F448677

General Info

Members Datasets Scaffolds Average Seq Length
461 233 922 219

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100068839|Ga0070670_1000688393
Length 260
Sequence MSQTYKVSRAASSVANLVGLVLTTFVLFKIYNSNIRLLTRKERFDFVIKYFQQHAPDAETELLYDNPFQLLVAVILSAQCTDKRVNMTTPAIFDKYPDAESLSKATFEELFPLVKSISYPNNKTKHLIGMAKMLVSDFKGQIPMTVEDLVKLPGVGRKTANVITSVIDEQPNMAVDTHVFRVAARIGLTVNAKTPLATEKQLIQLIPTELIHKAHHWLILHGRYICVARNPKCAQCGLKPVCKYYQKNILSRTLVSPINE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
152 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 2738541278 Niastella sp. CF465 Isolate Unclassified
229 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
230 2818991444 Filimonas endophytica 3197 Isolate Unclassified
231 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
232 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
233 2904467357 Chitinophaga sancti 3198 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0
Rhizoplane 2.17
Rhizosphere 89.37
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100068839 3300005331 Bacteria 3038
2 SwRhRL2b_contig_2847592 2162886007 Bacteria 1363
3 rootL2_10044612 3300003322 Bacteria 2494
4 rootL2_10199477 3300003322 Bacteria 2418
5 rootL2_10273467 3300003322 Bacteria 1891
6 rootH1_10066352 3300003323 Bacteria 3940
7 rootH1_10090583 3300003323 Bacteria 1145
8 Ga0065165_1011759 3300005262 Bacteria 3613
9 Ga0065704_10082877 3300005289 Bacteria 3540
10 Ga0065707_10174190 3300005295 Unclassified 1462
11 Ga0070658_10007651 3300005327 Bacteria 8711
12 Ga0070676_10005937 3300005328 Bacteria 6515
13 Ga0070676_10240526 3300005328 Bacteria 1204
14 Ga0070690_100013006 3300005330 Unclassified 4908
15 Ga0070670_100114351 3300005331 Bacteria 2327
16 Ga0070677_10140414 3300005333 Unclassified 1113
17 Ga0068869_100061471 3300005334 Bacteria 2755
18 Ga0068869_100074242 3300005334 Unclassified 2524
19 Ga0068869_100127623 3300005334 Bacteria 1952
20 Ga0068869_100144482 3300005334 Unclassified 1840
21 Ga0068869_100209532 3300005334 Bacteria 1540
22 Ga0068869_100587806 3300005334 Bacteria 939
23 Ga0070666_10000072 3300005335 Bacteria 75356
24 Ga0070666_10008467 3300005335 Bacteria 6389
25 Ga0068868_100001449 3300005338 Bacteria 16363
26 Ga0068868_100016699 3300005338 Bacteria 5458
27 Ga0068868_100039206 3300005338 Bacteria 3680
28 Ga0068868_100079595 3300005338 Bacteria 2625
29 Ga0070660_100475713 3300005339 Bacteria 1038
30 Ga0070689_100093985 3300005340 Bacteria 2367
31 Ga0070689_100197402 3300005340 Unclassified 1641
32 Ga0070691_10025176 3300005341 Bacteria 2770
33 Ga0070661_100479198 3300005344 Bacteria 993
34 Ga0070668_100003854 3300005347 Bacteria 11069
35 Ga0070669_100241758 3300005353 Bacteria 1434
36 Ga0070675_100282146 3300005354 Bacteria 1460
37 Ga0070671_100043535 3300005355 Bacteria 3730
38 Ga0070671_100056934 3300005355 Bacteria 3253
39 Ga0070671_100122062 3300005355 Bacteria 2193
40 Ga0070671_100893274 3300005355 Bacteria 776
41 Ga0070674_100080251 3300005356 Unclassified 2329
42 Ga0070673_100004768 3300005364 Bacteria 8614
43 Ga0070673_100008243 3300005364 Bacteria 6918
44 Ga0070667_100000867 3300005367 Bacteria 28069
45 Ga0070667_100023752 3300005367 Bacteria 5089
46 Ga0070667_100048286 3300005367 Bacteria 3582
47 Ga0070667_100179831 3300005367 Unclassified 1870
48 Ga0070667_100467321 3300005367 Bacteria 1154
49 Ga0070714_100428979 3300005435 Bacteria 1253
50 Ga0070700_100466398 3300005441 Bacteria 964
51 Ga0070694_100284285 3300005444 Bacteria 1262
52 Ga0070678_100003213 3300005456 Bacteria 9070
53 Ga0070662_100001674 3300005457 Bacteria 13637
54 Ga0070662_100018997 3300005457 Bacteria 4659
55 Ga0070681_10207207 3300005458 Bacteria 1877
56 Ga0068867_100013731 3300005459 Bacteria 5736
57 Ga0068867_100075189 3300005459 Bacteria 2533
58 Ga0068867_100269568 3300005459 Bacteria 1391
59 Ga0068867_100546516 3300005459 Unclassified 1003
60 Ga0068867_100658664 3300005459 Bacteria 919
61 Ga0070685_10270097 3300005466 Bacteria 1134
62 Ga0070699_100839388 3300005518 Bacteria 841
63 Ga0070697_100415146 3300005536 Bacteria 1169
64 Ga0068853_100002148 3300005539 Bacteria 14676
65 Ga0068853_100039459 3300005539 Bacteria 4027
66 Ga0068853_100086389 3300005539 Bacteria 2751
67 Ga0068853_100130204 3300005539 Bacteria 2252
68 Ga0068853_100316086 3300005539 Bacteria 1447
69 Ga0068853_100351567 3300005539 Unclassified 1371
70 Ga0068853_100529033 3300005539 Bacteria 1115
71 Ga0070672_100220697 3300005543 Bacteria 1590
72 Ga0070695_100271599 3300005545 Bacteria 1242
