga0070714_100378000
493 Ga0070663_100029850
494 Ga0070678_101483133
495 Ga0070681_10199509
496 Ga0070681_11590773
497 Ga0068867_101027515
498 Ga0068867_101503387
499 Ga0070698_101404935
500 Ga0070684_101623619
501 Ga0070672_100805281
502 Ga0070686_101583762
503 Ga0070695_100288233
504 Ga0070693_100738918
505 Ga0070665_100005904
506 Ga0070665_100464623
507 Ga0068855_100060409
508 Ga0068855_100146673
509 Ga0068855_100540840
510 Ga0068855_100989877
511 Ga0068857_101012417
512 Ga0068854_100245352
513 Ga0068854_101382101
514 Ga0068854_101581571
515 Ga0068854_102232237
516 Ga0068856_100011504
517 Ga0068856_100309582
518 Ga0068856_100673893
519 Ga0068856_102349778
520 Ga0068852_100013033
521 Ga0068859_102417112
522 Ga0068866_10594438
523 Ga0068861_101524187
524 Ga0068863_100917160
525 Ga0068863_101326413
526 Ga0068863_101417389
527 Ga0068858_102156860
528 Ga0068860_100000037
529 Ga0068862_100054756
530 Ga0068862_100260857
531 Ga0081455_10001951
532 Ga0070717_10118798
533 Ga0075365_10023371
534 Ga0075363_100039586
535 Ga0075364_10246667
536 Ga0075364_10279124
537 Ga0070712_100974651
538 Ga0075367_10022115
539 Ga0075369_10195233
540 Ga0075369_10384901
541 Ga0075366_10509985
542 Ga0097621_100344937
543 Ga0075370_10079587
544 Ga0075370_10108230
545 Ga0075370_10185246
546 Ga0068871_100300072
547 Ga0068871_100570836
548 Ga0068871_101128480
549 Ga0075428_102574753
550 Ga0075433_10450118
551 Ga0068865_100002490
552 Ga0068865_100509048
553 Ga0075436_101426886
554 Ga0097620_102416754
555 Ga0099795_10079903
556 Ga0105240_11682394
557 Ga0105240_12069702
558 Ga0111539_13443358
559 Ga0105245_11376453
560 Ga0105247_10360574
561 Ga0105248_10741995
562 Ga0105237_11530400
563 Ga0105238_12162816
564 Ga0105249_11204986
565 Ga0099796_10014563
566 Ga0105246_10372721
567 Ga0105246_10709144
568 Ga0157369_10064024
569 Ga0157369_10901797
570 Ga0163162_10501172
571 Ga0163162_12874535
572 Ga0157375_11466552
573 Ga0163163_10542515
574 Ga0163163_12900816
575 Ga0157380_10921799
576 Ga0157380_11041165
577 Ga0157380_11280522
578 Ga0157380_11361511
579 Ga0157380_11601540
580 Ga0157380_11751543
581 Ga0157380_12233478
582 Ga0182008_10143737
583 Ga0157377_10613212
584 Ga0157379_10654342
585 Ga0157379_10766713
586 Ga0157376_10461238
587 Ga0182007_10012367
588 Ga0163161_10375478
589 Ga0163161_11292726
590 Ga0213872_10075297
591 Ga0213875_10037946
592 Ga0209026_1004463
593 Ga0209148_1020118
594 Ga0209233_1053394
595 Ga0209455_1041381
596 Ga0209676_1000282
597 Ga0209564_1010399
598 Ga0209758_1003525
599 Ga0209050_1000095
600 Ga0209050_1001911
601 Ga0209257_1000106
602 Ga0209257_1000332
603 Ga0209257_1000641
604 Ga0207688_10246264
605 Ga0207654_10222856
606 Ga0207707_10457787
607 Ga0207695_10383141
608 Ga0207695_11063388
609 Ga0207695_11257804
610 Ga0207671_10897630
611 Ga0207657_10028470
612 Ga0207657_10995826
613 Ga0207657_11027570
614 Ga0207681_10322349
615 Ga0207681_10804391
616 Ga0207694_10037753
617 Ga0207694_10320212
618 Ga0207650_10329371
619 Ga0207650_11022772
620 Ga0207650_11644062
621 Ga0207659_10795104
622 Ga0207659_11443643
623 Ga0207664_11009887
624 Ga0207670_11053952
625 Ga0207704_10023565
626 Ga0207704_10499026
627 Ga0207691_11112307
628 Ga0207661_11198285
629 Ga0207661_11668391
630 Ga0207667_10111987
631 Ga0207667_10228837
632 Ga0207667_10289251
633 Ga0207667_10820046
634 Ga0207667_10829305
635 Ga0207667_11587597
636 Ga0207668_10130453
637 Ga0207668_11211633
638 Ga0207668_11585544
639 Ga0207640_10013118
640 Ga0207640_11570031
641 Ga0207658_10411778
642 Ga0207678_10027553
643 Ga0207702_10034487
644 Ga0207702_10203336
645 Ga0207702_10316145
646 Ga0207702_10894247
647 Ga0207702_10943505
648 Ga0207641_10618680
649 Ga0207648_10532371
