F448715

General Info

Members Datasets Scaffolds Average Seq Length
461 289 922 321

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10001015|Ga0105244_100010157
Length 306
Sequence MFTPRRRTVLSLFALTSTLRIGYQKSSTLLTILKVRGQLEQDLAPLGVKVSWHEFSSGLPLLEALNVGGVDLSADVADTVPVFAQAAGAQLTYFAQEAPSPSAQAIVVRADAPYTSVADLKGKKIALTKAAGSHYLLIAALDKAGLRFKDIEPAYLTPADGRAAFERGSVAAWVTWDPYLAGVQRQSSVKILADGRNIADYQRYYLAATSYAEARSDVLAVVFEALRKTGKWVKQSPKEASELLAPAWGLDAKTVELANSRRSYDVRLVLKDALGEQQRIADAFYGEGLLPRKLDATAVPLWRGAK

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
94 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
115 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
116 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
117 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
193 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
194 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
198 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
201 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
202 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
203 2511231006 Pseudomonas sp. GM17 Isolate Nodule
204 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
205 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
206 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
207 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
208 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
209 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
210 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
211 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
212 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
213 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
214 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
215 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
216 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
217 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
218 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
219 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
220 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
221 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
222 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
223 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
224 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
225 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
226 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
227 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
228 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
229 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
230 2643221570 Acidovorax sp. Root568 Isolate Unclassified
231 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
232 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
233 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
234 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
235 2643221652 Acidovorax sp. Root402 Isolate Unclassified
236 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
237 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
238 2738541297 Duganella sp. GV083 Isolate Unclassified
239 2738541357 Duganella sp. GV053 Isolate Unclassified
240 2738543003 Duganella sp. GV066 Isolate Unclassified
241 2738543026 Duganella sp. GV089 Isolate Unclassified
242 2738543029 Duganella sp. GV039 Isolate Unclassified
243 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
244 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
245 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
246 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
247 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
248 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
249 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
250 2821131069 Duganella sp. 1224 Isolate Unclassified
251 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
252 2831864461 Roseateles noduli HZ7 Isolate Nodule
253 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
254 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
255 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
256 2842711865 Duganella sp. R-73148 Isolate Unclassified
257 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
258 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
259 2857553236 Duganella sp. R-74557 Isolate Unclassified
260 2857558681 Duganella sp. R-74565 Isolate Unclassified
261 2857564685 Duganella sp. R-74599 Isolate Unclassified
262 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
263 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
264 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
265 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
266 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
267 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
268 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