73 Ga0070693_100021776 3300005547 Bacteria 3400
74 Ga0070665_100000318 3300005548 Bacteria 74326
75 Ga0070704_100635467 3300005549 Bacteria 941
76 Ga0068855_100011556 3300005563 Bacteria 10663
77 Ga0068855_100150691 3300005563 Bacteria 2645
78 Ga0068855_100310700 3300005563 Unclassified 1744
79 Ga0070664_100151480 3300005564 Unclassified 2048
80 Ga0068857_100084601 3300005577 Bacteria 2835
81 Ga0068857_100092087 3300005577 Bacteria 2714
82 Ga0068857_100216505 3300005577 Bacteria 1749
83 Ga0068854_100415318 3300005578 Unclassified 1116
84 Ga0068856_100050780 3300005614 Bacteria 4089
85 Ga0068856_100132089 3300005614 Bacteria 2502
86 Ga0068852_100001821 3300005616 Bacteria 14493
87 Ga0068852_100011011 3300005616 Bacteria 6786
88 Ga0068852_100016882 3300005616 Bacteria 5710
89 Ga0068852_100109976 3300005616 Bacteria 2503
90 Ga0068859_100000006 3300005617 Bacteria 421509
91 Ga0068859_100000639 3300005617 Bacteria 34980
92 Ga0068859_100029899 3300005617 Bacteria 5465
93 Ga0068859_100032162 3300005617 Bacteria 5270
94 Ga0068859_100459515 3300005617 Bacteria 1369
95 Ga0068859_100772708 3300005617 Unclassified 1049
96 Ga0068864_100003890 3300005618 Bacteria 12297
97 Ga0068864_100451284 3300005618 Bacteria 1230
98 Ga0068864_100676182 3300005618 Bacteria 1007
99 Ga0068866_10013183 3300005718 Bacteria 3619
100 Ga0068866_10050332 3300005718 Bacteria 2115
101 Ga0068851_10001667 3300005834 Bacteria 9732
102 Ga0068851_10099183 3300005834 Bacteria 1543
103 Ga0068870_10001518 3300005840 Bacteria 9418
104 Ga0068863_100006901 3300005841 Bacteria 11127
105 Ga0068863_100010664 3300005841 Bacteria 8921
106 Ga0068863_100036982 3300005841 Bacteria 4648
107 Ga0068858_100000978 3300005842 Bacteria 29516
108 Ga0068858_100006220 3300005842 Bacteria 11634
109 Ga0068858_101122241 3300005842 Bacteria 772
110 Ga0068860_100001713 3300005843 Bacteria 23427
111 Ga0068860_100001937 3300005843 Bacteria 21898
112 Ga0068860_100006239 3300005843 Bacteria 11978
113 Ga0068860_100013129 3300005843 Bacteria 8128
114 Ga0068860_100199227 3300005843 Bacteria 1940
115 Ga0068862_100005509 3300005844 Bacteria 10574
116 Ga0068862_100292532 3300005844 Bacteria 1496
117 Ga0068862_100364619 3300005844 Unclassified 1343
118 Ga0068862_100560531 3300005844 Bacteria 1092
119 Ga0075366_10003065 3300006195 Bacteria 8726
120 Ga0075366_10019693 3300006195 Bacteria 3909
121 Ga0075366_10051152 3300006195 Bacteria 2455
122 Ga0097621_100004096 3300006237 Bacteria 10111
123 Ga0097621_100009570 3300006237 Bacteria 7042
124 Ga0097621_100023550 3300006237 Bacteria 4795
125 Ga0097621_100071290 3300006237 Bacteria 2871
126 Ga0097621_100306998 3300006237 Unclassified 1403
127 Ga0068871_100019230 3300006358 Bacteria 5213
128 Ga0068871_100019320 3300006358 Bacteria 5201
129 Ga0068871_100039691 3300006358 Bacteria 3768
130 Ga0068871_100042294 3300006358 Bacteria 3657
131 Ga0068871_100051578 3300006358 Bacteria 3331
132 Ga0068871_100060808 3300006358 Bacteria 3082
133 Ga0068871_100163564 3300006358 Bacteria 1904
134 Ga0068871_100174141 3300006358 Bacteria 1846
135 Ga0075428_100027400 3300006844 Bacteria 6305
136 Ga0075430_100008093 3300006846 Bacteria 8885
137 Ga0075433_10525057 3300006852 Bacteria 1041
138 Ga0075429_100023176 3300006880 Bacteria 5384
139 Ga0068865_100027002 3300006881 Bacteria 3789
140 Ga0097620_100000006 3300006931 Bacteria 421509
141 Ga0097620_100000639 3300006931 Bacteria 34980
142 Ga0097620_100029900 3300006931 Bacteria 5465
143 Ga0097620_100032162 3300006931 Bacteria 5270
144 Ga0097620_100459476 3300006931 Bacteria 1369
145 Ga0097620_100772564 3300006931 Unclassified 1049
146 Ga0105240_10009898 3300009093 Bacteria 13445
147 Ga0105240_10012427 3300009093 Bacteria 11755
148 Ga0105240_10122293 3300009093 Bacteria 3132
149 Ga0105240_10280091 3300009093 Unclassified 1916
150 Ga0105240_10551128 3300009093 Bacteria 1276
151 Ga0111539_10002209 3300009094 Bacteria 25989
152 Ga0111539_11350976 3300009094 Unclassified 827
153 Ga0105245_10055008 3300009098 Bacteria 3574
154 Ga0105247_10018426 3300009101 Bacteria 4187
155 Ga0105247_10117808 3300009101 Unclassified 1717
156 Ga0105247_10280921 3300009101 Bacteria 1148
157 Ga0114129_10002294 3300009147 Bacteria 26500
158 Ga0105243_10052841 3300009148 Bacteria 3220
159 Ga0105243_10146175 3300009148 Bacteria 2023
160 Ga0105241_10070906 3300009174 Bacteria 2704
161 Ga0105241_10200256 3300009174 Unclassified 1667
162 Ga0105241_10241324 3300009174 Bacteria 1528
163 Ga0105242_10028526 3300009176 Bacteria 4446