650 Ga0207648_11645839
651 Ga0207674_11247145
652 Ga0207674_11402948
653 Ga0207675_102328974
654 Ga0207683_10897424
655 Ga0207698_10047667
656 Ga0207698_11001791
657 Ga0209179_1026856
658 Ga0268266_10002702
659 Ga0268266_10130329
660 Ga0268265_10005623
661 Ga0268265_10128073
662 Ga0268265_10178342
663 Ga0268265_10494293
664 Ga0268264_10000002
665 Ga0307515_10147271
666 Ga0307511_10009257
667 Ga0265330_10339156
668 Ga0307513_10122822
669 Ga0307408_102529699
670 Ga0316579_10040909
671 Ga0316579_10103418
672 Ga0265314_10144092
673 Ga0307405_10101846
674 Ga0307405_11467339
675 Ga0307405_11908103
676 Ga0307405_12048939
677 Ga0307413_10155204
678 Ga0307413_10367673
679 Ga0307406_11387418
680 Ga0307409_102054729
681 Ga0307416_102888180
682 Ga0307414_10218288
683 Ga0307411_10137932
684 Ga0307411_10236234
685 Ga0316583_10000048
686 Ga0316593_10037294
687 Ga0316593_10161695
688 Ga0316593_10226330
689 Ga0307510_10054322
690 Ga0307510_10149207
691 Ga0373934_0054909
692 Ga0373924_0582914
693 Ga0373933_0631117
694 Ga0373925_0113154
695 Ga0395898_0257306
696 Ga0395905_0279921
697 Ga0395905_0554713
698 Ga0395905_0872781
699 Ga0395905_1581827
700 Ga0316581_0153903
701 Ga0436364_1205445
702 Ga0395901_1222831
703 Ga0436365_0332337
704 Ga0451793_1733260
705 Ga0451841_0587899
706 Ga0451855_1514446
707 Ga0451853_0315559
708 Ga0451853_2618744
709 Ga0439431_0019146
710 Ga0453684_0457212
711 Ga0495603_0021713
712 Ga0495638_0084882
713 Ga0495638_0099278
714 Ga0495650_0060370
715 Ga0495639_0117027
716 Ga0495607_0211014
717 Ga0495583_0054853
718 Ga0495606_0289302
719 Ga0495606_0591326
720 Ga0495610_0079773
721 Ga0495616_0033362
722 Ga0495620_0033380
723 Ga0495628_0213659
724 Ga0495630_0906438
725 Ga0495631_0189527
726 Ga0495632_0064449
727 Ga0495637_0148318
728 Ga0495643_0130520
729 Ga0495643_0340730
730 Ga0495648_0000580
731 Ga0495648_0240396
732 Ga0495666_0303304
733 Ga0495654_0023909
734 Ga0495609_0090384
735 Ga0495621_0154455
736 Ga0495597_0063998
737 Ga0495645_0061511
738 Ga0495668_0000037
739 Ga0495668_0044827
740 Ga0495668_0134058
741 Ga0495668_0184923
742 Ga0495668_0546499
743 Ga0495611_0083825
744 Ga0495625_0205883
745 Ga0495625_0209604
746 Ga0495659_0293472
747 Ga0495661_0167295
748 Ga0495588_0182761
749 Ga0495658_0476425
750 Ga0495670_0063486
751 Ga0495670_0370750
752 Ga0495671_0069471
753 Ga0495660_0089247
754 Ga0495674_1248187
755 Ga0495672_0517392
756 Ga0495673_0000191
757 Ga0495681_0117065
758 Ga0495686_0138549
759 Ga0495686_0177123
760 Ga0495686_0306569
761 Ga0495686_0366145
762 Ga0495686_0393412
763 Ga0495686_0456106
764 Ga0495686_0660918
765 Ga0495626_0223030
766 Ga0496100_0131602
767 Ga0496100_0149359
768 Ga0496100_0507851
769 Ga0496102_0200750
770 Ga0496102_1044327
771 Ga0496103_0681367
772 Ga0496104_1538263
773 Ga0496105_1089907
774 Ga0496106_0472933
775 Ga0496107_0862791
776 Ga0496108_0473908
777 Ga0496108_0841170
778 Ga0496109_0556628
779 Ga0496110_0023917
780 Ga0496111_1186162
781 Ga0496112_0090897
782 Ga0496112_0228214
783 Ga0496112_0571638
784 Ga0496113_0217892
785 Ga0496114_1681055
786 Ga0496115_1223373
787 Ga0496116_0002966
788 Ga0496116_0192452
789 Ga0496117_0091572
790 Ga0496118_0070949
791 Ga0496118_0151844
792 Ga0496119_0377553
793 Ga0496120_0012249
794 Ga0496121_0006360
795 Ga0496121_0012038
796 Ga0496122_0027335
797 Ga0496123_0012473
798 Ga0496123_0123285
799 Ga0496124_0022257
800 Ga0496124_0316771
801 Ga0496125_0045576
802 Ga0496125_0072227
803 Ga0496125_0520966
804 Ga0496126_0023915
805 Ga0496126_0044792
806 Ga0496126_0428547
807 Ga0501306_045825
808 Ga0501306_073932
809 Ga0501343_024323
810 Ga0495678_063370
811 Ga0501316_081007
812 Ga0501317_071148
813 Ga0501319_023815
814 Ga0501320_015656