269 2904424332 Duganella sp. 1411 Isolate Rhizosphere
270 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
271 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
272 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
273 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
274 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
275 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
276 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
277 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
278 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
279 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
280 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
281 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
282 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
283 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
284 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
285 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
286 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
287 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
288 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
289 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.91
Metatranscriptomes 0
Isolates 19.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.52
Nodule 3.04
Rhizoplane 4.99
Rhizosphere 49.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10001015 3300009036 Bacteria 23506
2 JGI25155J39150_1000598 3300002704 Bacteria 7730
3 JGI25155J39150_1000632 3300002704 Bacteria 7232
4 JGI25156J39149_1000116 3300002705 Bacteria 57707
5 JGI25162J39368_1000014 3300002737 Bacteria 328873
6 JGI25154J39366_1000242 3300002738 Bacteria 35678
7 JGI25154J39366_1001605 3300002738 Bacteria 7701
8 JGI25157J39369_1000301 3300002741 Bacteria 35700
9 JGI25163J39215_1000165 3300002771 Bacteria 26186
10 JGI25164J39214_1000059 3300002772 Bacteria 111483
11 JGI25165J46597_1000027 3300003214 Bacteria 328873
12 JGI25153J46596_10011044 3300003215 Bacteria 4024
13 rootL2_10000441 3300003322 Bacteria 16020
14 rootH1_10026297 3300003323 Bacteria 6276
15 Ga0055538_1000117 3300003751 Bacteria 60939
16 Ga0055539_1000163 3300003752 Bacteria 60939
17 Ga0055533_1000166 3300003756 Bacteria 60939
18 Ga0055532_1000005 3300003758 Bacteria 458107
19 Ga0055525_1000227 3300003759 Bacteria 60939
20 Ga0055526_1002292 3300003771 Bacteria 13062
21 Ga0055526_1005476 3300003771 Bacteria 7286
22 Ga0055524_1000045 3300003775 Bacteria 151148
23 Ga0055524_1002816 3300003775 Bacteria 8737
24 Ga0055524_1023592 3300003775 Bacteria 1977
25 Ga0055536_1000026 3300003781 Bacteria 166220
26 Ga0055536_1000133 3300003781 Bacteria 63308
27 Ga0055534_1001063 3300003784 Bacteria 11875
28 Ga0055530_10000147 3300003791 Bacteria 63296
29 Ga0055530_10000960 3300003791 Bacteria 23448
30 Ga0055530_10031815 3300003791 Bacteria 1380
31 Ga0055540_1000149 3300003792 Bacteria 68747
32 Ga0055540_1000706 3300003792 Bacteria 22986
33 Ga0055540_1007247 3300003792 Bacteria 4231
34 Ga0055531_10010100 3300003794 Bacteria 4738
35 Ga0055541_1000109 3300003841 Bacteria 60939
36 Ga0065165_1000652 3300005262 Bacteria 50081
37 Ga0065704_10112908 3300005289 Bacteria 1923
38 Ga0070711_100233445 3300005439 Bacteria 1435
39 Ga0070706_100147132 3300005467 Bacteria 2200
40 Ga0070665_100014610 3300005548 Bacteria 7879
41 Ga0068855_100041389 3300005563 Bacteria 5461
42 Ga0068854_100004017 3300005578 Bacteria 9232
43 Ga0068856_100060251 3300005614 Bacteria 3750
44 Ga0068852_100003485 3300005616 Bacteria 11001
45 Ga0068861_100116536 3300005719 Bacteria 2148
46 Ga0075363_100092531 3300006048 Bacteria 1666
47 Ga0075362_10068920 3300006177 Bacteria 1612
48 Ga0075366_10130189 3300006195 Bacteria 1518
49 Ga0099823_1000004 3300006944 Bacteria 176518
50 Ga0079104_1000301 3300006946 Bacteria 62512
51 Ga0079104_1008951 3300006946 Bacteria 3435
52 Ga0079104_1011634 3300006946 Bacteria 2817
53 Ga0099826_10000074 3300006948 Bacteria 52710
54 Ga0105251_10018489 3300009011 Bacteria 3704
55 Ga0105251_10025671 3300009011 Bacteria 3010
56 Ga0105251_10031817 3300009011 Bacteria 2635
57 Ga0105244_10000377 3300009036 Bacteria 41493
58 Ga0105244_10000692 3300009036 Bacteria 29284
59 Ga0105250_10007826 3300009092 Bacteria 4572
60 Ga0105250_10009178 3300009092 Bacteria 4173
61 Ga0105240_10008790 3300009093 Bacteria 14389
62 Ga0105240_10034674 3300009093 Bacteria 6507
63 Ga0105240_10042117 3300009093 Bacteria 5822
64 Ga0105243_10010101 3300009148 Bacteria 7180
65 Ga0105237_10339650 3300009545 Bacteria 1506
66 Ga0105238_10000505 3300009551 Bacteria 41099
67 Ga0105238_10186971 3300009551 Bacteria 2048
68 Ga0157319_1000006 3300012497 Bacteria 361506
69 Ga0157371_10000147 3300013102 Bacteria 102369
70 Ga0157372_10541599 3300013307 Bacteria 1357
71 Ga0182008_10002837 3300014497 Bacteria 10718
72 Ga0182008_10012743 3300014497 Bacteria 4434
73 Ga0182008_10015207 3300014497 Bacteria 4018
