F448697

General Info

Members Datasets Scaffolds Average Seq Length
461 259 920 342

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100024839|Ga0068856_1000248393
Length 345
Sequence MHMNRKRFLSSFLAPLAIAPVKGLRVFADGHEDDSLAAIRPRYLKPGDTIGITCPAGSITQQEIQPAMLQMIEWGFNIKVGDTVGKKDFTFGGTDEERARDFQQMIDDPKVKAIMCARGGYGFVRIIDKINFTKLVAKPKWIIGFSDITVLHCHLNRNYGMATIHSKMCNSFPDDWNKAEPIQIETILSIKQALIGAEKMKYSAPVNPLNKHGKAEGALVGGNLKTIETLAGTKSDIRTDNKILFVEDTGEYLYSIDRMFWNLKRTGKLEKLAALIVGGFKIKPDDPGEEFGRTVEEIVLEKVKNYHYPVCFDFPVGHQRNNYALKCGLNHKLTVGEDGVILKEV

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
162 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
196 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
217 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
218 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
219 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
220 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
226 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2738541278 Niastella sp. CF465 Isolate Unclassified
247 2738541283 Pedobacter sp. OK701 Isolate Unclassified
248 2738541302 Pedobacter sp. CF074 Isolate Unclassified
249 2738543023 Pedobacter sp. OK628 Isolate Unclassified
250 2739367651 Pedobacter sp. OK291 Isolate Unclassified
251 2739367656 Pedobacter sp. CF523 Isolate Unclassified
252 2739367663 Pedobacter sp. YR510 Isolate Unclassified
253 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
254 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
255 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
256 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
257 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
258 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
259 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0
Isolates 3.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 0
Rhizoplane 0.65
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100024839 3300005614 Bacteria 5837
2 SwRhRL2b_contig_2932149 2162886007 Bacteria 10985
3 JGI25152J39213_1000111 3300002773 Bacteria 57579
4 JGI25150J39212_1000009 3300002774 Bacteria 249509
5 JGI25151J46595_10000017 3300003187 Bacteria 249509
6 JGI25153J46596_10000023 3300003215 Bacteria 249509
7 rootH1_10043460 3300003316 Bacteria 9314
8 rootH2_10001202 3300003320 Bacteria 51390
9 rootH2_10037451 3300003320 Bacteria 28858
10 rootH2_10253432 3300003320 Bacteria 2827
11 rootL2_10008147 3300003322 Bacteria 3398
12 rootL2_10024437 3300003322 Bacteria 3630
13 rootL2_10209965 3300003322 Unclassified 2828
14 rootH1_10023435 3300003323 Bacteria 23065
15 Ga0055536_1000003 3300003781 Bacteria 447744
16 Ga0055530_10005502 3300003791 Bacteria 5994
17 Ga0065714_10002765 3300005288 Bacteria 65513
18 Ga0065714_10012852 3300005288 Bacteria 1752
19 Ga0065704_10000288 3300005289 Bacteria 77379
20 Ga0065704_10071650 3300005289 Bacteria 10385
21 Ga0065712_10011070 3300005290 Bacteria 2638
22 Ga0065712_10069521 3300005290 Bacteria 7132
23 Ga0065715_10102809 3300005293 Bacteria 3083
24 Ga0065707_10026134 3300005295 Unclassified 1180
25 Ga0070658_10005285 3300005327 Bacteria 10487
26 Ga0070676_10048328 3300005328 Unclassified 2487
27 Ga0070683_100002310 3300005329 Bacteria 15119
28 Ga0070683_100002782 3300005329 Bacteria 13982
29 Ga0070670_100047428 3300005331 Bacteria 3697
30 Ga0070670_100050817 3300005331 Unclassified 3562
31 Ga0070670_100107630 3300005331 Bacteria 2402
32 Ga0070677_10072266 3300005333 Bacteria 1454
33 Ga0068869_100003774 3300005334 Bacteria 9330
34 Ga0070666_10079539 3300005335 Bacteria 2239
35 Ga0070666_10144205 3300005335 Bacteria 1659
36 Ga0070666_10206089 3300005335 Bacteria 1384
37 Ga0070682_100000005 3300005337 Bacteria 386439
38 Ga0070682_100060512 3300005337 Bacteria 2395
39 Ga0068868_100026419 3300005338 Bacteria 4424
40 Ga0068868_100284621 3300005338 Bacteria 1400
41 Ga0068868_100465104 3300005338 Unclassified 1102
42 Ga0070660_100001218 3300005339 Bacteria 17473
43 Ga0070660_100141677 3300005339 Bacteria 1929
44 Ga0070689_100016954 3300005340 Bacteria 5341
45 Ga0070661_100052921 3300005344 Bacteria 2971
46 Ga0070669_100025766 3300005353 Bacteria 4225
47 Ga0070675_100074762 3300005354 Bacteria 2815
48 Ga0070675_100095353 3300005354 Bacteria 2498
49 Ga0070675_100257361 3300005354 Bacteria 1529
50 Ga0070671_100186222 3300005355 Bacteria 1759
51 Ga0070674_100108089 3300005356 Bacteria 2038
52 Ga0070673_100038472 3300005364 Bacteria 3653
53 Ga0070673_100256410 3300005364 Bacteria 1526
54 Ga0070688_100127284 3300005365 Unclassified 1714
55 Ga0070659_100001755 3300005366 Bacteria 15575
56 Ga0070659_100036370 3300005366 Bacteria 3839
57 Ga0070667_100133605 3300005367 Bacteria 2168
58 Ga0070667_100146045 3300005367 Bacteria 2074
59 Ga0070701_10049685 3300005438 Bacteria 2169
60 Ga0070678_100012996 3300005456 Bacteria 5200
61 Ga0070662_100047997 3300005457 Bacteria 3074
62 Ga0068867_100096403 3300005459 Unclassified 2252