815 Ga0501320_041686
816 Ga0501320_045908
817 Ga0501321_031487
818 Ga0501323_023887
819 Ga0501323_050245
820 Ga0501324_006409
821 Ga0501324_025039
822 Ga0501325_035543
823 Ga0501325_053934
824 Ga0501329_03055
825 Ga0501047_1017092
826 Ga0501070_0696324
827 Ga0501073_0734234
828 Ga0501074_0516773
829 Ga0501080_0188462
830 Ga0501241_098287
831 Ga0501269_067686
832 nmdc:mga03683_95265_c1
833 nmdc:mga03n38_186224_c1
834 nmdc:mga03n38_764186_c1
835 nmdc:mga00v17_187603_c1
836 nmdc:mga0yw44_220863_c1
837 nmdc:mga0yw44_4055_c1
838 nmdc:mga0yw44_893201_c1
839 nmdc:mga06z11_541356_c1
840 nmdc:mga07m45_40638_c1
841 nmdc:mga07m45_558820_c1
842 nmdc:mga07m45_614948_c1
843 nmdc:mga07m45_78543_c1
844 nmdc:mga0n895_1100334_c1
845 nmdc:mga0a205_880589_c1
846 nmdc:mga0sz30_13911_c1
847 nmdc:mga0sz30_7935_c1
848 Ga0500635_0110332
849 Ga0500643_041656
850 Ga0500643_093981
851 Ga0500644_0000187
852 Ga0500644_0168901
853 Ga0500581_083483
854 Ga0500646_0049813
855 Ga0500651_0018719
856 Ga0500651_0075557
857 Ga0500651_0549756
858 Ga0500566_0000474
859 Ga0500566_0247505
860 Ga0500641_0226320
861 Ga0500650_0099254
862 Ga0500650_0493270
863 Ga0500654_196690
864 Ga0500554_000457
865 Ga0500554_104201
866 Ga0500556_0000029
867 Ga0500562_069532
868 Ga0500569_019245
869 Ga0500592_003760
870 Ga0500593_224053
871 Ga0500594_0009753
872 Ga0500594_0021347
873 Ga0500595_001500
874 Ga0500595_089940
875 Ga0500607_053935
876 Ga0500608_000022
877 Ga0500608_002234
878 Ga0500618_006496
879 Ga0500642_0000020
880 Ga0500642_0007119
881 Ga0500642_0013646
882 Ga0500652_007586
883 Ga0500658_0217967
884 Ga0500559_0000593
885 Ga0500559_0004746
886 Ga0500564_000079
887 Ga0500564_290234
888 Ga0500568_0000521
889 Ga0500568_0001940
890 Ga0500568_0175801
891 Ga0500577_0166737
892 Ga0500586_114418
893 Ga0500588_0120154
894 Ga0500590_004588
895 Ga0500603_000474
896 Ga0500604_0004356
897 Ga0500616_0000112
898 Ga0500622_0000717
899 Ga0500622_0012486
900 Ga0500627_0131462
901 Ga0500633_0043783
902 Ga0500634_0044297
903 Ga0500634_0333752
904 Ga0500639_178119
905 Ga0500636_0377057
906 Ga0500637_0077801
907 Ga0500567_057661
908 Ga0500570_222923
909 Ga0500611_099405
910 Ga0500645_002004
911 Ga0500645_048766
912 Ga0500609_003288
913 Ga0500609_003661
914 Ga0590075_002461
915 Ga0590077_020797
916 Ga0587066_144466
917 Ga0587080_154573
918 Ga0587111_0016459
919 Ga0501082_0557152
920 Ga0530510_1279447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

18

85

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9146 2 69
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9125 2 69
3aqq-assembly1.cif.gz_D crystal structure of human crhsp-24 0.9069 2 68
2lss-assembly1.cif.gz_A solution structure of the r. rickettsii cold shock-like protein 0.9039 3 69
3aqq-assembly1.cif.gz_C crystal structure of human crhsp-24 0.8987 2 69
ID Description Score Start End Superfamily
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9229 2 68 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9186 2 67 2.40.50.140
af_P0A976_2_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9105 2 67 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9039 3 69 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8987 2 69 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A371B4W4-F1-model_v4 Cold-shock protein 0.9922 1 69 GO:0003676
GO:0005829
AF-A0A246E1Q0-F1-model_v4 Cold-shock protein 0.9911 1 69 GO:0003676
GO:0005829
AF-A0A2E7RF98-F1-model_v4 Cold-shock protein 0.9911 1 69 GO:0003676
GO:0005829
AF-A0A1I1HSF1-F1-model_v4 Cold-shock DNA-binding protein family 0.99 1 69 GO:0003677
GO:0005829
AF-A0A7Y4H5I2-F1-model_v4 Cold shock domain-containing protein 0.99 1 67 GO:0003676
GO:0005829

Map