164 Ga0105248_10052386 3300009177 Bacteria 4579
165 Ga0105237_10006111 3300009545 Bacteria 13458
166 Ga0105237_10079417 3300009545 Bacteria 3271
167 Ga0105237_10364019 3300009545 Bacteria 1450
168 Ga0105249_10002054 3300009553 Bacteria 17468
169 Ga0105249_10080242 3300009553 Bacteria 3030
170 Ga0105239_10011078 3300010375 Bacteria 10065
171 Ga0105239_10216708 3300010375 Bacteria 2146
172 Ga0105239_10490318 3300010375 Unclassified 1396
173 Ga0105246_10030336 3300011119 Bacteria 3570
174 Ga0105246_10109745 3300011119 Bacteria 2025
175 Ga0105246_10381805 3300011119 Bacteria 1164
176 Ga0157373_10230577 3300013100 Bacteria 1307
177 Ga0157370_10006044 3300013104 Bacteria 13457
178 Ga0157370_10314558 3300013104 Bacteria 1445
179 Ga0157370_10475564 3300013104 Bacteria 1148
180 Ga0157369_10077077 3300013105 Bacteria 3573
181 Ga0157369_10086180 3300013105 Bacteria 3355
182 Ga0157369_10169095 3300013105 Bacteria 2304
183 Ga0157374_10003691 3300013296 Bacteria 12871
184 Ga0157374_10031458 3300013296 Bacteria 4824
185 Ga0157374_10057888 3300013296 Bacteria 3621
186 Ga0157378_10002733 3300013297 Bacteria 15712
187 Ga0157378_10023109 3300013297 Bacteria 5472
188 Ga0157378_10108408 3300013297 Unclassified 2543
189 Ga0163162_10000112 3300013306 Bacteria 72032
190 Ga0163162_10001176 3300013306 Bacteria 24432
191 Ga0163162_10006924 3300013306 Bacteria 10993
192 Ga0163162_10052907 3300013306 Unclassified 4080
193 Ga0163162_10064335 3300013306 Bacteria 3713
194 Ga0163162_10224914 3300013306 Bacteria 2006
195 Ga0157372_10027137 3300013307 Bacteria 6233
196 Ga0157372_10092120 3300013307 Unclassified 3447
197 Ga0157372_10150748 3300013307 Bacteria 2684
198 Ga0157372_10317557 3300013307 Unclassified 1814
199 Ga0157372_10374573 3300013307 Unclassified 1659
200 Ga0157375_10016783 3300013308 Bacteria 6591
201 Ga0157375_10022627 3300013308 Bacteria 5787
202 Ga0157375_10024940 3300013308 Bacteria 5544
203 Ga0163163_10012397 3300014325 Bacteria 7765
204 Ga0163163_10034704 3300014325 Bacteria 4888
205 Ga0163163_10054751 3300014325 Bacteria 3942
206 Ga0163163_10182292 3300014325 Unclassified 2147
207 Ga0157380_10000895 3300014326 Bacteria 18734
208 Ga0157380_10205753 3300014326 Bacteria 1750
209 Ga0157377_10000392 3300014745 Bacteria 18955
210 Ga0157379_10011542 3300014968 Bacteria 7709
211 Ga0157379_10068244 3300014968 Bacteria 3179
212 Ga0157376_10027800 3300014969 Bacteria 4489
213 Ga0157376_10068212 3300014969 Bacteria 3011
214 Ga0157376_10104272 3300014969 Bacteria 2485
215 Ga0157376_10633102 3300014969 Bacteria 1068
216 Ga0157376_11572797 3300014969 Bacteria 691
217 Ga0163161_10021837 3300017792 Bacteria 4501
218 Ga0209436_101389 3300025208 Bacteria 8545
219 Ga0207426_1016646 3300025302 Bacteria 2633
220 Ga0207697_10044047 3300025315 Bacteria 1835
221 Ga0207697_10050852 3300025315 Unclassified 1711
222 Ga0207656_10012972 3300025321 Bacteria 3174
223 Ga0207656_10211308 3300025321 Unclassified 940
224 Ga0207682_10104654 3300025893 Unclassified 1240
225 Ga0207642_10093585 3300025899 Bacteria 1491
226 Ga0207710_10017476 3300025900 Bacteria 3042
227 Ga0207680_10000137 3300025903 Bacteria 34668
228 Ga0207680_10076489 3300025903 Bacteria 2090
229 Ga0207647_10000292 3300025904 Bacteria 41200
230 Ga0207645_10002213 3300025907 Bacteria 15508
231 Ga0207645_10022793 3300025907 Bacteria 4071
232 Ga0207705_10005337 3300025909 Bacteria 9612
233 Ga0207654_10001678 3300025911 Bacteria 11582
234 Ga0207654_10253655 3300025911 Unclassified 1180
235 Ga0207707_10075212 3300025912 Bacteria 2946
236 Ga0207695_10041263 3300025913 Bacteria 4940
237 Ga0207695_10097479 3300025913 Bacteria 2941
238 Ga0207671_10000453 3300025914 Bacteria 56447
239 Ga0207671_10047265 3300025914 Bacteria 3185
240 Ga0207660_10043753 3300025917 Bacteria 3147
241 Ga0207657_10382549 3300025919 Bacteria 1108
242 Ga0207652_10278741 3300025921 Bacteria 1508
243 Ga0207681_10009948 3300025923 Bacteria 5821
244 Ga0207681_10472369 3300025923 Unclassified 1023
245 Ga0207650_10017905 3300025925 Bacteria 4964
246 Ga0207659_10004664 3300025926 Bacteria 8302
247 Ga0207659_10791914 3300025926 Bacteria 814
248 Ga0207659_10874914 3300025926 Bacteria 772
249 Ga0207644_10189247 3300025931 Unclassified 1617
250 Ga0207644_10936691 3300025931 Bacteria 726
251 Ga0207706_10013778 3300025933 Bacteria 7337
252 Ga0207706_10058717 3300025933 Unclassified 3388
253 Ga0207686_10025611 3300025934 Unclassified 3433
254 Ga0207686_10033836 3300025934 Bacteria 3053