63 Ga0070698_100001279 3300005471 Bacteria 28081
64 Ga0070698_100002592 3300005471 Bacteria 19910
65 Ga0070684_100014118 3300005535 Bacteria 6459
66 Ga0070684_100018210 3300005535 Bacteria 5782
67 Ga0068853_100001810 3300005539 Bacteria 15718
68 Ga0068853_100078283 3300005539 Unclassified 2889
69 Ga0068853_100156744 3300005539 Bacteria 2052
70 Ga0068853_100179005 3300005539 Unclassified 1922
71 Ga0070672_100039139 3300005543 Unclassified 3630
72 Ga0070672_100169287 3300005543 Bacteria 1816
73 Ga0070686_100038249 3300005544 Bacteria 2981
74 Ga0070686_100295105 3300005544 Bacteria 1200
75 Ga0068855_100001432 3300005563 Bacteria 29672
76 Ga0068855_100040018 3300005563 Bacteria 5564
77 Ga0068857_100003231 3300005577 Bacteria 13531
78 Ga0068857_100031441 3300005577 Bacteria 4691
79 Ga0068857_100323658 3300005577 Bacteria 1424
80 Ga0068854_100003818 3300005578 Bacteria 9429
81 Ga0068854_100093646 3300005578 Bacteria 2240
82 Ga0068852_100000424 3300005616 Bacteria 28108
83 Ga0068852_100138386 3300005616 Bacteria 2250
84 Ga0068859_100034496 3300005617 Bacteria 5078
85 Ga0068859_100436054 3300005617 Unclassified 1406
86 Ga0068864_100100086 3300005618 Bacteria 2569
87 Ga0068864_100136915 3300005618 Bacteria 2206
88 Ga0068861_100024539 3300005719 Bacteria 4361
89 Ga0068870_10005475 3300005840 Bacteria 5549
90 Ga0068858_100173690 3300005842 Bacteria 2033
91 Ga0068860_100000252 3300005843 Bacteria 79891
92 Ga0068860_100003398 3300005843 Bacteria 16371
93 Ga0068860_100023111 3300005843 Bacteria 6012
94 Ga0081540_1008958 3300005983 Bacteria 6928
95 Ga0097621_100002450 3300006237 Bacteria 12708
96 Ga0097621_100004097 3300006237 Bacteria 10111
97 Ga0097621_100081296 3300006237 Bacteria 2696
98 Ga0097621_100121208 3300006237 Bacteria 2218
99 Ga0068871_100001412 3300006358 Bacteria 16072
100 Ga0068871_100013603 3300006358 Bacteria 6043
101 Ga0068871_100027554 3300006358 Unclassified 4446
102 Ga0068871_100197388 3300006358 Bacteria 1736
103 Ga0075428_100038235 3300006844 Bacteria 5280
104 Ga0075431_100039382 3300006847 Bacteria 4868
105 Ga0097620_100034496 3300006931 Bacteria 5078
106 Ga0097620_100436033 3300006931 Unclassified 1406
107 Ga0105240_10000431 3300009093 Bacteria 77497
108 Ga0105240_10001434 3300009093 Bacteria 40792
109 Ga0105240_10003449 3300009093 Bacteria 24537
110 Ga0105240_10003572 3300009093 Bacteria 24125
111 Ga0105240_10003829 3300009093 Bacteria 23261
112 Ga0105240_10004355 3300009093 Bacteria 21610
113 Ga0105240_10006516 3300009093 Bacteria 17139
114 Ga0105240_10020767 3300009093 Bacteria 8749
115 Ga0105240_10024925 3300009093 Bacteria 7874
116 Ga0105240_10242760 3300009093 Bacteria 2087
117 Ga0105240_10257180 3300009093 Bacteria 2016
118 Ga0111539_10002057 3300009094 Bacteria 26904
119 Ga0111539_10009272 3300009094 Bacteria 12434
120 Ga0105245_10452338 3300009098 Bacteria 1293
121 Ga0114129_10002037 3300009147 Bacteria 27713
122 Ga0114129_10333505 3300009147 Unclassified 2013
123 Ga0105241_10002146 3300009174 Bacteria 14869
124 Ga0105242_10029348 3300009176 Bacteria 4386
125 Ga0105242_10224019 3300009176 Unclassified 1682
126 Ga0105242_10318496 3300009176 Bacteria 1426
127 Ga0105237_10002049 3300009545 Bacteria 25638
128 Ga0105237_10009667 3300009545 Bacteria 10322
129 Ga0105237_10014339 3300009545 Bacteria 8296
130 Ga0105237_10024976 3300009545 Bacteria 6113
131 Ga0105237_10040303 3300009545 Bacteria 4711
132 Ga0105237_10043497 3300009545 Bacteria 4523
133 Ga0105237_10078911 3300009545 Bacteria 3282
134 Ga0105238_10001088 3300009551 Bacteria 27427
135 Ga0105238_10013492 3300009551 Bacteria 8249
136 Ga0105238_10331505 3300009551 Bacteria 1509
137 Ga0105249_10002214 3300009553 Bacteria 16849
138 Ga0105249_10007217 3300009553 Bacteria 9695
139 Ga0105249_10050324 3300009553 Bacteria 3798
140 Ga0105239_10001881 3300010375 Bacteria 27435
141 Ga0105239_10002232 3300010375 Bacteria 24792
142 Ga0105239_10002512 3300010375 Bacteria 23336
143 Ga0105239_10012133 3300010375 Bacteria 9608
144 Ga0105239_10012220 3300010375 Bacteria 9571
145 Ga0105239_10024455 3300010375 Bacteria 6655
146 Ga0105239_10148225 3300010375 Bacteria 2618
147 Ga0105246_10037839 3300011119 Bacteria 3240
148 Ga0157373_10000043 3300013100 Bacteria 113422
149 Ga0157373_10025384 3300013100 Bacteria 4286
150 Ga0157373_10256164 3300013100 Bacteria 1238
151 Ga0157371_10002166 3300013102 Bacteria 19115
152 Ga0157371_10002575 3300013102 Bacteria 17198
153 Ga0157371_10006167 3300013102 Bacteria 9949
154 Ga0157371_10064551 3300013102 Bacteria 2594
155 Ga0157370_10002625 3300013104 Bacteria 21610
156 Ga0157370_10002741 3300013104 Bacteria 21072
157 Ga0157370_10006838 3300013104 Bacteria 12497
158 Ga0157370_10024877 3300013104 Bacteria 5928
159 Ga0157370_10063883 3300013104 Bacteria 3486
160 Ga0157370_10104367 3300013104 Bacteria 2653
161 Ga0157370_10117732 3300013104 Bacteria 2482
162 Ga0157370_10189139 3300013104 Bacteria 1911
163 Ga0157370_10192217 3300013104 Bacteria 1895