74 Ga0182006_1004517 3300015261 Bacteria 6849
75 Ga0182006_1032511 3300015261 Bacteria 2097
76 Ga0182007_10008738 3300015262 Bacteria 4136
77 Ga0213872_10004114 3300021361 Bacteria 7828
78 Ga0213876_10051609 3300021384 Bacteria 2174
79 Ga0209435_100004 3300025206 Bacteria 633417
80 Ga0209435_100392 3300025206 Bacteria 9558
81 Ga0209760_100025 3300025207 Bacteria 156628
82 Ga0209784_100153 3300025224 Bacteria 62664
83 Ga0209566_100195 3300025225 Bacteria 62664
84 Ga0209674_100198 3300025226 Bacteria 62664
85 Ga0209147_100011 3300025229 Bacteria 702140
86 Ga0209563_100157 3300025230 Bacteria 62664
87 Ga0207427_100003 3300025231 Bacteria 1035004
88 Ga0209437_100002 3300025233 Bacteria 1574801
89 Ga0209437_100084 3300025233 Bacteria 255423
90 Ga0209258_100677 3300025242 Bacteria 23853
91 Ga0209646_1000032 3300025246 Bacteria 375315
92 Ga0209646_1000372 3300025246 Bacteria 29735
93 Ga0209026_1000128 3300025250 Bacteria 121958
94 Ga0209677_100156 3300025253 Bacteria 62664
95 Ga0209759_1000126 3300025256 Bacteria 134208
96 Ga0209759_1001169 3300025256 Bacteria 16573
97 Ga0209233_1000004 3300025261 Bacteria 1574798
98 Ga0209565_1004483 3300025263 Bacteria 4225
99 Ga0209455_1009571 3300025272 Bacteria 2534
100 Ga0209673_1016547 3300025273 Bacteria 2752
101 Ga0209675_1000026 3300025291 Bacteria 284716
102 Ga0209675_1003453 3300025291 Bacteria 7508
103 Ga0209676_1000003 3300025292 Bacteria 1454178
104 Ga0209676_1000059 3300025292 Bacteria 344882
105 Ga0209025_1000066 3300025294 Bacteria 298742
106 Ga0209564_1000003 3300025295 Bacteria 1585848
107 Ga0209564_1000084 3300025295 Bacteria 252729
108 Ga0209564_1000161 3300025295 Bacteria 162489
109 Ga0209758_1000262 3300025297 Bacteria 104339
110 Ga0209050_1000004 3300025298 Bacteria 1600040
111 Ga0209050_1000221 3300025298 Bacteria 126843
112 Ga0209050_1000537 3300025298 Bacteria 62966
113 Ga0209050_1010144 3300025298 Bacteria 4687
114 Ga0209256_1000143 3300025299 Bacteria 151331
115 Ga0209256_1000602 3300025299 Bacteria 49884
116 Ga0209256_1003716 3300025299 Bacteria 10351
117 Ga0209051_1000187 3300025303 Bacteria 109779
118 Ga0209051_1000345 3300025303 Bacteria 69229
119 Ga0209051_1000843 3300025303 Bacteria 31536
120 Ga0209051_1034776 3300025303 Bacteria 1884
121 Ga0209051_1045148 3300025303 Bacteria 1528
122 Ga0209257_1000685 3300025304 Bacteria 52685
123 Ga0209257_1007314 3300025304 Bacteria 6709
124 Ga0207696_1002185 3300025711 Bacteria 9800
125 Ga0207655_1000528 3300025728 Bacteria 48555
126 Ga0207655_1000646 3300025728 Bacteria 41672
127 Ga0207713_1001103 3300025735 Bacteria 23100
128 Ga0207713_1016966 3300025735 Bacteria 3676
129 Ga0207695_10004091 3300025913 Bacteria 20044
130 Ga0207695_10012830 3300025913 Bacteria 10034
131 Ga0207695_10031653 3300025913 Bacteria 5797
132 Ga0207694_10000392 3300025924 Bacteria 40819
133 Ga0207694_10018060 3300025924 Bacteria 5333
134 Ga0207709_10012938 3300025935 Bacteria 4601
135 Ga0207667_10029547 3300025949 Bacteria 5943
136 Ga0207640_10037899 3300025981 Bacteria 3037
137 Ga0207702_10043358 3300026078 Bacteria 3777
138 Ga0207698_10002874 3300026142 Bacteria 10300
139 Ga0209281_1000307 3300027111 Bacteria 87401
140 Ga0209281_1010660 3300027111 Bacteria 2093
141 Ga0209389_1000006 3300027296 Bacteria 231635
142 Ga0209371_1000049 3300027312 Bacteria 279132
143 Ga0209282_1000113 3300027666 Bacteria 52714
144 Ga0307517_10002205 3300028786 Bacteria 31473
145 Ga0307517_10113448 3300028786 Bacteria 2046
146 Ga0307515_10002443 3300028794 Bacteria 40478
147 Ga0307515_10034124 3300028794 Bacteria 8347
148 Ga0268256_1000031 3300030500 Bacteria 425730
149 Ga0307512_10041599 3300030522 Bacteria 3817
150 Ga0307512_10042244 3300030522 Bacteria 3777
151 Ga0307513_10036082 3300031456 Bacteria 5524
152 Ga0307513_10042366 3300031456 Bacteria 5013
153 Ga0307513_10143492 3300031456 Bacteria 2310
154 Ga0307509_10001611 3300031507 Bacteria 37857
155 Ga0307509_10115224 3300031507 Bacteria 2681
156 Ga0307514_10003638 3300031649 Bacteria 14632
157 Ga0307514_10022749 3300031649 Bacteria 5090
158 Ga0265342_10007300 3300031712 Bacteria 8113
159 Ga0307516_10004028 3300031730 Bacteria 18416
160 Ga0307516_10375812 3300031730 Bacteria 1083
161 Ga0307510_10016593 3300033180 Bacteria 8691
162 Ga0373936_0037221 3300035113 Bacteria 1943
163 Ga0395905_0050857 3300037471 Bacteria 3882
164 Ga0395905_0114370 3300037471 Bacteria 2535
165 Ga0436365_1927728 3300039437 Bacteria 1758
166 Ga0436361_0167284 3300039447 Bacteria 22857
167 Ga0439438_000544 3300041405 Bacteria 17157
168 Ga0451802_0352664 3300041460 Bacteria 3192
169 Ga0439463_000404 3300042016 Bacteria 11967
170 Ga0450902_001532 3300042137 Bacteria 3161
171 Ga0450905_000057 3300042142 Bacteria 10051
172 Ga0450901_000389 3300042533 Bacteria 5307
173 Ga0439440_0008592 3300042993 Bacteria 2100
174 Ga0466969_0130893 3300044656 Bacteria 1163
175 Ga0466977_0000237 3300044666 Bacteria 15239
