F448737

General Info

Members Datasets Scaffolds Average Seq Length
461 325 922 324

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10186978|Ga0157376_101869782
Length 353
Sequence MAGLRPADRRGARAPAVGRAAYHAGVPQERVLVTGSSGHLGEALVRVLRGQGREVVGLDLLASPYTTVIGPVTDRAVVRRCLDGVGAVLHAATLHKPHIGSHQRQAFVDTNVSGTLTLLEEAVAAGVESFVFTSSTSVFGRALTPLPGEPATWITEDVAPVPRNIYGVTKAAAEDLCEIIARDHGLPVAVLRVARFFPEDDDRDEVRAAFDGANVKANEYLYRRVDIQDVVDAHLLAMAGAPAIGFGRYIISATTPFTPGDRAGLGRDAPAVVRRLFPDADAEYARRGWAMFGVIDRVYVNARARAALGWRPTHDLRWVLDQLKAGQDPRSPLARAVGAKGYHAVPTGPYTVR

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
299 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
300 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
309 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
310 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
311 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
312 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
313 2739367700 Dyella sp. YR388 Isolate Unclassified
314 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
315 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
316 2791355199
317 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
318 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
319 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
320 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
321 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
322 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
323 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
324 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
325 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 0
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.71
Nodule 2.17
Rhizoplane 2.82
Rhizosphere 74.84
Stem 0
Stem Tuber 0
Unclassified 2.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10186978 3300014969 Bacteria 1897
2 JGI24735J21928_10012748 3300002067 Bacteria 2654
3 JGI25154J39366_1000002 3300002738 Bacteria 466942
4 JGI25157J39369_1001283 3300002741 Bacteria 10098
5 JGI25163J39215_1001858 3300002771 Bacteria 2770
6 JGI25164J39214_1000878 3300002772 Bacteria 10199
7 JGI25151J46595_10000296 3300003187 Bacteria 55085
8 JGI25406J46586_10000455 3300003203 Bacteria 19067
9 JGI25165J46597_1001659 3300003214 Bacteria 10199
10 rootH2_10005244 3300003320 Bacteria 65536
11 rootH2_10128754 3300003320 Bacteria 4245
12 rootH1_10060954 3300003323 Unclassified 4093
13 rootH1_10362814 3300003323 Unclassified 1695
14 JGI25160J50197_1003699 3300003354 Bacteria 6752
15 JGI25160J50197_1010326 3300003354 Bacteria 3385
16 Ga0055535_1001671 3300003761 Bacteria 10199
17 Ga0055542_1001621 3300003762 Bacteria 10199
18 Ga0055529_1001205 3300003763 Bacteria 10199
19 Ga0065712_10182247 3300005290 Bacteria 1186
20 Ga0070676_10005643 3300005328 Bacteria 6661
21 Ga0070683_100035348 3300005329 Unclassified 4568
22 Ga0070683_100195889 3300005329 Bacteria 1918
23 Ga0070670_100088866 3300005331 Unclassified 2656
24 Ga0070677_10019883 3300005333 Bacteria 2439
25 Ga0070682_100012949 3300005337 Bacteria 4789
26 Ga0068868_100018848 3300005338 Bacteria 5164
27 Ga0070689_100143040 3300005340 Bacteria 1925
28 Ga0070687_100149539 3300005343 Bacteria 1369
29 Ga0070669_100060530 3300005353 Bacteria 2782
30 Ga0070669_100125865 3300005353 Bacteria 1961
31 Ga0070675_100011560 3300005354 Bacteria 6913
32 Ga0070675_100154491 3300005354 Bacteria 1969
33 Ga0070671_100084731 3300005355 Bacteria 2651
34 Ga0070671_100099227 3300005355 Bacteria 2443
35 Ga0070671_100151424 3300005355 Bacteria 1959
36 Ga0070674_100201925 3300005356 Bacteria 1536
37 Ga0070688_100083317 3300005365 Bacteria 2075
38 Ga0070667_100105942 3300005367 Bacteria 2433
39 Ga0070709_10046894 3300005434 Bacteria 2689
40 Ga0070709_10249207 3300005434 Bacteria 1279
41 Ga0070713_100033319 3300005436 Bacteria 4125
42 Ga0070701_10035153 3300005438 Bacteria 2516