164 Ga0157369_10017716 3300013105 Bacteria 7999
165 Ga0157369_10063484 3300013105 Bacteria 3979
166 Ga0157369_10306246 3300013105 Bacteria 1652
167 Ga0157374_10000025 3300013296 Bacteria 245131
168 Ga0157374_10025814 3300013296 Bacteria 5281
169 Ga0157374_10051285 3300013296 Bacteria 3839
170 Ga0157374_10122966 3300013296 Bacteria 2506
171 Ga0157374_10232423 3300013296 Bacteria 1811
172 Ga0157378_10019172 3300013297 Bacteria 6012
173 Ga0157378_10051569 3300013297 Bacteria 3661
174 Ga0157378_10140148 3300013297 Bacteria 2245
175 Ga0157378_10462901 3300013297 Bacteria 1260
176 Ga0163162_10000124 3300013306 Bacteria 68603
177 Ga0163162_10000410 3300013306 Bacteria 39376
178 Ga0163162_10000994 3300013306 Bacteria 26396
179 Ga0163162_10002190 3300013306 Bacteria 18338
180 Ga0163162_10016117 3300013306 Bacteria 7306
181 Ga0163162_10033988 3300013306 Bacteria 5071
182 Ga0163162_10133741 3300013306 Bacteria 2590
183 Ga0157372_10000294 3300013307 Bacteria 55599
184 Ga0157372_10002269 3300013307 Bacteria 20833
185 Ga0157372_10474616 3300013307 Unclassified 1458
186 Ga0157375_10017191 3300013308 Bacteria 6520
187 Ga0157375_10027858 3300013308 Bacteria 5286
188 Ga0163163_10059845 3300014325 Bacteria 3769
189 Ga0163163_10168596 3300014325 Unclassified 2236
190 Ga0163163_10324883 3300014325 Bacteria 1592
191 Ga0157380_10009117 3300014326 Bacteria 7094
192 Ga0157380_10014693 3300014326 Bacteria 5733
193 Ga0157380_10142902 3300014326 Bacteria 2058
194 Ga0157380_10295421 3300014326 Bacteria 1489
195 Ga0182008_10000975 3300014497 Bacteria 19863
196 Ga0157377_10001182 3300014745 Bacteria 11091
197 Ga0157377_10106384 3300014745 Bacteria 1680
198 Ga0157379_10014882 3300014968 Bacteria 6825
199 Ga0157379_10019062 3300014968 Bacteria 6058
200 Ga0157376_10000404 3300014969 Bacteria 28086
201 Ga0157376_10016798 3300014969 Bacteria 5566
202 Ga0157376_10078856 3300014969 Bacteria 2822
203 Ga0157376_10281280 3300014969 Bacteria 1567
204 Ga0182006_1000244 3300015261 Bacteria 50752
205 Ga0182006_1000646 3300015261 Bacteria 24714
206 Ga0182006_1005799 3300015261 Bacteria 5820
207 Ga0182006_1007537 3300015261 Bacteria 4975
208 Ga0183373_1010 3300015682 Bacteria 196982
209 Ga0163161_10000468 3300017792 Bacteria 33545
210 Ga0163161_10001705 3300017792 Bacteria 16126
211 Ga0163161_10005954 3300017792 Bacteria 8455
212 Ga0163161_10008720 3300017792 Bacteria 7013
213 Ga0163161_10021017 3300017792 Bacteria 4587
214 Ga0207425_1000007 3300025245 Bacteria 777411
215 Ga0209129_1000006 3300025258 Bacteria 777761
216 Ga0209676_1000001 3300025292 Bacteria 1852142
217 Ga0209025_1000025 3300025294 Bacteria 524454
218 Ga0209758_1000016 3300025297 Bacteria 778557
219 Ga0209050_1000016 3300025298 Bacteria 729149
220 Ga0207682_10072225 3300025893 Bacteria 1464
221 Ga0207688_10003403 3300025901 Bacteria 8675
222 Ga0207680_10080217 3300025903 Bacteria 2049
223 Ga0207680_10134619 3300025903 Bacteria 1632
224 Ga0207647_10000017 3300025904 Bacteria 129999
225 Ga0207647_10078666 3300025904 Bacteria 1980
226 Ga0207645_10001413 3300025907 Bacteria 19673
227 Ga0207643_10003479 3300025908 Bacteria 8476
228 Ga0207643_10005893 3300025908 Bacteria 6546
229 Ga0207705_10028650 3300025909 Bacteria 3969
230 Ga0207654_10040557 3300025911 Bacteria 2624
231 Ga0207695_10000282 3300025913 Bacteria 126242
232 Ga0207695_10001411 3300025913 Bacteria 40483
233 Ga0207695_10001469 3300025913 Bacteria 39469
234 Ga0207695_10003026 3300025913 Bacteria 24133
235 Ga0207695_10012182 3300025913 Bacteria 10335
236 Ga0207695_10051044 3300025913 Bacteria 4346
237 Ga0207695_10054985 3300025913 Bacteria 4152
238 Ga0207695_10070785 3300025913 Unclassified 3563
239 Ga0207695_10091226 3300025913 Bacteria 3061
240 Ga0207695_10262773 3300025913 Bacteria 1623
241 Ga0207671_10004781 3300025914 Bacteria 12765
242 Ga0207671_10017316 3300025914 Bacteria 5560
243 Ga0207671_10039435 3300025914 Bacteria 3497
244 Ga0207671_10065465 3300025914 Bacteria 2704
245 Ga0207671_10070076 3300025914 Bacteria 2613
246 Ga0207671_10200790 3300025914 Bacteria 1557
247 Ga0207657_10054002 3300025919 Bacteria 3477
248 Ga0207649_10153529 3300025920 Bacteria 1588
249 Ga0207681_10139526 3300025923 Unclassified 1804
250 Ga0207694_10015366 3300025924 Bacteria 5774
251 Ga0207694_10271123 3300025924 Bacteria 1392
252 Ga0207650_10081616 3300025925 Bacteria 2453
253 Ga0207659_10027806 3300025926 Bacteria 3834
254 Ga0207659_10028669 3300025926 Bacteria 3786
255 Ga0207659_10067108 3300025926 Bacteria 2605
256 Ga0207659_10137444 3300025926 Unclassified 1893
257 Ga0207706_10011729 3300025933 Bacteria 7987
258 Ga0207686_10000722 3300025934 Bacteria 20514
259 Ga0207686_10160939 3300025934 Bacteria 1573
260 Ga0207670_10142309 3300025936 Bacteria 1770
261 Ga0207691_10010578 3300025940 Bacteria 8849
262 Ga0207691_10017968 3300025940 Bacteria 6698
263 Ga0207691_10018396 3300025940 Bacteria 6621
264 Ga0207691_10198620 3300025940 Bacteria 1746
265 Ga0207711_10046034 3300025941 Bacteria 3727