255 Ga0207686_10068888 3300025934 Bacteria 2268
256 Ga0207670_10014373 3300025936 Bacteria 4698
257 Ga0207670_10165436 3300025936 Unclassified 1655
258 Ga0207670_10413209 3300025936 Bacteria 1081
259 Ga0207669_10013463 3300025937 Bacteria 4064
260 Ga0207704_10040934 3300025938 Bacteria 2713
261 Ga0207704_10051857 3300025938 Bacteria 2484
262 Ga0207704_10127302 3300025938 Unclassified 1756
263 Ga0207691_10122715 3300025940 Bacteria 2300
264 Ga0207691_10387973 3300025940 Bacteria 1192
265 Ga0207711_10095673 3300025941 Unclassified 2620
266 Ga0207689_10002434 3300025942 Bacteria 17330
267 Ga0207689_10024280 3300025942 Bacteria 5087
268 Ga0207689_10048070 3300025942 Bacteria 3520
269 Ga0207689_10099362 3300025942 Unclassified 2391
270 Ga0207689_10179598 3300025942 Unclassified 1745
271 Ga0207689_10433694 3300025942 Bacteria 1097
272 Ga0207679_10194158 3300025945 Unclassified 1690
273 Ga0207667_10004455 3300025949 Bacteria 17147
274 Ga0207651_10016139 3300025960 Bacteria 4364
275 Ga0207651_10590714 3300025960 Bacteria 970
276 Ga0207712_10023039 3300025961 Bacteria 4106
277 Ga0207712_10025776 3300025961 Unclassified 3910
278 Ga0207712_10032445 3300025961 Bacteria 3526
279 Ga0207668_10001230 3300025972 Bacteria 15234
280 Ga0207668_10105393 3300025972 Bacteria 2104
281 Ga0207668_10536713 3300025972 Bacteria 1011
282 Ga0207640_10023604 3300025981 Bacteria 3698
283 Ga0207640_10791883 3300025981 Bacteria 820
284 Ga0207658_10003547 3300025986 Bacteria 11014
285 Ga0207658_10069300 3300025986 Bacteria 2664
286 Ga0207658_10530590 3300025986 Bacteria 1051
287 Ga0207677_10061867 3300026023 Bacteria 2594
288 Ga0207677_10393736 3300026023 Bacteria 1173
289 Ga0207703_10002783 3300026035 Bacteria 14957
290 Ga0207703_10122590 3300026035 Unclassified 2234
291 Ga0207703_10132068 3300026035 Bacteria 2157
292 Ga0207639_10082263 3300026041 Bacteria 2552
293 Ga0207639_10176362 3300026041 Bacteria 1815
294 Ga0207639_10244773 3300026041 Unclassified 1561
295 Ga0207708_10317982 3300026075 Bacteria 1270
296 Ga0207702_10060154 3300026078 Bacteria 3238
297 Ga0207702_11133671 3300026078 Bacteria 776
298 Ga0207641_10000058 3300026088 Bacteria 166385
299 Ga0207641_10013907 3300026088 Bacteria 6601
300 Ga0207641_10024874 3300026088 Bacteria 4936
301 Ga0207648_10000739 3300026089 Bacteria 36659
302 Ga0207648_10002407 3300026089 Bacteria 20149
303 Ga0207648_10003048 3300026089 Bacteria 17709
304 Ga0207648_10066202 3300026089 Bacteria 3151
305 Ga0207676_10003311 3300026095 Bacteria 11435
306 Ga0207676_10023151 3300026095 Bacteria 4577
307 Ga0207676_10311516 3300026095 Bacteria 1441
308 Ga0207674_10011355 3300026116 Bacteria 10012
309 Ga0207674_10079189 3300026116 Bacteria 3291
310 Ga0207674_10292027 3300026116 Unclassified 1579
311 Ga0207674_10901469 3300026116 Bacteria 852
312 Ga0207675_100000610 3300026118 Bacteria 34895
313 Ga0207675_100320235 3300026118 Bacteria 1514
314 Ga0207675_100485277 3300026118 Unclassified 1229
315 Ga0207675_100539587 3300026118 Bacteria 1164
316 Ga0207683_10000651 3300026121 Bacteria 31796
317 Ga0207683_10002030 3300026121 Bacteria 17898
318 Ga0207698_10007968 3300026142 Bacteria 6673
319 Ga0207698_10406739 3300026142 Unclassified 1302
320 Ga0207698_10669540 3300026142 Bacteria 1030
321 Ga0207698_10839355 3300026142 Bacteria 923
322 Ga0207428_10018651 3300027907 Bacteria 5923
323 Ga0268265_10229837 3300028380 Bacteria 1629
324 Ga0268265_10988218 3300028380 Bacteria 831
325 Ga0268264_10000726 3300028381 Bacteria 37807
326 Ga0268264_10001477 3300028381 Bacteria 21934
327 Ga0268264_10010303 3300028381 Bacteria 7735
328 Ga0265327_10023703 3300031251 Bacteria 3626
329 Ga0265327_10043418 3300031251 Bacteria 2405
330 Ga0307513_10114277 3300031456 Bacteria 2685
331 Ga0307407_10162662 3300031903 Unclassified 1462
332 Ga0373933_0246559 3300035724 Unclassified 1150
333 Ga0395900_0935494 3300037418 Bacteria 789
334 Ga0395905_0017395 3300037471 Bacteria 6826
335 Ga0395905_0024815 3300037471 Bacteria 5658
336 Ga0395905_0112692 3300037471 Bacteria 2555
337 Ga0439436_0029013 3300041404 Bacteria 1612
338 Ga0439438_079272 3300041405 Bacteria 807
339 Ga0439439_0004082 3300041406 Bacteria 3263
340 Ga0439439_0009935 3300041406 Bacteria 2269
341 Ga0439439_0016946 3300041406 Bacteria 1788
342 Ga0439439_0051558 3300041406 Bacteria 1079
343 Ga0451791_1704220 3300041451 Bacteria 712
344 Ga0451795_0067844 3300041456 Bacteria 952
345 Ga0451795_0212506 3300041456 Bacteria 1795
346 Ga0451795_1544795 3300041456 Bacteria 995