43 Ga0070700_100010244 3300005441 Bacteria 5172
44 Ga0070700_100133214 3300005441 Bacteria 1680
45 Ga0070708_100000017 3300005445 Bacteria 120364
46 Ga0070708_100051451 3300005445 Bacteria 3650
47 Ga0070708_100265736 3300005445 Bacteria 1613
48 Ga0070708_100330121 3300005445 Bacteria 1437
49 Ga0070678_100090369 3300005456 Bacteria 2347
50 Ga0070681_10132587 3300005458 Bacteria 2423
51 Ga0070681_10488934 3300005458 Bacteria 1143
52 Ga0068867_100007852 3300005459 Bacteria 7541
53 Ga0070685_10153373 3300005466 Bacteria 1462
54 Ga0070706_100093032 3300005467 Bacteria 2797
55 Ga0070706_100124093 3300005467 Bacteria 2407
56 Ga0070698_100349545 3300005471 Bacteria 1410
57 Ga0070684_100055150 3300005535 Bacteria 3463
58 Ga0070684_100131526 3300005535 Bacteria 2258
59 Ga0070684_100422094 3300005535 Bacteria 1231
60 Ga0068853_100009827 3300005539 Bacteria 7721
61 Ga0070672_100012923 3300005543 Bacteria 5884
62 Ga0070686_100017525 3300005544 Bacteria 4187
63 Ga0070695_100163404 3300005545 Bacteria 1565
64 Ga0070696_100071832 3300005546 Bacteria 2436
65 Ga0070665_100000108 3300005548 Bacteria 155204
66 Ga0068855_100051841 3300005563 Bacteria 4833
67 Ga0070664_100168494 3300005564 Bacteria 1942
68 Ga0068857_100137249 3300005577 Bacteria 2208
69 Ga0068856_100213179 3300005614 Bacteria 1946
70 Ga0068852_100341018 3300005616 Bacteria 1460
71 Ga0068864_100096774 3300005618 Bacteria 2612
72 Ga0068864_100117434 3300005618 Bacteria 2375
73 Ga0068864_100287352 3300005618 Bacteria 1536
74 Ga0068861_100053270 3300005719 Bacteria 3077
75 Ga0068861_100135680 3300005719 Bacteria 2002
76 Ga0068851_10004550 3300005834 Bacteria 6259
77 Ga0068851_10037766 3300005834 Bacteria 2422
78 Ga0068863_100206540 3300005841 Bacteria 1890
79 Ga0068863_100311762 3300005841 Bacteria 1527
80 Ga0068858_100086455 3300005842 Bacteria 2917
81 Ga0068858_100136818 3300005842 Bacteria 2299
82 Ga0068858_100498018 3300005842 Bacteria 1177
83 Ga0068860_100028068 3300005843 Bacteria 5419
84 Ga0068860_100081685 3300005843 Bacteria 3074
85 Ga0068862_100024485 3300005844 Bacteria 5065
86 Ga0068862_100046445 3300005844 Bacteria 3705
87 Ga0068862_100242766 3300005844 Bacteria 1638
88 Ga0081455_10016106 3300005937 Bacteria 7228
89 Ga0081455_10022272 3300005937 Bacteria 5925
90 Ga0081455_10032211 3300005937 Bacteria 4728
91 Ga0081455_10048480 3300005937 Bacteria 3670
92 Ga0081538_10003177 3300005981 Bacteria 15619
93 Ga0081540_1000527 3300005983 Bacteria 37363
94 Ga0081540_1005987 3300005983 Bacteria 8957
95 Ga0081540_1011271 3300005983 Bacteria 5987
96 Ga0081540_1016209 3300005983 Bacteria 4676
97 Ga0081539_10000204 3300005985 Bacteria 137351
98 Ga0081539_10006434 3300005985 Bacteria 11267
99 Ga0070717_10010276 3300006028 Bacteria 7055
100 Ga0070717_10050136 3300006028 Bacteria 3429
101 Ga0070712_100109713 3300006175 Bacteria 2057
102 Ga0070712_100311741 3300006175 Bacteria 1277
103 Ga0075367_10040311 3300006178 Bacteria 2726
104 Ga0075367_10056614 3300006178 Bacteria 2329
105 Ga0075367_10062089 3300006178 Bacteria 2231
106 Ga0075367_10146884 3300006178 Bacteria 1462
107 Ga0075366_10000689 3300006195 Bacteria 15998
108 Ga0075366_10042563 3300006195 Bacteria 2689
109 Ga0075366_10097677 3300006195 Bacteria 1761
110 Ga0097621_100035778 3300006237 Bacteria 3969
111 Ga0097621_100152104 3300006237 Bacteria 1985
112 Ga0097621_100351125 3300006237 Bacteria 1311
113 Ga0097621_100466494 3300006237 Bacteria 1139
114 Ga0075370_10096928 3300006353 Bacteria 1705
115 Ga0068871_100053214 3300006358 Bacteria 3280
116 Ga0068871_100178406 3300006358 Bacteria 1824
117 Ga0068871_100218153 3300006358 Bacteria 1652
118 Ga0075428_100028229 3300006844 Bacteria 6206
119 Ga0075428_100170218 3300006844 Bacteria 2361
120 Ga0075431_100043435 3300006847 Bacteria 4639
121 Ga0075431_100061786 3300006847 Bacteria 3865
122 Ga0075433_10000630 3300006852 Bacteria 23544
123 Ga0075434_100000062 3300006871 Bacteria 55222