266 Ga0207689_10004939 3300025942 Bacteria 12012
267 Ga0207689_10180435 3300025942 Bacteria 1741
268 Ga0207661_10002021 3300025944 Bacteria 13987
269 Ga0207661_10109042 3300025944 Bacteria 2338
270 Ga0207667_10000403 3300025949 Bacteria 58481
271 Ga0207667_10001258 3300025949 Bacteria 31777
272 Ga0207667_10022507 3300025949 Bacteria 6959
273 Ga0207667_10125408 3300025949 Bacteria 2644
274 Ga0207651_10015187 3300025960 Bacteria 4468
275 Ga0207651_10136537 3300025960 Bacteria 1887
276 Ga0207712_10029647 3300025961 Bacteria 3673
277 Ga0207712_10279312 3300025961 Bacteria 1362
278 Ga0207668_10243040 3300025972 Unclassified 1458
279 Ga0207640_10066873 3300025981 Bacteria 2403
280 Ga0207658_10040812 3300025986 Bacteria 3357
281 Ga0207658_10129946 3300025986 Bacteria 2022
282 Ga0207658_10189548 3300025986 Bacteria 1708
283 Ga0207677_10319038 3300026023 Bacteria 1290
284 Ga0207703_10142123 3300026035 Bacteria 2084
285 Ga0207639_10018474 3300026041 Bacteria 4955
286 Ga0207639_10051504 3300026041 Unclassified 3132
287 Ga0207639_10411400 3300026041 Unclassified 1221
288 Ga0207702_10211699 3300026078 Bacteria 1802
289 Ga0207641_10000783 3300026088 Bacteria 33947
290 Ga0207648_10026399 3300026089 Bacteria 5161
291 Ga0207648_10051653 3300026089 Bacteria 3593
292 Ga0207676_10108651 3300026095 Bacteria 2316
293 Ga0207674_10000600 3300026116 Bacteria 47324
294 Ga0207674_10059731 3300026116 Bacteria 3857
295 Ga0207674_10106446 3300026116 Bacteria 2782
296 Ga0207675_100005681 3300026118 Bacteria 11937
297 Ga0207675_100039287 3300026118 Bacteria 4417
298 Ga0207683_10015154 3300026121 Bacteria 6560
299 Ga0207683_10128353 3300026121 Bacteria 2280
300 Ga0207698_10003680 3300026142 Bacteria 9265
301 Ga0207698_10011350 3300026142 Bacteria 5771
302 Ga0207698_10014452 3300026142 Bacteria 5249
303 Ga0209974_10051586 3300027876 Bacteria 1384
304 Ga0268266_10101682 3300028379 Bacteria 2534
305 Ga0268265_10190663 3300028380 Bacteria 1770
306 Ga0268264_10000015 3300028381 Bacteria 508501
307 Ga0268264_10000019 3300028381 Bacteria 488112
308 Ga0268264_10000054 3300028381 Bacteria 317048
309 Ga0268264_10002332 3300028381 Bacteria 16777
310 Ga0268264_10028905 3300028381 Bacteria 4538
311 Ga0307517_10001171 3300028786 Bacteria 44114
312 Ga0307517_10144687 3300028786 Bacteria 1654
313 Ga0307513_10138558 3300031456 Bacteria 2364
314 Ga0307509_10104247 3300031507 Bacteria 2862
315 Ga0307509_10155272 3300031507 Bacteria 2196
316 Ga0307508_10000162 3300031616 Bacteria 80675
317 Ga0307516_10054170 3300031730 Bacteria 3921
318 Ga0307406_10287470 3300031901 Bacteria 1257
319 Ga0307407_10000009 3300031903 Bacteria 188746
320 Ga0307412_10000075 3300031911 Bacteria 97612
321 Ga0307416_100000019 3300032002 Bacteria 199706
322 Ga0307414_10001789 3300032004 Bacteria 11123
323 Ga0307414_10136337 3300032004 Bacteria 1914
324 Ga0307510_10010057 3300033180 Bacteria 11243
325 Ga0373936_0047719 3300035113 Bacteria 1728
326 Ga0373935_0280077 3300035692 Bacteria 1174
327 Ga0395899_0025319 3300037312 Bacteria 4478
328 Ga0395900_0042519 3300037418 Bacteria 4682
329 Ga0395898_0029694 3300037466 Bacteria 5472
330 Ga0395905_0007445 3300037471 Bacteria 10889
331 Ga0395901_0064301 3300038443 Bacteria 3818
332 Ga0439436_0005395 3300041404 Bacteria 3915
333 Ga0451800_1238597 3300041459 Bacteria 1091
334 Ga0439442_003910 3300042002 Bacteria 2954
335 Ga0439449_0008697 3300042007 Bacteria 3854
336 Ga0439462_0005705 3300042015 Bacteria 3076
337 Ga0439434_0021436 3300042435 Bacteria 1941
338 Ga0466969_0000987 3300044656 Bacteria 15353
339 Ga0466972_0000032 3300044658 Bacteria 159445
340 Ga0466972_0000099 3300044658 Bacteria 76709
341 Ga0466972_0077574 3300044658 Bacteria 1582
342 Ga0453683_0073194 3300044673 Bacteria 2145
343 Ga0466966_0000054 3300044684 Bacteria 82352
344 Ga0466961_0115507 3300044693 Unclassified 1687
345 Ga0453684_0072272 3300044712 Bacteria 4356
346 Ga0466970_0034646 3300044765 Bacteria 2673
347 Ga0466957_0000656 3300044842 Bacteria 17549
348 Ga0466960_0070345 3300044901 Bacteria 1741
349 Ga0466959_0000012 3300045049 Bacteria 168961
350 Ga0466959_0000436 3300045049 Bacteria 24268
351 Ga0495638_0044975 3300046460 Bacteria 2780
352 Ga0495606_0003604 3300046507 Bacteria 16293
353 Ga0495610_0012275 3300046512 Bacteria 5170
354 Ga0495630_0053250 3300046517 Bacteria 3030
355 Ga0495630_0073510 3300046517 Bacteria 2575
356 Ga0495648_0001051 3300046524 Bacteria 28002
357 Ga0495621_0014082 3300046539 Bacteria 2525
358 Ga0495668_0003162 3300046616 Bacteria 12690
359 Ga0495634_0041202 3300046642 Bacteria 3137
360 Ga0495611_0002528 3300046648 Bacteria 8319
361 Ga0495625_0089322 3300046660 Bacteria 2133
362 Ga0495658_0005149 3300046683 Bacteria 6428
363 Ga0495670_0025666 3300046691 Bacteria 2915
364 Ga0495649_0058986 3300046694 Bacteria 2067
365 Ga0495672_0022983 3300047320 Unclassified 4044
366 Ga0495672_0026218 3300047320 Bacteria 3721
367 Ga0495676_0100694 3300047321 Bacteria 2139