176 Ga0466957_0116702 3300044842 Bacteria 1698
177 Ga0466957_0310350 3300044842 Bacteria 1062
178 Ga0495617_000003 3300046452 Bacteria 541914
179 Ga0495617_001935 3300046452 Bacteria 8688
180 Ga0495617_006662 3300046452 Bacteria 4036
181 Ga0495627_000008 3300046453 Bacteria 572150
182 Ga0495592_0000462 3300046454 Bacteria 30113
183 Ga0495590_0000001 3300046457 Bacteria 762984
184 Ga0495590_0016539 3300046457 Bacteria 2662
185 Ga0495590_0039613 3300046457 Bacteria 1644
186 Ga0495638_0002285 3300046460 Bacteria 15813
187 Ga0495638_0183653 3300046460 Bacteria 1191
188 Ga0495653_0000002 3300046463 Bacteria 507262
189 Ga0495650_0001043 3300046471 Bacteria 30879
190 Ga0495650_0002390 3300046471 Bacteria 15339
191 Ga0495605_0000068 3300046474 Bacteria 137743
192 Ga0495605_0002115 3300046474 Bacteria 12438
193 Ga0495605_0012206 3300046474 Bacteria 4770
194 Ga0495584_0000144 3300046491 Bacteria 49665
195 Ga0495584_0057414 3300046491 Bacteria 1958
196 Ga0495585_0003501 3300046492 Bacteria 10593
197 Ga0495596_0000740 3300046500 Bacteria 20152
198 Ga0495607_0004899 3300046501 Bacteria 9737
199 Ga0495607_0007873 3300046501 Bacteria 7331
200 Ga0495607_0026042 3300046501 Bacteria 3631
201 Ga0495607_0045373 3300046501 Bacteria 2586
202 Ga0495607_0064010 3300046501 Bacteria 2078
203 Ga0495583_0000021 3300046506 Bacteria 287046
204 Ga0495583_0007962 3300046506 Bacteria 6557
205 Ga0495606_0000220 3300046507 Bacteria 101211
206 Ga0495606_0000344 3300046507 Bacteria 79864
207 Ga0495606_0000545 3300046507 Bacteria 60465
208 Ga0495606_0003124 3300046507 Bacteria 17987
209 Ga0495606_0039888 3300046507 Bacteria 3158
210 Ga0495610_0000003 3300046512 Bacteria 1203910
211 Ga0495610_0001527 3300046512 Bacteria 20389
212 Ga0495610_0011846 3300046512 Bacteria 5298
213 Ga0495610_0012659 3300046512 Bacteria 5058
214 Ga0495610_0020618 3300046512 Bacteria 3656
215 Ga0495610_0029136 3300046512 Bacteria 2911
216 Ga0495616_0002236 3300046513 Bacteria 12958
217 Ga0495616_0003216 3300046513 Bacteria 10526
218 Ga0495631_0002060 3300046518 Bacteria 11721
219 Ga0495632_0013802 3300046519 Bacteria 4594
220 Ga0495637_0000214 3300046520 Bacteria 45088
221 Ga0495637_0003947 3300046520 Bacteria 7768
222 Ga0495643_0000028 3300046522 Bacteria 262886
223 Ga0495643_0000044 3300046522 Bacteria 226211
224 Ga0495643_0000772 3300046522 Bacteria 35775
225 Ga0495644_0001004 3300046523 Bacteria 11763
226 Ga0495648_0000326 3300046524 Bacteria 52532
227 Ga0495648_0001942 3300046524 Bacteria 19698
228 Ga0495648_0004851 3300046524 Bacteria 11354
229 Ga0495648_0007854 3300046524 Bacteria 8486
230 Ga0495648_0016106 3300046524 Bacteria 5395
231 Ga0495648_0124139 3300046524 Bacteria 1382
232 Ga0495654_0000292 3300046530 Bacteria 45100
233 Ga0495609_0000340 3300046538 Bacteria 41415
234 Ga0495609_0001232 3300046538 Bacteria 17613
235 Ga0495609_0003092 3300046538 Bacteria 9755
236 Ga0495597_0000072 3300046542 Bacteria 87914
237 Ga0495597_0000216 3300046542 Bacteria 52708
238 Ga0495597_0019833 3300046542 Bacteria 3141
239 Ga0495622_0048371 3300046557 Bacteria 1976
240 Ga0495633_0000055 3300046558 Bacteria 151013
241 Ga0495633_0001371 3300046558 Bacteria 19037
242 Ga0495633_0003496 3300046558 Bacteria 10429
243 Ga0495633_0018503 3300046558 Bacteria 3538
244 Ga0495633_0032019 3300046558 Bacteria 2543
245 Ga0495656_0012950 3300046615 Bacteria 3091
246 Ga0495668_0000020 3300046616 Bacteria 411641
247 Ga0495668_0000194 3300046616 Bacteria 89512
248 Ga0495668_0000512 3300046616 Bacteria 48355
249 Ga0495668_0038331 3300046616 Bacteria 2678
250 Ga0495611_0000886 3300046648 Bacteria 16273
251 Ga0495611_0004727 3300046648 Bacteria 5850
252 Ga0495611_0068253 3300046648 Bacteria 1623
253 Ga0495611_0090394 3300046648 Bacteria 1415
254 Ga0495625_0000035 3300046660 Bacteria 224323
255 Ga0495625_0002336 3300046660 Bacteria 20734
256 Ga0495625_0002920 3300046660 Bacteria 17855
257 Ga0495625_0004474 3300046660 Bacteria 13198
258 Ga0495625_0012920 3300046660 Bacteria 6741
259 Ga0495625_0021862 3300046660 Bacteria 4912
260 Ga0495625_0023394 3300046660 Bacteria 4720
261 Ga0495659_0004875 3300046664 Bacteria 4225
262 Ga0495661_0037903 3300046665 Bacteria 3007
263 Ga0495669_0105287 3300046684 Bacteria 1313
264 Ga0495671_0000010 3300046692 Bacteria 368641
265 Ga0495671_0004493 3300046692 Bacteria 8330
266 Ga0495671_0010058 3300046692 Bacteria 5260
267 Ga0495671_0014779 3300046692 Bacteria 4194
268 Ga0495671_0021215 3300046692 Bacteria 3415
269 Ga0495671_0023932 3300046692 Bacteria 3187
270 Ga0495649_0008781 3300046694 Bacteria 6056
271 Ga0495649_0013591 3300046694 Bacteria 4693
272 Ga0495649_0028574 3300046694 Bacteria 3090
273 Ga0495649_0051322 3300046694 Bacteria 2237
274 Ga0495649_0187785 3300046694 Bacteria 1076
275 Ga0495589_0040945 3300046794 Bacteria 2312
276 Ga0495589_0068573 3300046794 Bacteria 1735
277 Ga0495660_0000118 3300046810 Bacteria 85202