124 Ga0075434_100016696 3300006871 Bacteria 7061
125 Ga0068865_100030428 3300006881 Bacteria 3591
126 Ga0068865_100033334 3300006881 Bacteria 3448
127 Ga0075436_100151776 3300006914 Bacteria 1630
128 Ga0105251_10080666 3300009011 Bacteria 1504
129 Ga0111539_10084866 3300009094 Bacteria 3722
130 Ga0114129_10004992 3300009147 Bacteria 18701
131 Ga0114129_10144514 3300009147 Bacteria 3259
132 Ga0105243_10050050 3300009148 Bacteria 3299
133 Ga0105242_10042003 3300009176 Bacteria 3690
134 Ga0105242_10123885 3300009176 Bacteria 2222
135 Ga0105248_10357946 3300009177 Bacteria 1643
136 Ga0105237_10183504 3300009545 Bacteria 2092
137 Ga0105238_10039744 3300009551 Bacteria 4770
138 Ga0105249_10263250 3300009553 Bacteria 1714
139 Ga0105028_101109 3300009993 Bacteria 2848
140 Ga0105239_10117267 3300010375 Bacteria 2955
141 Ga0157369_10237406 3300013105 Bacteria 1904
142 Ga0157374_10029436 3300013296 Bacteria 4974
143 Ga0157374_10164630 3300013296 Bacteria 2161
144 Ga0157374_10462545 3300013296 Bacteria 1270
145 Ga0157378_10030417 3300013297 Unclassified 4771
146 Ga0163162_10012683 3300013306 Bacteria 8226
147 Ga0163162_10210308 3300013306 Bacteria 2075
148 Ga0163162_10213556 3300013306 Bacteria 2059
149 Ga0157372_10035356 3300013307 Bacteria 5500
150 Ga0157372_10037551 3300013307 Bacteria 5344
151 Ga0157375_10007505 3300013308 Bacteria 9534
152 Ga0163163_10004894 3300014325 Bacteria 11518
153 Ga0163163_10115026 3300014325 Bacteria 2721
154 Ga0157380_10031528 3300014326 Bacteria 4069
155 Ga0157380_10173120 3300014326 Bacteria 1888
156 Ga0157379_10130106 3300014968 Bacteria 2265
157 Ga0157376_10001620 3300014969 Bacteria 14893
158 Ga0157376_10197701 3300014969 Bacteria 1848
159 Ga0163161_10175518 3300017792 Bacteria 1640
160 Ga0213876_10002263 3300021384 Bacteria 11354
161 Ga0209760_100825 3300025207 Bacteria 4139
162 Ga0209784_100094 3300025224 Bacteria 113434
163 Ga0209566_101305 3300025225 Bacteria 8112
164 Ga0207427_100100 3300025231 Bacteria 121264
165 Ga0209437_100059 3300025233 Bacteria 355048
166 Ga0209258_100034 3300025242 Bacteria 437372
167 Ga0209646_1000005 3300025246 Bacteria 717627
168 Ga0209646_1002083 3300025246 Bacteria 4689
169 Ga0209026_1000232 3300025250 Bacteria 75219
170 Ga0209026_1001373 3300025250 Bacteria 10867
171 Ga0209148_1000001 3300025254 Bacteria 2545271
172 Ga0209759_1001936 3300025256 Bacteria 10080
173 Ga0209233_1000002 3300025261 Bacteria 2501366
174 Ga0209455_1000054 3300025272 Bacteria 358936
175 Ga0209455_1007853 3300025272 Bacteria 2963
176 Ga0209673_1003179 3300025273 Bacteria 9996
177 Ga0209130_1000462 3300025284 Bacteria 42249
178 Ga0209025_1000408 3300025294 Bacteria 86719
179 Ga0209564_1000364 3300025295 Bacteria 84138
180 Ga0209758_1000904 3300025297 Bacteria 40285
181 Ga0209758_1016332 3300025297 Bacteria 3777
182 Ga0209758_1028319 3300025297 Bacteria 2373
183 Ga0209256_1004405 3300025299 Bacteria 8869
184 Ga0207426_1000066 3300025302 Bacteria 351182
185 Ga0207426_1000600 3300025302 Bacteria 47121
186 Ga0207682_10050978 3300025893 Bacteria 1713
187 Ga0207699_10036497 3300025906 Bacteria 2802
188 Ga0207699_10039629 3300025906 Bacteria 2708
189 Ga0207645_10007792 3300025907 Bacteria 7536
190 Ga0207643_10087935 3300025908 Bacteria 1808
191 Ga0207684_10119712 3300025910 Bacteria 2257
192 Ga0207654_10181675 3300025911 Bacteria 1373
193 Ga0207695_10000023 3300025913 Bacteria 657903
194 Ga0207695_10000031 3300025913 Bacteria 526801
195 Ga0207695_10110586 3300025913 Bacteria 2728
196 Ga0207693_10125195 3300025915 Bacteria 2019
197 Ga0207662_10049604 3300025918 Bacteria 2491
198 Ga0207652_10121687 3300025921 Bacteria 2322
199 Ga0207652_10128876 3300025921 Bacteria 2255
200 Ga0207681_10023179 3300025923 Bacteria 3968
201 Ga0207681_10074736 3300025923 Bacteria 2375
202 Ga0207650_10022754 3300025925 Unclassified 4440
203 Ga0207659_10172606 3300025926 Bacteria 1707