368 Ga0496104_0343300 3300048907 Bacteria 1406
369 Ga0496115_0064676 3300048918 Bacteria 2953
370 Ga0496122_0000765 3300048925 Bacteria 62189
371 Ga0496123_0005845 3300048926 Bacteria 12189
372 Ga0501290_001589 3300049513 Bacteria 3062
373 Ga0501297_000579 3300049520 Bacteria 3311
374 Ga0501032_0036133 3300049569 Bacteria 3374
375 Ga0501032_0042507 3300049569 Bacteria 3082
376 Ga0501034_0011765 3300049571 Bacteria 9055
377 Ga0501034_0020155 3300049571 Bacteria 6807
378 Ga0501036_0031255 3300049572 Bacteria 4499
379 Ga0501037_0075581 3300049573 Bacteria 2446
380 Ga0501038_0015399 3300049574 Bacteria 6952
381 Ga0501038_0050071 3300049574 Bacteria 3611
382 Ga0501039_0049397 3300049575 Bacteria 3252
383 Ga0501043_0010222 3300049579 Bacteria 7355
384 Ga0501043_0061179 3300049579 Bacteria 2957
385 Ga0501043_0207902 3300049579 Bacteria 1517
386 Ga0501043_0302257 3300049579 Bacteria 1222
387 Ga0501046_0048001 3300049580 Bacteria 3382
388 Ga0501047_0003414 3300049581 Bacteria 15035
389 Ga0501047_0009295 3300049581 Bacteria 9283
390 Ga0501047_0029171 3300049581 Bacteria 5321
391 Ga0501047_0042976 3300049581 Bacteria 4366
392 Ga0501047_0180392 3300049581 Bacteria 1978
393 Ga0501048_0017746 3300049582 Bacteria 5237
394 Ga0501048_0150201 3300049582 Unclassified 1648
395 Ga0501070_0055996 3300049586 Bacteria 3269
396 Ga0501070_0143569 3300049586 Bacteria 1970
397 Ga0501073_0006622 3300049589 Bacteria 8625
398 Ga0501074_0002982 3300049590 Bacteria 11896
399 Ga0501198_002349 3300049649 Bacteria 2543
400 Ga0501202_000356 3300049652 Bacteria 6369
401 Ga0501206_001354 3300049653 Bacteria 3062
402 Ga0501217_000636 3300049661 Bacteria 5919
403 Ga0501217_007302 3300049661 Bacteria 2365
404 Ga0501224_000608 3300049664 Bacteria 4414
405 Ga0501235_000430 3300049669 Bacteria 8137
406 Ga0501235_025022 3300049669 Bacteria 1335
407 Ga0501243_000328 3300049675 Bacteria 6180
408 Ga0501249_033255 3300049679 Viruses 1155
409 Ga0501253_000404 3300049683 Bacteria 3637
410 Ga0501259_000947 3300049688 Bacteria 4793
411 Ga0501261_001046 3300049690 Bacteria 3398
412 Ga0501225_0000892 3300049705 Bacteria 9288
413 Ga0501225_0001221 3300049705 Bacteria 8004
414 Ga0501234_000801 3300049707 Bacteria 4924
415 Ga0501079_0160635 3300049741 Bacteria 1752
416 Ga0501083_0037414 3300049744 Bacteria 3306
417 Ga0501083_0068334 3300049744 Bacteria 2364
418 Ga0501241_007505 3300049758 Bacteria 1996
419 Ga0501241_008381 3300049758 Bacteria 1889
420 Ga0501273_004573 3300049770 Bacteria 1526
421 Ga0501035_0007679 3300049822 Bacteria 10075
422 Ga0501035_0081840 3300049822 Bacteria 2849
423 Ga0501044_0013869 3300049823 Bacteria 8710
424 Ga0501044_0055923 3300049823 Bacteria 4051
425 Ga0501044_0065602 3300049823 Bacteria 3702
426 Ga0501045_0116003 3300049824 Bacteria 1987
427 Ga0501284_00015 3300050005 Bacteria 104438
428 nmdc:mga0k408_21233_c1 3300050493 Bacteria 3645
429 nmdc:mga05p37_1846_c2 3300050507 Bacteria 21167
430 nmdc:mga06r32_144304_c1 3300050510 Bacteria 2358
431 nmdc:mga08y16_199945_c1 3300050511 Bacteria 2071
432 Ga0500578_0000001 3300053086 Bacteria 317120
433 Ga0500578_0061856 3300053086 Bacteria 2390
434 Ga0500583_0000048 3300053092 Bacteria 78503
435 Ga0500583_0000388 3300053092 Bacteria 14200
436 Ga0500583_0013232 3300053092 Bacteria 3184
437 Ga0500651_0002187 3300053093 Bacteria 10235
438 Ga0500555_039834 3300053103 Bacteria 1311
439 Ga0500568_0036638 3300053139 Bacteria 1995
440 Ga0500604_0004170 3300053151 Bacteria 3851
441 Ga0500622_0084532 3300053156 Unclassified 1584
442 Ga0500637_0011158 3300053178 Bacteria 4633
443 Ga0500587_008976 3300053739 Bacteria 1283
444 Ga0501084_0034032 3300054114 Bacteria 4261
445 Ga0501082_0046766 3300060353 Bacteria 3729
446 Ga0501082_0241808 3300060353 Bacteria 1571
447 2738728862 2738541278 Bacteria 9755573
448 2738759708 2738541283 Bacteria 7222293
449 2738853903 2738541302 Bacteria 5944758
450 2739305194 2738543023 Bacteria 6767879
451 2739588480 2739367651 Bacteria 6359826
452 2739617955 2739367656 Bacteria 5152243
453 2739645169 2739367663 Bacteria 5040914
454 2776613354 2775506987 Bacteria 5373360
455 2849284369 2849281842 Bacteria 6065644
456 2852631672 2852627209 Bacteria 5896285
457 2857631023 2857627736 Bacteria 5625397
458 2904445766 2904445276 Bacteria 5310396
459 2919187016 2919186247 Bacteria 6244071
460 2939665715 2939664404 Bacteria 6364494
461 Ga0068856_100024839
462 SwRhRL2b_contig_2932149
463 JGI25152J39213_1000111
464 JGI25150J39212_1000009
465 JGI25151J46595_10000017
466 JGI25153J46596_10000023
467 rootH1_10043460
468 rootH2_10001202
469 rootH2_10037451
470 rootH2_10253432
471 rootL2_10008147
472 rootL2_10024437
473 rootL2_10209965
474 rootH1_10023435
475 Ga0055536_1000003
476 Ga0055530_10005502
477 Ga0065714_10002765
478 Ga0065714_10012852
479 Ga0065704_10000288
480 Ga0065704_10071650
481 Ga0065712_10011070
482 Ga0065712_10069521
483 Ga0065715_10102809
484 Ga0065707_10026134
485 Ga0070658_10005285
486 Ga0070676_10048328
487 Ga0070683_100002310