278 Ga0495660_0001415 3300046810 Bacteria 16450
279 Ga0495660_0017334 3300046810 Bacteria 4147
280 Ga0495660_0037283 3300046810 Bacteria 2708
281 Ga0495636_0000430 3300047318 Bacteria 15568
282 Ga0495672_0000212 3300047320 Bacteria 83026
283 Ga0495672_0062142 3300047320 Bacteria 2149
284 Ga0495683_0001547 3300047323 Bacteria 14899
285 Ga0495683_0006022 3300047323 Bacteria 6661
286 Ga0495683_0031228 3300047323 Bacteria 2714
287 Ga0495687_000245 3300047443 Bacteria 73990
288 Ga0495687_000925 3300047443 Bacteria 30492
289 Ga0495679_033685 3300047446 Bacteria 1634
290 Ga0495685_000045 3300047447 Bacteria 50520
291 Ga0495673_0000003 3300047469 Bacteria 1491337
292 Ga0495673_0000016 3300047469 Bacteria 580643
293 Ga0495673_0000035 3300047469 Bacteria 316861
294 Ga0495673_0023594 3300047469 Bacteria 2989
295 Ga0495673_0072853 3300047469 Bacteria 1441
296 Ga0495681_0012608 3300047470 Bacteria 4956
297 Ga0495686_0000282 3300047472 Bacteria 89471
298 Ga0495686_0003530 3300047472 Bacteria 13474
299 Ga0495686_0112450 3300047472 Bacteria 1631
300 Ga0496102_0004546 3300048905 Bacteria 11729
301 Ga0496114_0001532 3300048917 Bacteria 17509
302 Ga0496114_0041131 3300048917 Bacteria 3830
303 Ga0496114_0295975 3300048917 Bacteria 1429
304 Ga0496116_0000221 3300048919 Bacteria 106314
305 Ga0496116_0009438 3300048919 Bacteria 8310
306 Ga0496116_0028913 3300048919 Bacteria 4006
307 Ga0496117_0006025 3300048920 Bacteria 12462
308 Ga0496117_0007180 3300048920 Bacteria 10991
309 Ga0496117_0075124 3300048920 Bacteria 2247
310 Ga0496118_0007806 3300048921 Bacteria 11226
311 Ga0496118_0050895 3300048921 Bacteria 3173
312 Ga0496118_0055582 3300048921 Bacteria 2985
313 Ga0496119_0000086 3300048922 Bacteria 137053
314 Ga0496120_0000130 3300048923 Bacteria 127368
315 Ga0496121_0000307 3300048924 Bacteria 101849
316 Ga0496121_0009885 3300048924 Bacteria 10872
317 Ga0496121_0014084 3300048924 Bacteria 8529
318 Ga0496121_0036345 3300048924 Bacteria 4390
319 Ga0496121_0042424 3300048924 Bacteria 3957
320 Ga0496121_0054552 3300048924 Bacteria 3338
321 Ga0496122_0001689 3300048925 Bacteria 34233
322 Ga0496122_0003785 3300048925 Bacteria 19498
323 Ga0496122_0004492 3300048925 Bacteria 17254
324 Ga0496122_0011297 3300048925 Bacteria 9066
325 Ga0496122_0047838 3300048925 Bacteria 3296
326 Ga0496123_0000145 3300048926 Bacteria 144475
327 Ga0496123_0000779 3300048926 Bacteria 51646
328 Ga0496123_0003262 3300048926 Bacteria 18410
329 Ga0496123_0005287 3300048926 Bacteria 13082
330 Ga0496123_0009060 3300048926 Bacteria 9017
331 Ga0496124_0001162 3300048927 Bacteria 41251
332 Ga0496124_0010510 3300048927 Bacteria 9366
333 Ga0496124_0016118 3300048927 Bacteria 7129
334 Ga0496125_0002507 3300048928 Bacteria 23742
335 Ga0496125_0004554 3300048928 Bacteria 15904
336 Ga0496125_0032107 3300048928 Bacteria 4668
337 Ga0496125_0046977 3300048928 Bacteria 3616
338 Ga0496125_0096588 3300048928 Bacteria 2193
339 Ga0496126_0001735 3300048929 Bacteria 32323
340 Ga0496126_0007656 3300048929 Bacteria 11787
341 Ga0495678_000029 3300049459 Bacteria 219803
342 Ga0495678_000032 3300049459 Bacteria 212537
343 Ga0495678_001104 3300049459 Bacteria 22646
344 Ga0495678_001769 3300049459 Bacteria 16004
345 Ga0495678_007967 3300049459 Bacteria 5418
346 Ga0495682_0000278 3300049460 Bacteria 40095
347 Ga0495682_0000416 3300049460 Bacteria 30208
348 Ga0495682_0001392 3300049460 Bacteria 13194
349 Ga0501034_0000055 3300049571 Bacteria 205427
350 Ga0501046_0000010 3300049580 Bacteria 331082
351 Ga0501280_000401 3300049776 Bacteria 10423
352 nmdc:mga0k408_39397_c1 3300050493 Bacteria 2715
353 nmdc:mga07m45_196555_c1 3300050496 Bacteria 1173
354 nmdc:mga07m45_39073_c1 3300050496 Bacteria 2651
355 nmdc:mga07m45_89733_c1 3300050496 Bacteria 1760
356 Ga0500578_0000002 3300053086 Bacteria 293507
357 Ga0500644_0004856 3300053088 Bacteria 3380
358 Ga0500651_0042000 3300053093 Bacteria 2882
359 Ga0500556_0000117 3300053104 Bacteria 69237
360 Ga0500562_005511 3300053108 Bacteria 3177
361 Ga0500562_017925 3300053108 Bacteria 1828
362 Ga0500593_000691 3300053117 Bacteria 12851
363 Ga0500594_0002188 3300053118 Bacteria 4237
364 Ga0500618_010073 3300053125 Bacteria 2549
365 Ga0500559_0000297 3300053136 Bacteria 38441
366 Ga0500586_000014 3300053145 Bacteria 37183
367 Ga0500586_005101 3300053145 Bacteria 3295
368 Ga0500619_000088 3300053154 Bacteria 25738
369 Ga0500622_0002916 3300053156 Bacteria 11895
370 Ga0500622_0011765 3300053156 Bacteria 4756
371 Ga0500622_0059728 3300053156 Bacteria 1946
372 Ga0500570_039555 3300053724 Bacteria 2479
373 Ga0500587_001105 3300053739 Bacteria 3700
374 2511249127 2511231003 Bacteria 5606035
375 2511268176 2511231006 Bacteria 6794709
376 2511387162 2511231026 Bacteria 5225445
377 2512327031 2512047018 Bacteria 6663241
378 2514044272 2513237165 Bacteria 6771773
379 2553006736 2551306416 Bacteria 6152985
380 2555669558 2554235341 Bacteria 6867980