204 Ga0207700_10057009 3300025928 Bacteria 2944
205 Ga0207664_10001921 3300025929 Bacteria 13642
206 Ga0207644_10035219 3300025931 Bacteria 3506
207 Ga0207644_10160545 3300025931 Bacteria 1747
208 Ga0207706_10032947 3300025933 Bacteria 4610
209 Ga0207686_10070330 3300025934 Bacteria 2248
210 Ga0207709_10006778 3300025935 Bacteria 6410
211 Ga0207670_10211267 3300025936 Bacteria 1480
212 Ga0207704_10057045 3300025938 Bacteria 2396
213 Ga0207704_10057882 3300025938 Bacteria 2384
214 Ga0207691_10012293 3300025940 Bacteria 8205
215 Ga0207711_10098336 3300025941 Bacteria 2585
216 Ga0207711_10149143 3300025941 Bacteria 2109
217 Ga0207689_10002769 3300025942 Bacteria 16206
218 Ga0207689_10100545 3300025942 Bacteria 2375
219 Ga0207689_10230425 3300025942 Bacteria 1531
220 Ga0207689_10316747 3300025942 Bacteria 1294
221 Ga0207661_10015079 3300025944 Bacteria 5678
222 Ga0207667_10163202 3300025949 Bacteria 2291
223 Ga0207651_10078209 3300025960 Bacteria 2372
224 Ga0207651_10195229 3300025960 Bacteria 1618
225 Ga0207658_10012941 3300025986 Bacteria 5699
226 Ga0207677_10289779 3300026023 Bacteria 1348
227 Ga0207703_10062462 3300026035 Bacteria 3051
228 Ga0207639_10139689 3300026041 Bacteria 2017
229 Ga0207708_10004481 3300026075 Bacteria 10292
230 Ga0207648_10009414 3300026089 Bacteria 9359
231 Ga0207648_10020880 3300026089 Bacteria 5896
232 Ga0207676_10065785 3300026095 Bacteria 2888
233 Ga0207676_10130553 3300026095 Bacteria 2135
234 Ga0207674_10024382 3300026116 Bacteria 6467
235 Ga0207675_100136972 3300026118 Bacteria 2324
236 Ga0207675_100238290 3300026118 Bacteria 1757
237 Ga0207675_100303664 3300026118 Bacteria 1555
238 Ga0207683_10106553 3300026121 Bacteria 2507
239 Ga0207683_10139625 3300026121 Bacteria 2183
240 Ga0207683_10170134 3300026121 Bacteria 1973
241 Ga0207698_10145483 3300026142 Bacteria 2049
242 Ga0268266_10000001 3300028379 Bacteria 4040580
243 Ga0268266_10000189 3300028379 Bacteria 109217
244 Ga0268266_10361040 3300028379 Bacteria 1367
245 Ga0268265_10015212 3300028380 Bacteria 5260
246 Ga0268265_10022791 3300028380 Bacteria 4405
247 Ga0268265_10207609 3300028380 Bacteria 1704
248 Ga0268265_10261717 3300028380 Bacteria 1538
249 Ga0268264_10000201 3300028381 Bacteria 122060
250 Ga0307517_10001507 3300028786 Bacteria 38891
251 Ga0307515_10000305 3300028794 Bacteria 121634
252 Ga0307515_10053578 3300028794 Bacteria 5948
253 Ga0265338_10002851 3300028800 Bacteria 25265
254 Ga0265338_10013065 3300028800 Bacteria 9409
255 Ga0307512_10005400 3300030522 Bacteria 13367
256 Ga0307512_10021450 3300030522 Bacteria 5825
257 Ga0307513_10026482 3300031456 Bacteria 6683
258 Ga0307509_10179426 3300031507 Bacteria 1985
259 Ga0307509_10255358 3300031507 Bacteria 1533
260 Ga0307408_100179225 3300031548 Bacteria 1698
261 Ga0307508_10000072 3300031616 Bacteria 118449
262 Ga0307514_10021569 3300031649 Bacteria 5249
263 Ga0307405_10321523 3300031731 Bacteria 1182
264 Ga0307518_10069665 3300031838 Bacteria 2548
265 Ga0307410_10151231 3300031852 Bacteria 1728
266 Ga0307409_100157525 3300031995 Bacteria 1981
267 Ga0307415_100051997 3300032126 Bacteria 2784
268 Ga0307415_100238857 3300032126 Bacteria 1468
269 Ga0307507_10124251 3300033179 Bacteria 2050
270 Ga0307510_10097517 3300033180 Bacteria 2749
271 Ga0373958_0004121 3300034819 Bacteria 2136
272 Ga0373938_0006556 3300034957 Bacteria 2017
273 Ga0373926_0026433 3300035083 Bacteria 2031
274 Ga0373929_0005105 3300035085 Bacteria 2360
275 Ga0373940_0068360 3300035088 Bacteria 1029
276 Ga0373923_0009081 3300035111 Bacteria 3575
277 Ga0373939_0011941 3300035114 Bacteria 2204
278 Ga0373953_0006628 3300035117 Bacteria 3829
279 Ga0373954_0034869 3300035118 Bacteria 2332
280 Ga0373956_0010675 3300035119 Bacteria 3771
281 Ga0373957_0009831 3300035120 Bacteria 3140
282 Ga0373955_0024539 3300035172 Bacteria 3085
283 Ga0373942_0029612 3300035207 Bacteria 1438