347 Ga0451802_0344273 3300041460 Bacteria 1558
348 Ga0439442_008229 3300042002 Bacteria 2105
349 Ga0439449_0059056 3300042007 Bacteria 1416
350 Ga0439449_0127764 3300042007 Unclassified 944
351 Ga0439457_074467 3300042014 Bacteria 776
352 Ga0439462_0000682 3300042015 Bacteria 6905
353 Ga0439462_0036986 3300042015 Bacteria 1300
354 Ga0439434_0024776 3300042435 Bacteria 1810
355 Ga0451577_0007475 3300042876 Bacteria 10732
356 Ga0451577_0049539 3300042876 Bacteria 3751
357 Ga0466969_0000730 3300044656 Bacteria 17779
358 Ga0466972_0000082 3300044658 Bacteria 88592
359 Ga0466966_0000501 3300044684 Bacteria 25083
360 Ga0453684_1089952 3300044712 Bacteria 844
361 Ga0466968_0025213 3300044735 Bacteria 2434
362 Ga0466957_0049955 3300044842 Bacteria 2544
363 Ga0466959_0000035 3300045049 Bacteria 108669
364 Ga0451576_0170624 3300045051 Unclassified 2271
365 Ga0466967_0986196 3300045976 Bacteria 839
366 Ga0495638_0061196 3300046460 Unclassified 2327
367 Ga0495582_0033711 3300046473 Bacteria 2816
368 Ga0495645_0114279 3300046543 Bacteria 1908
369 Ga0495667_0277135 3300046559 Unclassified 1065
370 Ga0495668_0003738 3300046616 Bacteria 11178
371 Ga0495658_0086863 3300046683 Unclassified 1846
372 Ga0495670_0355451 3300046691 Bacteria 789
373 Ga0495604_0172278 3300047317 Unclassified 1521
374 Ga0495674_0223893 3300047319 Bacteria 1554
375 Ga0495674_0365214 3300047319 Bacteria 1170
376 Ga0495672_0006400 3300047320 Bacteria 9140
377 Ga0495672_0091934 3300047320 Bacteria 1664
378 Ga0495672_0131251 3300047320 Bacteria 1318
379 Ga0495686_0000005 3300047472 Bacteria 827143
380 Ga0495686_0067420 3300047472 Bacteria 2209
381 Ga0495602_0441782 3300048088 Bacteria 920
382 Ga0496104_0525068 3300048907 Bacteria 1095
383 Ga0496109_0115912 3300048912 Unclassified 2493
384 Ga0496114_0189905 3300048917 Unclassified 1797
385 Ga0496114_0472262 3300048917 Bacteria 1110
386 Ga0496115_0427116 3300048918 Bacteria 1073
387 Ga0496121_0000051 3300048924 Bacteria 315378
388 Ga0501032_0003107 3300049569 Bacteria 12808
389 Ga0501032_0416569 3300049569 Bacteria 862
390 Ga0501033_0066289 3300049570 Bacteria 2655
391 Ga0501034_0001878 3300049571 Bacteria 26626
392 Ga0501034_0007610 3300049571 Bacteria 11525
393 Ga0501034_0343109 3300049571 Bacteria 1423
394 Ga0501034_0686230 3300049571 Bacteria 923
395 Ga0501036_0017507 3300049572 Bacteria 5991
396 Ga0501037_0365516 3300049573 Bacteria 993
397 Ga0501039_0074510 3300049575 Bacteria 2638
398 Ga0501046_0004991 3300049580 Bacteria 11916
399 Ga0501046_0226922 3300049580 Unclassified 1381
400 Ga0501047_0103047 3300049581 Bacteria 2733
401 Ga0501047_0195330 3300049581 Bacteria 1886
402 Ga0501047_0211710 3300049581 Bacteria 1796
403 Ga0501048_0058861 3300049582 Bacteria 2723
404 Ga0501067_0411598 3300049583 Unclassified 754
405 Ga0501069_0346400 3300049585 Bacteria 875
406 Ga0501070_0082346 3300049586 Bacteria 2664
407 Ga0501070_0316636 3300049586 Bacteria 1269
408 Ga0501070_0364563 3300049586 Bacteria 1172
409 Ga0501073_0001997 3300049589 Bacteria 15220
410 Ga0501073_0018164 3300049589 Bacteria 5083
411 Ga0501073_0427359 3300049589 Bacteria 915
412 Ga0501074_0159581 3300049590 Bacteria 1610
413 Ga0501077_0514662 3300049593 Bacteria 768
414 Ga0501219_000084 3300049703 Bacteria 16050
415 Ga0501080_0043755 3300049742 Bacteria 4169
416 Ga0501080_0056266 3300049742 Bacteria 3663
417 Ga0501080_0119080 3300049742 Bacteria 2448
418 Ga0501080_0197815 3300049742 Bacteria 1846
419 Ga0501080_0751624 3300049742 Bacteria 857
420 Ga0501083_0139534 3300049744 Bacteria 1587
421 Ga0501241_002587 3300049758 Bacteria 3485
422 Ga0501044_0064780 3300049823 Bacteria 3729
423 Ga0501044_0260244 3300049823 Bacteria 1673
424 Ga0501044_0399853 3300049823 Bacteria 1286
425 Ga0501284_00017 3300050005 Bacteria 96362
426 nmdc:mga0k408_145079_c1 3300050493 Bacteria 1413
427 nmdc:mga0k408_234817_c1 3300050493 Bacteria 1095
428 nmdc:mga0k408_296440_c1 3300050493 Bacteria 965
429 nmdc:mga0k408_466928_c1 3300050493 Bacteria 749
430 nmdc:mga05p37_30260_c1 3300050507 Bacteria 6605
431 nmdc:mga0qj67_66795_c1 3300050509 Bacteria 2865
432 nmdc:mga06r32_29203_c1 3300050510 Bacteria 5166
433 nmdc:mga08y16_274593_c1 3300050511 Unclassified 1739
434 nmdc:mga08y16_38826_c1 3300050511 Bacteria 4997
435 nmdc:mga0a205_510771_c1 3300050515 Bacteria 1058
436 Ga0500646_0002966 3300053090 Bacteria 4352
437 Ga0500646_0035759 3300053090 Bacteria 1382
438 Ga0500583_0000003 3300053092 Bacteria 229587
439 Ga0500583_0001287 3300053092 Bacteria 7160