488 Ga0070683_100002782
489 Ga0070670_100047428
490 Ga0070670_100050817
491 Ga0070670_100107630
492 Ga0070677_10072266
493 Ga0068869_100003774
494 Ga0070666_10079539
495 Ga0070666_10144205
496 Ga0070666_10206089
497 Ga0070682_100000005
498 Ga0070682_100060512
499 Ga0068868_100026419
500 Ga0068868_100284621
501 Ga0068868_100465104
502 Ga0070660_100001218
503 Ga0070660_100141677
504 Ga0070689_100016954
505 Ga0070661_100052921
506 Ga0070669_100025766
507 Ga0070675_100074762
508 Ga0070675_100095353
509 Ga0070675_100257361
510 Ga0070671_100186222
511 Ga0070674_100108089
512 Ga0070673_100038472
513 Ga0070673_100256410
514 Ga0070688_100127284
515 Ga0070659_100001755
516 Ga0070659_100036370
517 Ga0070667_100133605
518 Ga0070667_100146045
519 Ga0070701_10049685
520 Ga0070678_100012996
521 Ga0070662_100047997
522 Ga0068867_100096403
523 Ga0070698_100001279
524 Ga0070698_100002592
525 Ga0070684_100014118
526 Ga0070684_100018210
527 Ga0068853_100001810
528 Ga0068853_100078283
529 Ga0068853_100156744
530 Ga0068853_100179005
531 Ga0070672_100039139
532 Ga0070672_100169287
533 Ga0070686_100038249
534 Ga0070686_100295105
535 Ga0068855_100001432
536 Ga0068855_100040018
537 Ga0068857_100003231
538 Ga0068857_100031441
539 Ga0068857_100323658
540 Ga0068854_100003818
541 Ga0068854_100093646
542 Ga0068852_100000424
543 Ga0068852_100138386
544 Ga0068859_100034496
545 Ga0068859_100436054
546 Ga0068864_100100086
547 Ga0068864_100136915
548 Ga0068861_100024539
549 Ga0068870_10005475
550 Ga0068858_100173690
551 Ga0068860_100000252
552 Ga0068860_100003398
553 Ga0068860_100023111
554 Ga0081540_1008958
555 Ga0097621_100002450
556 Ga0097621_100004097
557 Ga0097621_100081296
558 Ga0097621_100121208
559 Ga0068871_100001412
560 Ga0068871_100013603
561 Ga0068871_100027554
562 Ga0068871_100197388
563 Ga0075428_100038235
564 Ga0075431_100039382
565 Ga0097620_100034496
566 Ga0097620_100436033
567 Ga0105240_10000431
568 Ga0105240_10001434
569 Ga0105240_10003449
570 Ga0105240_10003572
571 Ga0105240_10003829
572 Ga0105240_10004355
573 Ga0105240_10006516
574 Ga0105240_10020767
575 Ga0105240_10024925
576 Ga0105240_10242760
577 Ga0105240_10257180
578 Ga0111539_10002057
579 Ga0111539_10009272
580 Ga0105245_10452338
581 Ga0114129_10002037
582 Ga0114129_10333505
583 Ga0105241_10002146
584 Ga0105242_10029348
585 Ga0105242_10224019
586 Ga0105242_10318496
587 Ga0105237_10002049
588 Ga0105237_10009667
589 Ga0105237_10014339
590 Ga0105237_10024976
591 Ga0105237_10040303
592 Ga0105237_10043497
593 Ga0105237_10078911
594 Ga0105238_10001088
595 Ga0105238_10013492
596 Ga0105238_10331505
597 Ga0105249_10002214
598 Ga0105249_10007217
599 Ga0105249_10050324
600 Ga0105239_10001881
601 Ga0105239_10002232
602 Ga0105239_10002512
603 Ga0105239_10012133
604 Ga0105239_10012220
605 Ga0105239_10024455
606 Ga0105239_10148225
607 Ga0105246_10037839
608 Ga0157373_10000043
609 Ga0157373_10025384
610 Ga0157373_10256164
611 Ga0157371_10002166
612 Ga0157371_10002575
613 Ga0157371_10006167
614 Ga0157371_10064551
615 Ga0157370_10002625
616 Ga0157370_10002741
617 Ga0157370_10006838
618 Ga0157370_10024877
619 Ga0157370_10063883
620 Ga0157370_10104367
621 Ga0157370_10117732
622 Ga0157370_10189139
623 Ga0157370_10192217
624 Ga0157369_10017716
625 Ga0157369_10063484
626 Ga0157369_10306246
627 Ga0157374_10000025
628 Ga0157374_10025814
629 Ga0157374_10051285
630 Ga0157374_10122966
631 Ga0157374_10232423
632 Ga0157378_10019172
633 Ga0157378_10051569
634 Ga0157378_10140148
635 Ga0157378_10462901
636 Ga0163162_10000124
637 Ga0163162_10000410
638 Ga0163162_10000994
639 Ga0163162_10002190
640 Ga0163162_10016117
641 Ga0163162_10033988
642 Ga0163162_10133741
643 Ga0157372_10000294
644 Ga0157372_10002269
645 Ga0157372_10474616
646 Ga0157375_10017191
647 Ga0157375_10027858
648 Ga0163163_10059845
649 Ga0163163_10168596
650 Ga0163163_10324883
651 Ga0157380_10009117
652 Ga0157380_10014693
653 Ga0157380_10142902
654 Ga0157380_10295421
655 Ga0182008_10000975
656 Ga0157377_10001182
657 Ga0157377_10106384
658 Ga0157379_10014882
659 Ga0157379_10019062
660 Ga0157376_10000404
661 Ga0157376_10016798
662 Ga0157376_10078856
663 Ga0157376_10281280
664 Ga0182006_1000244
665 Ga0182006_1000646
666 Ga0182006_1005799
667 Ga0182006_1007537
668 Ga0183373_1010
669 Ga0163161_10000468
670 Ga0163161_10001705
671 Ga0163161_10005954
672 Ga0163161_10008720
673 Ga0163161_10021017
674 Ga0207425_1000007
675 Ga0209129_1000006
676 Ga0209676_1000001
677 Ga0209025_1000025
678 Ga0209758_1000016
679 Ga0209050_1000016
680 Ga0207682_10072225
681 Ga0207688_10003403
682 Ga0207680_10080217
683 Ga0207680_10134619
684 Ga0207647_10000017
685 Ga0207647_10078666
686 Ga0207645_10001413
687 Ga0207643_10003479
688 Ga0207643_10005893
689 Ga0207705_10028650
690 Ga0207654_10040557
691 Ga0207695_10000282
692 Ga0207695_10001411
693 Ga0207695_10001469
694 Ga0207695_10003026
695 Ga0207695_10012182
696 Ga0207695_10051044
697 Ga0207695_10054985
698 Ga0207695_10070785