284 Ga0373961_0078858 3300035241 Bacteria 1033
285 Ga0373962_0016092 3300035242 Bacteria 1925
286 Ga0373931_0013584 3300035691 Bacteria 3968
287 Ga0373933_0052319 3300035724 Bacteria 2443
288 Ga0373933_0108911 3300035724 Bacteria 1726
289 Ga0373937_0088872 3300036401 Bacteria 2860
290 Ga0373937_0111505 3300036401 Bacteria 2545
291 Ga0373925_0015895 3300037068 Bacteria 5445
292 Ga0400483_279059 3300039062 Bacteria 3761
293 Ga0436365_0191965 3300039437 Bacteria 59780
294 Ga0436365_1751144 3300039437 Bacteria 3305
295 Ga0436363_1366179 3300039450 Bacteria 5664
296 Ga0436362_0026763 3300039453 Bacteria 8902
297 Ga0439465_0006629 3300041413 Bacteria 3678
298 Ga0439465_0059863 3300041413 Bacteria 1261
299 Ga0439446_0018248 3300042156 Bacteria 1964
300 Ga0439464_0060986 3300042439 Bacteria 1104
301 Ga0466966_0058639 3300044684 Bacteria 2433
302 Ga0466963_0126677 3300044694 Bacteria 1761
303 Ga0466959_0030544 3300045049 Bacteria 3990
304 Ga0466958_0102151 3300045836 Bacteria 1784
305 Ga0495617_045212 3300046452 Bacteria 1468
306 Ga0495603_0007619 3300046455 Bacteria 6517
307 Ga0495603_0032677 3300046455 Bacteria 3130
308 Ga0495590_0052388 3300046457 Bacteria 1426
309 Ga0495629_0052518 3300046459 Bacteria 2852
310 Ga0495629_0085275 3300046459 Unclassified 2204
311 Ga0495629_0128484 3300046459 Bacteria 1765
312 Ga0495638_0001562 3300046460 Bacteria 20538
313 Ga0495638_0105902 3300046460 Bacteria 1675
314 Ga0495641_0075938 3300046461 Bacteria 1506
315 Ga0495641_0078316 3300046461 Bacteria 1481
316 Ga0495651_0086718 3300046462 Bacteria 2354
317 Ga0495580_0176883 3300046472 Bacteria 1474
318 Ga0495580_0342342 3300046472 Bacteria 1014
319 Ga0495582_0026032 3300046473 Bacteria 3205
320 Ga0495639_0088766 3300046475 Bacteria 1448
321 Ga0495664_0008184 3300046477 Bacteria 5824
322 Ga0495596_0035387 3300046500 Bacteria 1980
323 Ga0495607_0101547 3300046501 Bacteria 1540
324 Ga0495607_0160854 3300046501 Bacteria 1141
325 Ga0495583_0084141 3300046506 Bacteria 1379
326 Ga0495606_0148157 3300046507 Bacteria 1380
327 Ga0495608_0046779 3300046511 Bacteria 2878
328 Ga0495610_0013988 3300046512 Bacteria 4742
329 Ga0495618_0102224 3300046514 Bacteria 1834
330 Ga0495620_0033221 3300046515 Bacteria 2344
331 Ga0495628_0090361 3300046516 Bacteria 2371
332 Ga0495643_0013674 3300046522 Bacteria 4850
333 Ga0495663_0000297 3300046525 Bacteria 18880
334 Ga0495663_0032350 3300046525 Bacteria 1557
335 Ga0495640_0181644 3300046533 Bacteria 1340
336 Ga0495586_0007017 3300046535 Bacteria 6004
337 Ga0495587_0003384 3300046536 Bacteria 10638
338 Ga0495645_0044773 3300046543 Unclassified 3227
339 Ga0495645_0126392 3300046543 Bacteria 1796
340 Ga0495622_0001100 3300046557 Bacteria 14136
341 Ga0495667_0013091 3300046559 Bacteria 5618
342 Ga0495667_0083019 3300046559 Bacteria 2081
343 Ga0495656_0079760 3300046615 Bacteria 1474
344 Ga0495668_0136283 3300046616 Bacteria 1344
345 Ga0495634_0020830 3300046642 Bacteria 4645
346 Ga0495625_0003360 3300046660 Bacteria 16082
347 Ga0495625_0006558 3300046660 Bacteria 10335
348 Ga0495625_0015130 3300046660 Bacteria 6124
349 Ga0495635_0010178 3300046663 Bacteria 6575
350 Ga0495659_0048509 3300046664 Bacteria 1539
351 Ga0495657_0017216 3300046675 Bacteria 5250
352 Ga0495657_0172672 3300046675 Bacteria 1330
353 Ga0495599_0009148 3300046678 Bacteria 6042
354 Ga0495669_0033849 3300046684 Bacteria 2251
355 Ga0495669_0043333 3300046684 Bacteria 2003
356 Ga0495671_0009337 3300046692 Bacteria 5480
357 Ga0495649_0006390 3300046694 Bacteria 7335
358 Ga0495649_0082395 3300046694 Bacteria 1719
359 Ga0495581_0077194 3300047315 Bacteria 1927
360 Ga0495674_0211359 3300047319 Bacteria 1606
361 Ga0495674_0212895 3300047319 Bacteria 1600
362 Ga0495680_0032014 3300047322 Bacteria 4273
363 Ga0495687_000010 3300047443 Bacteria 413735
364 Ga0495685_033185 3300047447 Bacteria 1774
365 Ga0495684_0027906 3300047471 Unclassified 4336