381 2583792327 2582580891 Bacteria 6800976
382 2587730226 2585428057 Bacteria 6737412
383 2587732871 2585428058 Bacteria 6853932
384 2587759021 2585428062 Bacteria 6842168
385 2588291280 2588253510 Bacteria 6901809
386 2597857556 2597489887 Bacteria 6666321
387 2599353444 2599185160 Bacteria 6844013
388 2599363839 2599185161 Bacteria 6960462
389 2599370159 2599185162 Bacteria 6957254
390 2599372466 2599185163 Bacteria 6995158
391 2599378552 2599185164 Bacteria 6841688
392 2599384071 2599185165 Bacteria 6843250
393 2599391325 2599185166 Bacteria 6959206
394 2599407571 2599185168 Bacteria 6997636
395 2599460278 2599185181 Bacteria 6844519
396 2599470672 2599185182 Bacteria 6883168
397 2599484519 2599185185 Bacteria 6652270
398 2599489299 2599185186 Bacteria 6831633
399 2599802216 2599185257 Bacteria 6492581
400 2600212886 2599185356 Bacteria 6843884
401 2601773054 2600255313 Bacteria 6842543
402 2643865471 2643221570 Bacteria 5103772
403 2643969376 2643221592 Bacteria 6608788
404 2644029462 2643221603 Bacteria 6147767
405 2644143676 2643221625 Bacteria 6512927
406 2644276618 2643221648 Bacteria 6521465
407 2644296177 2643221652 Bacteria 5140275
408 2671094987 2667528171 Bacteria 6900659
409 2671770165 2671180172 Bacteria 6495783
410 2738829786 2738541297 Bacteria 6549566
411 2739153582 2738541357 Bacteria 6549408
412 2739195502 2738543003 Bacteria 6549560
413 2739321978 2738543026 Bacteria 6549408
414 2739340219 2738543029 Bacteria 6549249
415 2743736977 2740892503 Bacteria 6855563
416 2765567853 2765235838 Bacteria 5445269
417 2809130282 2808606415 Bacteria 4576710
418 2809150241 2808606419 Bacteria 4576925
419 2819592592 2818991445 Bacteria 4955017
420 2819618036 2818991449 Bacteria 5518009
421 2819705659 2818991464 Bacteria 6907494
422 2821131746 2821131069 Bacteria 6108407
423 2829746083 2829745981 Bacteria 5406054
424 2831870073 2831864461 Bacteria 6502356
425 2834645767 2834641062 Bacteria 5559922
426 2839097860 2839094727 Bacteria 5534556
427 2842702424 2842698319 Bacteria 5190321
428 2842715425 2842711865 Bacteria 7155354
429 2844670058 2844665904 Bacteria 6817974
430 2852621536 2852618963 Bacteria 4577824
431 2857555997 2857553236 Bacteria 6166726
432 2857559215 2857558681 Bacteria 6617694
433 2857567022 2857564685 Bacteria 6290584
434 2861695046 2861691609 Bacteria 5628931
435 2884811978 2884811622 Bacteria 5552861
436 2884838917 2884836552 Bacteria 5219991
437 2884855209 2884852848 Bacteria 5221161
438 2889310669 2889306138 Bacteria 6358934
439 2896156122 2896154374 Bacteria 5221518
440 2902405289 2902405164 Bacteria 6784948
441 2904425800 2904424332 Bacteria 7633521
442 2904441947 2904439833 Bacteria 5931679
443 2904533244 2904530477 Bacteria 5876334
444 2904586191 2904584206 Bacteria 6028872
445 2904591995 2904589729 Bacteria 6113573
446 2904601843 2904601388 Bacteria 5884906
447 2917073371 2917070673 Bacteria 6868303
448 2919049441 2919046199 Bacteria 5567169
449 2919083830 2919079590 Bacteria 5946433
450 2923156007 2923153595 Bacteria 6870622
451 2923515265 2923510766 Bacteria 5926163
452 2935357630 2935353572 Unclassified 6955622
453 3007401552 3007395558 Bacteria 6755444
454 637319891 637000220 Bacteria 7074893
455 8003405507 8003400568 Bacteria 5535898
456 8015690228 8015687852 Bacteria 6613826
457 8019775051 8019769354 Bacteria 6924660
458 8055773362 8055770955 Bacteria 6827675
459 8055882980 8055878733 Bacteria 5907058
460 8056139516 8056137416 Bacteria 6147080
461 8057799982 8057798959 Bacteria 6713499
462 Ga0105244_10001015
463 JGI25155J39150_1000598
464 JGI25155J39150_1000632
465 JGI25156J39149_1000116
466 JGI25162J39368_1000014
467 JGI25154J39366_1000242
468 JGI25154J39366_1001605
469 JGI25157J39369_1000301
470 JGI25163J39215_1000165
471 JGI25164J39214_1000059
472 JGI25165J46597_1000027
473 JGI25153J46596_10011044
474 rootL2_10000441
475 rootH1_10026297
476 Ga0055538_1000117
477 Ga0055539_1000163
478 Ga0055533_1000166
479 Ga0055532_1000005
480 Ga0055525_1000227
481 Ga0055526_1002292
482 Ga0055526_1005476
483 Ga0055524_1000045
484 Ga0055524_1002816
485 Ga0055524_1023592
486 Ga0055536_1000026
487 Ga0055536_1000133
488 Ga0055534_1001063
489 Ga0055530_10000147
490 Ga0055530_10000960
491 Ga0055530_10031815
492 Ga0055540_1000149
493 Ga0055540_1000706
494 Ga0055540_1007247
495 Ga0055531_10010100
496 Ga0055541_1000109
497 Ga0065165_1000652
498 Ga0065704_10112908
499 Ga0070711_100233445
500 Ga0070706_100147132
501 Ga0070665_100014610
502 Ga0068855_100041389
503 Ga0068854_100004017
504 Ga0068856_100060251
505 Ga0068852_100003485
506 Ga0068861_100116536
507 Ga0075363_100092531
508 Ga0075362_10068920
509 Ga0075366_10130189
510 Ga0099823_1000004
511 Ga0079104_1000301
512 Ga0079104_1008951
513 Ga0079104_1011634
514 Ga0099826_10000074
515 Ga0105251_10018489
516 Ga0105251_10025671
517 Ga0105251_10031817
518 Ga0105244_10000377
519 Ga0105244_10000692
520 Ga0105250_10007826