699 Ga0207695_10091226
700 Ga0207695_10262773
701 Ga0207671_10004781
702 Ga0207671_10017316
703 Ga0207671_10039435
704 Ga0207671_10065465
705 Ga0207671_10070076
706 Ga0207671_10200790
707 Ga0207657_10054002
708 Ga0207649_10153529
709 Ga0207681_10139526
710 Ga0207694_10015366
711 Ga0207694_10271123
712 Ga0207650_10081616
713 Ga0207659_10027806
714 Ga0207659_10028669
715 Ga0207659_10067108
716 Ga0207659_10137444
717 Ga0207706_10011729
718 Ga0207686_10000722
719 Ga0207686_10160939
720 Ga0207670_10142309
721 Ga0207691_10010578
722 Ga0207691_10017968
723 Ga0207691_10018396
724 Ga0207691_10198620
725 Ga0207711_10046034
726 Ga0207689_10004939
727 Ga0207689_10180435
728 Ga0207661_10002021
729 Ga0207661_10109042
730 Ga0207667_10000403
731 Ga0207667_10001258
732 Ga0207667_10022507
733 Ga0207667_10125408
734 Ga0207651_10015187
735 Ga0207651_10136537
736 Ga0207712_10029647
737 Ga0207712_10279312
738 Ga0207668_10243040
739 Ga0207640_10066873
740 Ga0207658_10040812
741 Ga0207658_10129946
742 Ga0207658_10189548
743 Ga0207677_10319038
744 Ga0207703_10142123
745 Ga0207639_10018474
746 Ga0207639_10051504
747 Ga0207639_10411400
748 Ga0207702_10211699
749 Ga0207641_10000783
750 Ga0207648_10026399
751 Ga0207648_10051653
752 Ga0207676_10108651
753 Ga0207674_10000600
754 Ga0207674_10059731
755 Ga0207674_10106446
756 Ga0207675_100005681
757 Ga0207675_100039287
758 Ga0207683_10015154
759 Ga0207683_10128353
760 Ga0207698_10003680
761 Ga0207698_10011350
762 Ga0207698_10014452
763 Ga0209974_10051586
764 Ga0268266_10101682
765 Ga0268265_10190663
766 Ga0268264_10000015
767 Ga0268264_10000019
768 Ga0268264_10000054
769 Ga0268264_10002332
770 Ga0268264_10028905
771 Ga0307517_10001171
772 Ga0307517_10144687
773 Ga0307513_10138558
774 Ga0307509_10104247
775 Ga0307509_10155272
776 Ga0307508_10000162
777 Ga0307516_10054170
778 Ga0307406_10287470
779 Ga0307407_10000009
780 Ga0307412_10000075
781 Ga0307416_100000019
782 Ga0307414_10001789
783 Ga0307414_10136337
784 Ga0307510_10010057
785 Ga0373936_0047719
786 Ga0373935_0280077
787 Ga0395899_0025319
788 Ga0395900_0042519
789 Ga0395898_0029694
790 Ga0395905_0007445
791 Ga0395901_0064301
792 Ga0439436_0005395
793 Ga0451800_1238597
794 Ga0439442_003910
795 Ga0439449_0008697
796 Ga0439462_0005705
797 Ga0439434_0021436
798 Ga0466969_0000987
799 Ga0466972_0000032
800 Ga0466972_0000099
801 Ga0466972_0077574
802 Ga0453683_0073194
803 Ga0466966_0000054
804 Ga0466961_0115507
805 Ga0453684_0072272
806 Ga0466970_0034646
807 Ga0466957_0000656
808 Ga0466960_0070345
809 Ga0466959_0000012
810 Ga0466959_0000436
811 Ga0495638_0044975
812 Ga0495606_0003604
813 Ga0495610_0012275
814 Ga0495630_0053250
815 Ga0495630_0073510
816 Ga0495648_0001051
817 Ga0495621_0014082
818 Ga0495668_0003162
819 Ga0495634_0041202
820 Ga0495611_0002528
821 Ga0495625_0089322
822 Ga0495658_0005149
823 Ga0495670_0025666
824 Ga0495649_0058986
825 Ga0495672_0022983
826 Ga0495672_0026218
827 Ga0495676_0100694
828 Ga0496104_0343300
829 Ga0496115_0064676
830 Ga0496122_0000765
831 Ga0496123_0005845
832 Ga0501290_001589
833 Ga0501297_000579
834 Ga0501032_0036133
835 Ga0501032_0042507
836 Ga0501034_0011765
837 Ga0501034_0020155
838 Ga0501036_0031255
839 Ga0501037_0075581
840 Ga0501038_0015399
841 Ga0501038_0050071
842 Ga0501039_0049397
843 Ga0501043_0010222
844 Ga0501043_0061179
845 Ga0501043_0207902
846 Ga0501043_0302257
847 Ga0501046_0048001
848 Ga0501047_0003414
849 Ga0501047_0009295
850 Ga0501047_0029171
851 Ga0501047_0042976
852 Ga0501047_0180392
853 Ga0501048_0017746
854 Ga0501048_0150201
855 Ga0501070_0055996
856 Ga0501070_0143569
857 Ga0501073_0006622
858 Ga0501074_0002982
859 Ga0501198_002349
860 Ga0501202_000356
861 Ga0501206_001354
862 Ga0501217_000636
863 Ga0501217_007302
864 Ga0501224_000608
865 Ga0501235_000430
866 Ga0501235_025022
867 Ga0501243_000328
868 Ga0501249_033255
869 Ga0501253_000404
870 Ga0501259_000947
871 Ga0501261_001046
872 Ga0501225_0000892
873 Ga0501225_0001221
874 Ga0501234_000801
875 Ga0501079_0160635
876 Ga0501083_0037414
877 Ga0501083_0068334
878 Ga0501241_007505
879 Ga0501241_008381
880 Ga0501273_004573
881 Ga0501035_0007679
882 Ga0501035_0081840
883 Ga0501044_0013869
884 Ga0501044_0055923
885 Ga0501044_0065602
886 Ga0501045_0116003
887 Ga0501284_00015
888 nmdc:mga0k408_21233_c1
889 nmdc:mga05p37_1846_c2
890 nmdc:mga06r32_144304_c1
891 nmdc:mga08y16_199945_c1
892 Ga0500578_0000001
893 Ga0500578_0061856
894 Ga0500583_0000048
895 Ga0500583_0000388
896 Ga0500583_0013232
897 Ga0500651_0002187
898 Ga0500555_039834
899 Ga0500568_0036638
900 Ga0500604_0004170
901 Ga0500622_0084532
902 Ga0500637_0011158
903 Ga0500587_008976
904 Ga0501084_0034032
905 Ga0501082_0046766
906 Ga0501082_0241808
907 2738728862
908 2738759708
909 2738853903
910 2739305194
911 2739588480
912 2739617955
913 2739645169
914 2776613354
915 2849284369
916 2852631672
917 2857631023
918 2904445766
919 2919187016
920 2939665715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02016