366 Ga0495684_0134814 3300047471 Bacteria 1853
367 Ga0495593_0068703 3300047673 Bacteria 1843
368 Ga0495602_0050945 3300048088 Bacteria 3694
369 Ga0495614_0021222 3300048089 Bacteria 2806
370 Ga0496100_0004715 3300048903 Bacteria 7268
371 Ga0496101_0001574 3300048904 Bacteria 13679
372 Ga0496102_0324810 3300048905 Bacteria 1449
373 Ga0496104_0175472 3300048907 Bacteria 2053
374 Ga0496105_0035392 3300048908 Bacteria 4109
375 Ga0496105_0120323 3300048908 Bacteria 2165
376 Ga0496109_0050851 3300048912 Bacteria 3774
377 Ga0496115_0001179 3300048918 Bacteria 18754
378 Ga0496115_0002362 3300048918 Bacteria 13536
379 Ga0496115_0036345 3300048918 Bacteria 3899
380 Ga0496115_0078518 3300048918 Bacteria 2685
381 Ga0496115_0162958 3300048918 Bacteria 1843
382 Ga0496121_0004235 3300048924 Bacteria 19526
383 Ga0496121_0010307 3300048924 Bacteria 10571
384 Ga0496123_0039857 3300048926 Bacteria 3280
385 Ga0496126_0046085 3300048929 Bacteria 4002
386 Ga0496126_0107458 3300048929 Bacteria 2433
387 Ga0495678_019506 3300049459 Bacteria 3023
388 Ga0501036_0118929 3300049572 Bacteria 2231
389 Ga0501040_0059523 3300049576 Bacteria 2624
390 Ga0501041_0030491 3300049577 Bacteria 3255
391 Ga0501042_0156502 3300049578 Bacteria 1644
392 Ga0501046_0071926 3300049580 Bacteria 2686
393 Ga0501047_0066858 3300049581 Bacteria 3465
394 Ga0501071_0089760 3300049587 Bacteria 2256
395 Ga0501072_0020429 3300049588 Bacteria 5132
396 Ga0501075_0017964 3300049591 Bacteria 5111
397 Ga0501075_0245162 3300049591 Bacteria 1366
398 Ga0501076_0010332 3300049592 Bacteria 6923
399 Ga0501076_0195363 3300049592 Bacteria 1652
400 Ga0501079_0079470 3300049741 Bacteria 2536
401 Ga0501080_0334802 3300049742 Bacteria 1368
402 Ga0501081_0008269 3300049743 Bacteria 6754
403 Ga0501081_0015152 3300049743 Bacteria 5085
404 Ga0501081_0322653 3300049743 Bacteria 1135
405 Ga0501044_0205135 3300049823 Bacteria 1928
406 Ga0501045_0146723 3300049824 Unclassified 1755
407 nmdc:mga0k408_781_c1 3300050493 Bacteria 17522
408 nmdc:mga0k408_87505_c1 3300050493 Bacteria 1830
409 nmdc:mga05p37_111334_c1 3300050507 Bacteria 3367
410 nmdc:mga0qj67_335089_c1 3300050509 Bacteria 1224
411 nmdc:mga06r32_318068_c1 3300050510 Bacteria 1542
412 nmdc:mga06r32_383131_c1 3300050510 Bacteria 1389
413 nmdc:mga08y16_107877_c1 3300050511 Bacteria 2899
414 nmdc:mga08y16_85099_c1 3300050511 Unclassified 3295
415 nmdc:mga0n895_13484_c1 3300050512 Bacteria 7377
416 nmdc:mga0n895_25132_c1 3300050512 Bacteria 5624
417 nmdc:mga0rr50_59241_c1 3300050513 Bacteria 2874
418 nmdc:mga0rr50_68382_c1 3300050513 Bacteria 2701
419 nmdc:mga08x19_8423_c1 3300050514 Bacteria 6143
420 nmdc:mga0a205_3551_c1 3300050515 Bacteria 13952
421 nmdc:mga0a205_48204_c1 3300050515 Bacteria 4112
422 Ga0495612_0086619 3300053078 Bacteria 1321
423 Ga0500644_0063367 3300053088 Bacteria 1310
424 Ga0500644_0071272 3300053088 Bacteria 1253
425 Ga0500641_0028115 3300053096 Bacteria 2194
426 Ga0500556_0001981 3300053104 Bacteria 7223
427 Ga0500572_024173 3300053111 Bacteria 1637
428 Ga0500595_007529 3300053119 Bacteria 4514
429 Ga0500642_0001003 3300053130 Bacteria 8101
430 Ga0500642_0159473 3300053130 Bacteria 1058
431 Ga0500559_0000185 3300053136 Bacteria 49556
432 Ga0500568_0002392 3300053139 Bacteria 11079
433 Ga0500568_0005253 3300053139 Bacteria 6732
434 Ga0500577_0004664 3300053142 Bacteria 3642
435 Ga0500604_0025931 3300053151 Bacteria 1687
436 Ga0500620_071368 3300053155 Bacteria 1195
437 Ga0500627_0141012 3300053158 Bacteria 1089
438 Ga0501084_0020052 3300054114 Bacteria 5575
439 Ga0590071_008086 3300059421 Bacteria 2484
440 Ga0590075_038758 3300059424 Bacteria 1216
441 Ga0501082_0164937 3300060353 Bacteria 1925
442 Ga0466962_0030399 3300061719 Bacteria 2587
443 Ga0530510_0441571 3300061734 Unclassified 983
444 2513695787 2513237101 Bacteria 7952346
445 2513891388 2513237141 Bacteria 8496279
446 2514588192 2513237351 Bacteria 6968952