440 Ga0500583_0102591 3300053092 Bacteria 1403
441 Ga0500641_0004752 3300053096 Bacteria 4807
442 Ga0500568_0008570 3300053139 Unclassified 4918
443 Ga0500568_0068664 3300053139 Unclassified 1360
444 Ga0500589_007963 3300053147 Bacteria 4378
445 Ga0500604_0011689 3300053151 Bacteria 2362
446 Ga0500604_0120764 3300053151 Bacteria 876
447 Ga0500616_0094598 3300053153 Bacteria 1472
448 Ga0500622_0000340 3300053156 Bacteria 45986
449 Ga0500622_0048090 3300053156 Bacteria 2201
450 Ga0500611_000008 3300053727 Bacteria 198346
451 Ga0500645_012907 3300053730 Bacteria 2692
452 Ga0500645_013380 3300053730 Bacteria 2633
453 Ga0501084_0041221 3300054114 Bacteria 3862
454 Ga0501084_0231815 3300054114 Unclassified 1558
455 Ga0501082_0300674 3300060353 Unclassified 1397
456 2738725659 2738541278 Bacteria 9755573
457 2819577318 2818991442 Bacteria 8318214
458 2819585529 2818991444 Bacteria 6968812
459 2821140621 2821136567 Bacteria 8080116
460 2896115302 2896109856 Bacteria 7140722
461 2904473040 2904467357 Bacteria 8057758
462 Ga0070670_100068839
463 SwRhRL2b_contig_2847592
464 rootL2_10044612
465 rootL2_10199477
466 rootL2_10273467
467 rootH1_10066352
468 rootH1_10090583
469 Ga0065165_1011759
470 Ga0065704_10082877
471 Ga0065707_10174190
472 Ga0070658_10007651
473 Ga0070676_10005937
474 Ga0070676_10240526
475 Ga0070690_100013006
476 Ga0070670_100114351
477 Ga0070677_10140414
478 Ga0068869_100061471
479 Ga0068869_100074242
480 Ga0068869_100127623
481 Ga0068869_100144482
482 Ga0068869_100209532
483 Ga0068869_100587806
484 Ga0070666_10000072
485 Ga0070666_10008467
486 Ga0068868_100001449
487 Ga0068868_100016699
488 Ga0068868_100039206
489 Ga0068868_100079595
490 Ga0070660_100475713
491 Ga0070689_100093985
492 Ga0070689_100197402
493 Ga0070691_10025176
494 Ga0070661_100479198
495 Ga0070668_100003854
496 Ga0070669_100241758
497 Ga0070675_100282146
498 Ga0070671_100043535
499 Ga0070671_100056934
500 Ga0070671_100122062
501 Ga0070671_100893274
502 Ga0070674_100080251
503 Ga0070673_100004768
504 Ga0070673_100008243
505 Ga0070667_100000867
506 Ga0070667_100023752
507 Ga0070667_100048286
508 Ga0070667_100179831
509 Ga0070667_100467321
510 Ga0070714_100428979
511 Ga0070700_100466398
512 Ga0070694_100284285
513 Ga0070678_100003213
514 Ga0070662_100001674
515 Ga0070662_100018997
516 Ga0070681_10207207
517 Ga0068867_100013731
518 Ga0068867_100075189
519 Ga0068867_100269568
520 Ga0068867_100546516
521 Ga0068867_100658664
522 Ga0070685_10270097
523 Ga0070699_100839388
524 Ga0070697_100415146
525 Ga0068853_100002148
526 Ga0068853_100039459
527 Ga0068853_100086389
528 Ga0068853_100130204
529 Ga0068853_100316086
530 Ga0068853_100351567
531 Ga0068853_100529033
532 Ga0070672_100220697
533 Ga0070695_100271599
534 Ga0070693_100021776
535 Ga0070665_100000318
536 Ga0070704_100635467
537 Ga0068855_100011556
538 Ga0068855_100150691
539 Ga0068855_100310700
540 Ga0070664_100151480
541 Ga0068857_100084601
542 Ga0068857_100092087
543 Ga0068857_100216505
544 Ga0068854_100415318
545 Ga0068856_100050780
546 Ga0068856_100132089
547 Ga0068852_100001821
548 Ga0068852_100011011
549 Ga0068852_100016882
550 Ga0068852_100109976
551 Ga0068859_100000006
552 Ga0068859_100000639
553 Ga0068859_100029899
554 Ga0068859_100032162
555 Ga0068859_100459515
556 Ga0068859_100772708
557 Ga0068864_100003890
558 Ga0068864_100451284
559 Ga0068864_100676182
560 Ga0068866_10013183
561 Ga0068866_10050332
562 Ga0068851_10001667
563 Ga0068851_10099183
564 Ga0068870_10001518
565 Ga0068863_100006901
566 Ga0068863_100010664
567 Ga0068863_100036982
568 Ga0068858_100000978
569 Ga0068858_100006220
570 Ga0068858_101122241
571 Ga0068860_100001713
572 Ga0068860_100001937
573 Ga0068860_100006239
574 Ga0068860_100013129
575 Ga0068860_100199227
576 Ga0068862_100005509
577 Ga0068862_100292532
578 Ga0068862_100364619
579 Ga0068862_100560531
580 Ga0075366_10003065
581 Ga0075366_10019693
582 Ga0075366_10051152
583 Ga0097621_100004096
584 Ga0097621_100009570
585 Ga0097621_100023550
586 Ga0097621_100071290
587 Ga0097621_100306998
588 Ga0068871_100019230
589 Ga0068871_100019320
590 Ga0068871_100039691
591 Ga0068871_100042294
592 Ga0068871_100051578
593 Ga0068871_100060808
594 Ga0068871_100163564
595 Ga0068871_100174141
596 Ga0075428_100027400
597 Ga0075430_100008093
598 Ga0075433_10525057
599 Ga0075429_100023176
600 Ga0068865_100027002
601 Ga0097620_100000006
602 Ga0097620_100000639
603 Ga0097620_100029900
604 Ga0097620_100032162
605 Ga0097620_100459476
606 Ga0097620_100772564