Peptidase_S66

LD-carboxypeptidase N-terminal domain

50

166

0.95

PF17676

Peptidase_S66C

LD-carboxypeptidase C-terminal domain

216

333

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9216 51 345
6uuk-assembly1.cif.gz_B crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.9005 51 345
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8993 53 345
6uuk-assembly1.cif.gz_A crystal structure of muramoyltetrapeptide carboxypeptidase from oxalobacter formigenes 0.8814 53 345
5z01-assembly1.cif.gz_A-2 native escherichia coli l,d-carboxypeptidase a (ldca) 0.8813 49 345
ID Description Score Start End Superfamily
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.9234 211 335 3.50.30.60
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8962 41 196 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8832 35 201 3.40.50.10740
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8704 211 335 3.50.30.60
1zl0A02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.8686 211 343 3.50.30.60
ID Description Score Start End GO Terms
AF-A0A3C1T835-F1-model_v4 LD-carboxypeptidase 0.9955 40 346 GO:0004180
GO:0006508
GO:0008236
AF-A0A519YKH2-F1-model_v4 LD-carboxypeptidase N-terminal domain-containing protein 0.9942 43 144
AF-A0A4Q3TJZ9-F1-model_v4 deleted 0.9934 86 346
AF-A0A4Q3ATW3-F1-model_v4 LD-carboxypeptidase 0.9912 206 346 GO:0004180
GO:0006508
GO:0008236
AF-A0A3C1NNW9-F1-model_v4 LD-carboxypeptidase 0.991 165 346 GO:0004180
GO:0006508
GO:0008236

Map