447 2587759599 2585428062 Bacteria 6842168
448 2723847252 2721755755 Bacteria 8322773
449 2739732737 2739367700 Bacteria 4747630
450 2765464967 2765235802 Bacteria 5618596
451 2788434066 2786546940 Bacteria 6396474
452 2793084158
453 2849282347 2849281842 Bacteria 6065644
454 2874607268 2874604998 Bacteria 7834745
455 2889038136 2889033259 Bacteria 9099371
456 2922368564 2922361189 Bacteria 7436256
457 2922387463 2922386360 Bacteria 7017218
458 8003152473 8003151029 Bacteria 8187759
459 8006968386 8006964411 Bacteria 8966052
460 8006994834 8006994254 Bacteria 8309700
461 8056679401 8056673599 Bacteria 7871253
462 Ga0157376_10186978
463 JGI24735J21928_10012748
464 JGI25154J39366_1000002
465 JGI25157J39369_1001283
466 JGI25163J39215_1001858
467 JGI25164J39214_1000878
468 JGI25151J46595_10000296
469 JGI25406J46586_10000455
470 JGI25165J46597_1001659
471 rootH2_10005244
472 rootH2_10128754
473 rootH1_10060954
474 rootH1_10362814
475 JGI25160J50197_1003699
476 JGI25160J50197_1010326
477 Ga0055535_1001671
478 Ga0055542_1001621
479 Ga0055529_1001205
480 Ga0065712_10182247
481 Ga0070676_10005643
482 Ga0070683_100035348
483 Ga0070683_100195889
484 Ga0070670_100088866
485 Ga0070677_10019883
486 Ga0070682_100012949
487 Ga0068868_100018848
488 Ga0070689_100143040
489 Ga0070687_100149539
490 Ga0070669_100060530
491 Ga0070669_100125865
492 Ga0070675_100011560
493 Ga0070675_100154491
494 Ga0070671_100084731
495 Ga0070671_100099227
496 Ga0070671_100151424
497 Ga0070674_100201925
498 Ga0070688_100083317
499 Ga0070667_100105942
500 Ga0070709_10046894
501 Ga0070709_10249207
502 Ga0070713_100033319
503 Ga0070701_10035153
504 Ga0070700_100010244
505 Ga0070700_100133214
506 Ga0070708_100000017
507 Ga0070708_100051451
508 Ga0070708_100265736
509 Ga0070708_100330121
510 Ga0070678_100090369
511 Ga0070681_10132587
512 Ga0070681_10488934
513 Ga0068867_100007852
514 Ga0070685_10153373
515 Ga0070706_100093032
516 Ga0070706_100124093
517 Ga0070698_100349545
518 Ga0070684_100055150
519 Ga0070684_100131526
520 Ga0070684_100422094
521 Ga0068853_100009827
522 Ga0070672_100012923
523 Ga0070686_100017525
524 Ga0070695_100163404
525 Ga0070696_100071832
526 Ga0070665_100000108
527 Ga0068855_100051841
528 Ga0070664_100168494
529 Ga0068857_100137249
530 Ga0068856_100213179
531 Ga0068852_100341018
532 Ga0068864_100096774
533 Ga0068864_100117434
534 Ga0068864_100287352
535 Ga0068861_100053270
536 Ga0068861_100135680
537 Ga0068851_10004550
538 Ga0068851_10037766
539 Ga0068863_100206540
540 Ga0068863_100311762
541 Ga0068858_100086455
542 Ga0068858_100136818
543 Ga0068858_100498018
544 Ga0068860_100028068
545 Ga0068860_100081685
546 Ga0068862_100024485
547 Ga0068862_100046445
548 Ga0068862_100242766
549 Ga0081455_10016106
550 Ga0081455_10022272
551 Ga0081455_10032211
552 Ga0081455_10048480
553 Ga0081538_10003177
554 Ga0081540_1000527
555 Ga0081540_1005987
556 Ga0081540_1011271
557 Ga0081540_1016209
558 Ga0081539_10000204
559 Ga0081539_10006434
560 Ga0070717_10010276
561 Ga0070717_10050136
562 Ga0070712_100109713
563 Ga0070712_100311741
564 Ga0075367_10040311
565 Ga0075367_10056614
566 Ga0075367_10062089
567 Ga0075367_10146884
568 Ga0075366_10000689
569 Ga0075366_10042563
570 Ga0075366_10097677
571 Ga0097621_100035778
572 Ga0097621_100152104
573 Ga0097621_100351125
574 Ga0097621_100466494
575 Ga0075370_10096928
576 Ga0068871_100053214
577 Ga0068871_100178406
578 Ga0068871_100218153
579 Ga0075428_100028229
580 Ga0075428_100170218
581 Ga0075431_100043435
582 Ga0075431_100061786
583 Ga0075433_10000630
584 Ga0075434_100000062
585 Ga0075434_100016696
586 Ga0068865_100030428
587 Ga0068865_100033334
588 Ga0075436_100151776
589 Ga0105251_10080666
590 Ga0111539_10084866
591 Ga0114129_10004992
592 Ga0114129_10144514
593 Ga0105243_10050050
594 Ga0105242_10042003
595 Ga0105242_10123885
596 Ga0105248_10357946
597 Ga0105237_10183504
598 Ga0105238_10039744
599 Ga0105249_10263250