521 Ga0105250_10009178
522 Ga0105240_10008790
523 Ga0105240_10034674
524 Ga0105240_10042117
525 Ga0105243_10010101
526 Ga0105237_10339650
527 Ga0105238_10000505
528 Ga0105238_10186971
529 Ga0157319_1000006
530 Ga0157371_10000147
531 Ga0157372_10541599
532 Ga0182008_10002837
533 Ga0182008_10012743
534 Ga0182008_10015207
535 Ga0182006_1004517
536 Ga0182006_1032511
537 Ga0182007_10008738
538 Ga0213872_10004114
539 Ga0213876_10051609
540 Ga0209435_100004
541 Ga0209435_100392
542 Ga0209760_100025
543 Ga0209784_100153
544 Ga0209566_100195
545 Ga0209674_100198
546 Ga0209147_100011
547 Ga0209563_100157
548 Ga0207427_100003
549 Ga0209437_100002
550 Ga0209437_100084
551 Ga0209258_100677
552 Ga0209646_1000032
553 Ga0209646_1000372
554 Ga0209026_1000128
555 Ga0209677_100156
556 Ga0209759_1000126
557 Ga0209759_1001169
558 Ga0209233_1000004
559 Ga0209565_1004483
560 Ga0209455_1009571
561 Ga0209673_1016547
562 Ga0209675_1000026
563 Ga0209675_1003453
564 Ga0209676_1000003
565 Ga0209676_1000059
566 Ga0209025_1000066
567 Ga0209564_1000003
568 Ga0209564_1000084
569 Ga0209564_1000161
570 Ga0209758_1000262
571 Ga0209050_1000004
572 Ga0209050_1000221
573 Ga0209050_1000537
574 Ga0209050_1010144
575 Ga0209256_1000143
576 Ga0209256_1000602
577 Ga0209256_1003716
578 Ga0209051_1000187
579 Ga0209051_1000345
580 Ga0209051_1000843
581 Ga0209051_1034776
582 Ga0209051_1045148
583 Ga0209257_1000685
584 Ga0209257_1007314
585 Ga0207696_1002185
586 Ga0207655_1000528
587 Ga0207655_1000646
588 Ga0207713_1001103
589 Ga0207713_1016966
590 Ga0207695_10004091
591 Ga0207695_10012830
592 Ga0207695_10031653
593 Ga0207694_10000392
594 Ga0207694_10018060
595 Ga0207709_10012938
596 Ga0207667_10029547
597 Ga0207640_10037899
598 Ga0207702_10043358
599 Ga0207698_10002874
600 Ga0209281_1000307
601 Ga0209281_1010660
602 Ga0209389_1000006
603 Ga0209371_1000049
604 Ga0209282_1000113
605 Ga0307517_10002205
606 Ga0307517_10113448
607 Ga0307515_10002443
608 Ga0307515_10034124
609 Ga0268256_1000031
610 Ga0307512_10041599
611 Ga0307512_10042244
612 Ga0307513_10036082
613 Ga0307513_10042366
614 Ga0307513_10143492
615 Ga0307509_10001611
616 Ga0307509_10115224
617 Ga0307514_10003638
618 Ga0307514_10022749
619 Ga0265342_10007300
620 Ga0307516_10004028
621 Ga0307516_10375812
622 Ga0307510_10016593
623 Ga0373936_0037221
624 Ga0395905_0050857
625 Ga0395905_0114370
626 Ga0436365_1927728
627 Ga0436361_0167284
628 Ga0439438_000544
629 Ga0451802_0352664
630 Ga0439463_000404
631 Ga0450902_001532
632 Ga0450905_000057
633 Ga0450901_000389
634 Ga0439440_0008592
635 Ga0466969_0130893
636 Ga0466977_0000237
637 Ga0466957_0116702
638 Ga0466957_0310350
639 Ga0495617_000003
640 Ga0495617_001935
641 Ga0495617_006662
642 Ga0495627_000008
643 Ga0495592_0000462
644 Ga0495590_0000001
645 Ga0495590_0016539
646 Ga0495590_0039613
647 Ga0495638_0002285
648 Ga0495638_0183653
649 Ga0495653_0000002
650 Ga0495650_0001043
651 Ga0495650_0002390
652 Ga0495605_0000068
653 Ga0495605_0002115
654 Ga0495605_0012206
655 Ga0495584_0000144
656 Ga0495584_0057414
657 Ga0495585_0003501
658 Ga0495596_0000740
659 Ga0495607_0004899
660 Ga0495607_0007873
661 Ga0495607_0026042
662 Ga0495607_0045373
663 Ga0495607_0064010
664 Ga0495583_0000021
665 Ga0495583_0007962
666 Ga0495606_0000220
667 Ga0495606_0000344
668 Ga0495606_0000545
669 Ga0495606_0003124
670 Ga0495606_0039888
671 Ga0495610_0000003
672 Ga0495610_0001527
673 Ga0495610_0011846
674 Ga0495610_0012659
675 Ga0495610_0020618
676 Ga0495610_0029136
677 Ga0495616_0002236
678 Ga0495616_0003216
679 Ga0495631_0002060
680 Ga0495632_0013802
681 Ga0495637_0000214
682 Ga0495637_0003947
683 Ga0495643_0000028
684 Ga0495643_0000044
685 Ga0495643_0000772
686 Ga0495644_0001004
687 Ga0495648_0000326
688 Ga0495648_0001942
689 Ga0495648_0004851
690 Ga0495648_0007854
691 Ga0495648_0016106
692 Ga0495648_0124139
693 Ga0495654_0000292
694 Ga0495609_0000340
695 Ga0495609_0001232
696 Ga0495609_0003092
697 Ga0495597_0000072
698 Ga0495597_0000216
699 Ga0495597_0019833
700 Ga0495622_0048371
701 Ga0495633_0000055
702 Ga0495633_0001371
703 Ga0495633_0003496
704 Ga0495633_0018503
705 Ga0495633_0032019
706 Ga0495656_0012950
707 Ga0495668_0000020
708 Ga0495668_0000194
709 Ga0495668_0000512
710 Ga0495668_0038331
711 Ga0495611_0000886
712 Ga0495611_0004727
713 Ga0495611_0068253
714 Ga0495611_0090394
715 Ga0495625_0000035
716 Ga0495625_0002336
717 Ga0495625_0002920
718 Ga0495625_0004474
719 Ga0495625_0012920
720 Ga0495625_0021862
721 Ga0495625_0023394
722 Ga0495659_0004875
723 Ga0495661_0037903
724 Ga0495669_0105287
725 Ga0495671_0000010
726 Ga0495671_0004493
727 Ga0495671_0010058
728 Ga0495671_0014779
729 Ga0495671_0021215
730 Ga0495671_0023932
731 Ga0495649_0008781
732 Ga0495649_0013591
733 Ga0495649_0028574
734 Ga0495649_0051322
735 Ga0495649_0187785
736 Ga0495589_0040945
737 Ga0495589_0068573
738 Ga0495660_0000118
739 Ga0495660_0001415
740 Ga0495660_0017334