607 Ga0105240_10009898
608 Ga0105240_10012427
609 Ga0105240_10122293
610 Ga0105240_10280091
611 Ga0105240_10551128
612 Ga0111539_10002209
613 Ga0111539_11350976
614 Ga0105245_10055008
615 Ga0105247_10018426
616 Ga0105247_10117808
617 Ga0105247_10280921
618 Ga0114129_10002294
619 Ga0105243_10052841
620 Ga0105243_10146175
621 Ga0105241_10070906
622 Ga0105241_10200256
623 Ga0105241_10241324
624 Ga0105242_10028526
625 Ga0105248_10052386
626 Ga0105237_10006111
627 Ga0105237_10079417
628 Ga0105237_10364019
629 Ga0105249_10002054
630 Ga0105249_10080242
631 Ga0105239_10011078
632 Ga0105239_10216708
633 Ga0105239_10490318
634 Ga0105246_10030336
635 Ga0105246_10109745
636 Ga0105246_10381805
637 Ga0157373_10230577
638 Ga0157370_10006044
639 Ga0157370_10314558
640 Ga0157370_10475564
641 Ga0157369_10077077
642 Ga0157369_10086180
643 Ga0157369_10169095
644 Ga0157374_10003691
645 Ga0157374_10031458
646 Ga0157374_10057888
647 Ga0157378_10002733
648 Ga0157378_10023109
649 Ga0157378_10108408
650 Ga0163162_10000112
651 Ga0163162_10001176
652 Ga0163162_10006924
653 Ga0163162_10052907
654 Ga0163162_10064335
655 Ga0163162_10224914
656 Ga0157372_10027137
657 Ga0157372_10092120
658 Ga0157372_10150748
659 Ga0157372_10317557
660 Ga0157372_10374573
661 Ga0157375_10016783
662 Ga0157375_10022627
663 Ga0157375_10024940
664 Ga0163163_10012397
665 Ga0163163_10034704
666 Ga0163163_10054751
667 Ga0163163_10182292
668 Ga0157380_10000895
669 Ga0157380_10205753
670 Ga0157377_10000392
671 Ga0157379_10011542
672 Ga0157379_10068244
673 Ga0157376_10027800
674 Ga0157376_10068212
675 Ga0157376_10104272
676 Ga0157376_10633102
677 Ga0157376_11572797
678 Ga0163161_10021837
679 Ga0209436_101389
680 Ga0207426_1016646
681 Ga0207697_10044047
682 Ga0207697_10050852
683 Ga0207656_10012972
684 Ga0207656_10211308
685 Ga0207682_10104654
686 Ga0207642_10093585
687 Ga0207710_10017476
688 Ga0207680_10000137
689 Ga0207680_10076489
690 Ga0207647_10000292
691 Ga0207645_10002213
692 Ga0207645_10022793
693 Ga0207705_10005337
694 Ga0207654_10001678
695 Ga0207654_10253655
696 Ga0207707_10075212
697 Ga0207695_10041263
698 Ga0207695_10097479
699 Ga0207671_10000453
700 Ga0207671_10047265
701 Ga0207660_10043753
702 Ga0207657_10382549
703 Ga0207652_10278741
704 Ga0207681_10009948
705 Ga0207681_10472369
706 Ga0207650_10017905
707 Ga0207659_10004664
708 Ga0207659_10791914
709 Ga0207659_10874914
710 Ga0207644_10189247
711 Ga0207644_10936691
712 Ga0207706_10013778
713 Ga0207706_10058717
714 Ga0207686_10025611
715 Ga0207686_10033836
716 Ga0207686_10068888
717 Ga0207670_10014373
718 Ga0207670_10165436
719 Ga0207670_10413209
720 Ga0207669_10013463
721 Ga0207704_10040934
722 Ga0207704_10051857
723 Ga0207704_10127302
724 Ga0207691_10122715
725 Ga0207691_10387973
726 Ga0207711_10095673
727 Ga0207689_10002434
728 Ga0207689_10024280
729 Ga0207689_10048070
730 Ga0207689_10099362
731 Ga0207689_10179598
732 Ga0207689_10433694
733 Ga0207679_10194158
734 Ga0207667_10004455
735 Ga0207651_10016139
736 Ga0207651_10590714
737 Ga0207712_10023039
738 Ga0207712_10025776
739 Ga0207712_10032445
740 Ga0207668_10001230
741 Ga0207668_10105393
742 Ga0207668_10536713
743 Ga0207640_10023604
744 Ga0207640_10791883
745 Ga0207658_10003547
746 Ga0207658_10069300
747 Ga0207658_10530590
748 Ga0207677_10061867
749 Ga0207677_10393736
750 Ga0207703_10002783
751 Ga0207703_10122590
752 Ga0207703_10132068
753 Ga0207639_10082263
754 Ga0207639_10176362
755 Ga0207639_10244773
756 Ga0207708_10317982
757 Ga0207702_10060154
758 Ga0207702_11133671
759 Ga0207641_10000058
760 Ga0207641_10013907
761 Ga0207641_10024874
762 Ga0207648_10000739
763 Ga0207648_10002407
764 Ga0207648_10003048
765 Ga0207648_10066202
766 Ga0207676_10003311
767 Ga0207676_10023151
768 Ga0207676_10311516
769 Ga0207674_10011355
770 Ga0207674_10079189
771 Ga0207674_10292027
772 Ga0207674_10901469
773 Ga0207675_100000610
774 Ga0207675_100320235
775 Ga0207675_100485277
776 Ga0207675_100539587
777 Ga0207683_10000651
778 Ga0207683_10002030
779 Ga0207698_10007968
780 Ga0207698_10406739
781 Ga0207698_10669540
782 Ga0207698_10839355
783 Ga0207428_10018651
784 Ga0268265_10229837
785 Ga0268265_10988218
786 Ga0268264_10000726
787 Ga0268264_10001477
788 Ga0268264_10010303
789 Ga0265327_10023703
790 Ga0265327_10043418
791 Ga0307513_10114277
792 Ga0307407_10162662
793 Ga0373933_0246559
794 Ga0395900_0935494
795 Ga0395905_0017395
796 Ga0395905_0024815
797 Ga0395905_0112692
798 Ga0439436_0029013
799 Ga0439438_079272
800 Ga0439439_0004082