741 Ga0495660_0037283
742 Ga0495636_0000430
743 Ga0495672_0000212
744 Ga0495672_0062142
745 Ga0495683_0001547
746 Ga0495683_0006022
747 Ga0495683_0031228
748 Ga0495687_000245
749 Ga0495687_000925
750 Ga0495679_033685
751 Ga0495685_000045
752 Ga0495673_0000003
753 Ga0495673_0000016
754 Ga0495673_0000035
755 Ga0495673_0023594
756 Ga0495673_0072853
757 Ga0495681_0012608
758 Ga0495686_0000282
759 Ga0495686_0003530
760 Ga0495686_0112450
761 Ga0496102_0004546
762 Ga0496114_0001532
763 Ga0496114_0041131
764 Ga0496114_0295975
765 Ga0496116_0000221
766 Ga0496116_0009438
767 Ga0496116_0028913
768 Ga0496117_0006025
769 Ga0496117_0007180
770 Ga0496117_0075124
771 Ga0496118_0007806
772 Ga0496118_0050895
773 Ga0496118_0055582
774 Ga0496119_0000086
775 Ga0496120_0000130
776 Ga0496121_0000307
777 Ga0496121_0009885
778 Ga0496121_0014084
779 Ga0496121_0036345
780 Ga0496121_0042424
781 Ga0496121_0054552
782 Ga0496122_0001689
783 Ga0496122_0003785
784 Ga0496122_0004492
785 Ga0496122_0011297
786 Ga0496122_0047838
787 Ga0496123_0000145
788 Ga0496123_0000779
789 Ga0496123_0003262
790 Ga0496123_0005287
791 Ga0496123_0009060
792 Ga0496124_0001162
793 Ga0496124_0010510
794 Ga0496124_0016118
795 Ga0496125_0002507
796 Ga0496125_0004554
797 Ga0496125_0032107
798 Ga0496125_0046977
799 Ga0496125_0096588
800 Ga0496126_0001735
801 Ga0496126_0007656
802 Ga0495678_000029
803 Ga0495678_000032
804 Ga0495678_001104
805 Ga0495678_001769
806 Ga0495678_007967
807 Ga0495682_0000278
808 Ga0495682_0000416
809 Ga0495682_0001392
810 Ga0501034_0000055
811 Ga0501046_0000010
812 Ga0501280_000401
813 nmdc:mga0k408_39397_c1
814 nmdc:mga07m45_196555_c1
815 nmdc:mga07m45_39073_c1
816 nmdc:mga07m45_89733_c1
817 Ga0500578_0000002
818 Ga0500644_0004856
819 Ga0500651_0042000
820 Ga0500556_0000117
821 Ga0500562_005511
822 Ga0500562_017925
823 Ga0500593_000691
824 Ga0500594_0002188
825 Ga0500618_010073
826 Ga0500559_0000297
827 Ga0500586_000014
828 Ga0500586_005101
829 Ga0500619_000088
830 Ga0500622_0002916
831 Ga0500622_0011765
832 Ga0500622_0059728
833 Ga0500570_039555
834 Ga0500587_001105
835 2511249127
836 2511268176
837 2511387162
838 2512327031
839 2514044272
840 2553006736
841 2555669558
842 2583792327
843 2587730226
844 2587732871
845 2587759021
846 2588291280
847 2597857556
848 2599353444
849 2599363839
850 2599370159
851 2599372466
852 2599378552
853 2599384071
854 2599391325
855 2599407571
856 2599460278
857 2599470672
858 2599484519
859 2599489299
860 2599802216
861 2600212886
862 2601773054
863 2643865471
864 2643969376
865 2644029462
866 2644143676
867 2644276618
868 2644296177
869 2671094987
870 2671770165
871 2738829786
872 2739153582
873 2739195502
874 2739321978
875 2739340219
876 2743736977
877 2765567853
878 2809130282
879 2809150241
880 2819592592
881 2819618036
882 2819705659
883 2821131746
884 2829746083
885 2831870073
886 2834645767
887 2839097860
888 2842702424
889 2842715425
890 2844670058
891 2852621536
892 2857555997
893 2857559215
894 2857567022
895 2861695046
896 2884811978
897 2884838917
898 2884855209
899 2889310669
900 2896156122
901 2902405289
902 2904425800
903 2904441947
904 2904533244
905 2904586191
906 2904591995
907 2904601843
908 2917073371
909 2919049441
910 2919083830
911 2923156007
912 2923515265
913 2935357630
914 3007401552
915 637319891
916 8003405507
917 8015690228
918 8019775051
919 8055773362
920 8055882980
921 8056139516
922 8057799982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

45

240

0.85

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

17

246

0.81

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

34

201

0.74

PF13379

NMT1_2

NMT1-like family

16

247

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9537 36 315
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9469 37 324
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9094 36 315
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.9062 36 321
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8857 36 321
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9669 120 214 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9143 123 216 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9109 120 214 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8845 37 315 3.40.190.10
af_Q2G1L7_145_252_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8645 123 215 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4R9WJY7-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9834 116 195
AF-A0A6B3TU84-F1-model_v4 ABC transporter substrate-binding protein 0.9793 102 247
AF-A0A838R042-F1-model_v4 Aliphatic sulfonate ABC transporter substrate-binding protein 0.9753 30 319 GO:0016020
GO:0042597
GO:0042626
AF-A0A434TM85-F1-model_v4 Sulfonate ABC transporter substrate-binding protein 0.9594 52 324 GO:0016020
GO:0042597
GO:0042626
AF-A0A3S1ZSK7-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9558 123 305

Map