801 Ga0439439_0009935
802 Ga0439439_0016946
803 Ga0439439_0051558
804 Ga0451791_1704220
805 Ga0451795_0067844
806 Ga0451795_0212506
807 Ga0451795_1544795
808 Ga0451802_0344273
809 Ga0439442_008229
810 Ga0439449_0059056
811 Ga0439449_0127764
812 Ga0439457_074467
813 Ga0439462_0000682
814 Ga0439462_0036986
815 Ga0439434_0024776
816 Ga0451577_0007475
817 Ga0451577_0049539
818 Ga0466969_0000730
819 Ga0466972_0000082
820 Ga0466966_0000501
821 Ga0453684_1089952
822 Ga0466968_0025213
823 Ga0466957_0049955
824 Ga0466959_0000035
825 Ga0451576_0170624
826 Ga0466967_0986196
827 Ga0495638_0061196
828 Ga0495582_0033711
829 Ga0495645_0114279
830 Ga0495667_0277135
831 Ga0495668_0003738
832 Ga0495658_0086863
833 Ga0495670_0355451
834 Ga0495604_0172278
835 Ga0495674_0223893
836 Ga0495674_0365214
837 Ga0495672_0006400
838 Ga0495672_0091934
839 Ga0495672_0131251
840 Ga0495686_0000005
841 Ga0495686_0067420
842 Ga0495602_0441782
843 Ga0496104_0525068
844 Ga0496109_0115912
845 Ga0496114_0189905
846 Ga0496114_0472262
847 Ga0496115_0427116
848 Ga0496121_0000051
849 Ga0501032_0003107
850 Ga0501032_0416569
851 Ga0501033_0066289
852 Ga0501034_0001878
853 Ga0501034_0007610
854 Ga0501034_0343109
855 Ga0501034_0686230
856 Ga0501036_0017507
857 Ga0501037_0365516
858 Ga0501039_0074510
859 Ga0501046_0004991
860 Ga0501046_0226922
861 Ga0501047_0103047
862 Ga0501047_0195330
863 Ga0501047_0211710
864 Ga0501048_0058861
865 Ga0501067_0411598
866 Ga0501069_0346400
867 Ga0501070_0082346
868 Ga0501070_0316636
869 Ga0501070_0364563
870 Ga0501073_0001997
871 Ga0501073_0018164
872 Ga0501073_0427359
873 Ga0501074_0159581
874 Ga0501077_0514662
875 Ga0501219_000084
876 Ga0501080_0043755
877 Ga0501080_0056266
878 Ga0501080_0119080
879 Ga0501080_0197815
880 Ga0501080_0751624
881 Ga0501083_0139534
882 Ga0501241_002587
883 Ga0501044_0064780
884 Ga0501044_0260244
885 Ga0501044_0399853
886 Ga0501284_00017
887 nmdc:mga0k408_145079_c1
888 nmdc:mga0k408_234817_c1
889 nmdc:mga0k408_296440_c1
890 nmdc:mga0k408_466928_c1
891 nmdc:mga05p37_30260_c1
892 nmdc:mga0qj67_66795_c1
893 nmdc:mga06r32_29203_c1
894 nmdc:mga08y16_274593_c1
895 nmdc:mga08y16_38826_c1
896 nmdc:mga0a205_510771_c1
897 Ga0500646_0002966
898 Ga0500646_0035759
899 Ga0500583_0000003
900 Ga0500583_0001287
901 Ga0500583_0102591
902 Ga0500641_0004752
903 Ga0500568_0008570
904 Ga0500568_0068664
905 Ga0500589_007963
906 Ga0500604_0011689
907 Ga0500604_0120764
908 Ga0500616_0094598
909 Ga0500622_0000340
910 Ga0500622_0048090
911 Ga0500611_000008
912 Ga0500645_012907
913 Ga0500645_013380
914 Ga0501084_0041221
915 Ga0501084_0231815
916 Ga0501082_0300674
917 2738725659
918 2819577318
919 2819585529
920 2821140621
921 2896115302
922 2904473040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

72

208

0.96

PF00633

HHH

Helix-hairpin-helix motif

137

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9304 6 217
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9285 6 219
1p59-assembly1.cif.gz_A structure of a non-covalent endonuclease iii-dna complex 0.9244 6 219
1orp-assembly1.cif.gz_A structure of a trapped endonuclease iii-dna covalent intermediate: estranged-adenine complex 0.9221 6 217
2abk-assembly1.cif.gz_A refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom 0.9073 6 212
ID Description Score Start End Superfamily
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9443 29 137 1.10.340.30
af_P0AB83_21_132_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9396 28 137 1.10.340.30
af_Q58030_26_127_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9267 36 134 1.10.340.30
af_P9WQ11_33_143_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9198 29 137 1.10.340.30
af_Q09907_40_150_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9193 35 134 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A256WKV6-F1-model_v4 Endonuclease III 0.9706 6 196 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
AF-A0A1F1EFG2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9682 6 215 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-R6F186-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9678 6 213 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-G6B0A2-F1-model_v4 Endonuclease III (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase) 0.9671 6 213 GO:0003677
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539
GO:0140078
AF-A0A256WKV6-F1-model_v4 Endonuclease III 0.9656 6 196 GO:0003677
GO:0003906
GO:0004519
GO:0006285
GO:0019104
GO:0046872
GO:0051539

Map