600 Ga0105028_101109
601 Ga0105239_10117267
602 Ga0157369_10237406
603 Ga0157374_10029436
604 Ga0157374_10164630
605 Ga0157374_10462545
606 Ga0157378_10030417
607 Ga0163162_10012683
608 Ga0163162_10210308
609 Ga0163162_10213556
610 Ga0157372_10035356
611 Ga0157372_10037551
612 Ga0157375_10007505
613 Ga0163163_10004894
614 Ga0163163_10115026
615 Ga0157380_10031528
616 Ga0157380_10173120
617 Ga0157379_10130106
618 Ga0157376_10001620
619 Ga0157376_10197701
620 Ga0163161_10175518
621 Ga0213876_10002263
622 Ga0209760_100825
623 Ga0209784_100094
624 Ga0209566_101305
625 Ga0207427_100100
626 Ga0209437_100059
627 Ga0209258_100034
628 Ga0209646_1000005
629 Ga0209646_1002083
630 Ga0209026_1000232
631 Ga0209026_1001373
632 Ga0209148_1000001
633 Ga0209759_1001936
634 Ga0209233_1000002
635 Ga0209455_1000054
636 Ga0209455_1007853
637 Ga0209673_1003179
638 Ga0209130_1000462
639 Ga0209025_1000408
640 Ga0209564_1000364
641 Ga0209758_1000904
642 Ga0209758_1016332
643 Ga0209758_1028319
644 Ga0209256_1004405
645 Ga0207426_1000066
646 Ga0207426_1000600
647 Ga0207682_10050978
648 Ga0207699_10036497
649 Ga0207699_10039629
650 Ga0207645_10007792
651 Ga0207643_10087935
652 Ga0207684_10119712
653 Ga0207654_10181675
654 Ga0207695_10000023
655 Ga0207695_10000031
656 Ga0207695_10110586
657 Ga0207693_10125195
658 Ga0207662_10049604
659 Ga0207652_10121687
660 Ga0207652_10128876
661 Ga0207681_10023179
662 Ga0207681_10074736
663 Ga0207650_10022754
664 Ga0207659_10172606
665 Ga0207700_10057009
666 Ga0207664_10001921
667 Ga0207644_10035219
668 Ga0207644_10160545
669 Ga0207706_10032947
670 Ga0207686_10070330
671 Ga0207709_10006778
672 Ga0207670_10211267
673 Ga0207704_10057045
674 Ga0207704_10057882
675 Ga0207691_10012293
676 Ga0207711_10098336
677 Ga0207711_10149143
678 Ga0207689_10002769
679 Ga0207689_10100545
680 Ga0207689_10230425
681 Ga0207689_10316747
682 Ga0207661_10015079
683 Ga0207667_10163202
684 Ga0207651_10078209
685 Ga0207651_10195229
686 Ga0207658_10012941
687 Ga0207677_10289779
688 Ga0207703_10062462
689 Ga0207639_10139689
690 Ga0207708_10004481
691 Ga0207648_10009414
692 Ga0207648_10020880
693 Ga0207676_10065785
694 Ga0207676_10130553
695 Ga0207674_10024382
696 Ga0207675_100136972
697 Ga0207675_100238290
698 Ga0207675_100303664
699 Ga0207683_10106553
700 Ga0207683_10139625
701 Ga0207683_10170134
702 Ga0207698_10145483
703 Ga0268266_10000001
704 Ga0268266_10000189
705 Ga0268266_10361040
706 Ga0268265_10015212
707 Ga0268265_10022791
708 Ga0268265_10207609
709 Ga0268265_10261717
710 Ga0268264_10000201
711 Ga0307517_10001507
712 Ga0307515_10000305
713 Ga0307515_10053578
714 Ga0265338_10002851
715 Ga0265338_10013065
716 Ga0307512_10005400
717 Ga0307512_10021450
718 Ga0307513_10026482
719 Ga0307509_10179426
720 Ga0307509_10255358
721 Ga0307408_100179225
722 Ga0307508_10000072
723 Ga0307514_10021569
724 Ga0307405_10321523
725 Ga0307518_10069665
726 Ga0307410_10151231
727 Ga0307409_100157525
728 Ga0307415_100051997
729 Ga0307415_100238857
730 Ga0307507_10124251
731 Ga0307510_10097517
732 Ga0373958_0004121
733 Ga0373938_0006556
734 Ga0373926_0026433
735 Ga0373929_0005105
736 Ga0373940_0068360
737 Ga0373923_0009081
738 Ga0373939_0011941
739 Ga0373953_0006628
740 Ga0373954_0034869
741 Ga0373956_0010675
742 Ga0373957_0009831
743 Ga0373955_0024539
744 Ga0373942_0029612
745 Ga0373961_0078858
746 Ga0373962_0016092
747 Ga0373931_0013584
748 Ga0373933_0052319
749 Ga0373933_0108911
750 Ga0373937_0088872
751 Ga0373937_0111505
752 Ga0373925_0015895
753 Ga0400483_279059
754 Ga0436365_0191965
755 Ga0436365_1751144
756 Ga0436363_1366179
757 Ga0436362_0026763
758 Ga0439465_0006629
759 Ga0439465_0059863
760 Ga0439446_0018248
761 Ga0439464_0060986
762 Ga0466966_0058639
763 Ga0466963_0126677
764 Ga0466959_0030544
765 Ga0466958_0102151
766 Ga0495617_045212
767 Ga0495603_0007619
768 Ga0495603_0032677
769 Ga0495590_0052388
770 Ga0495629_0052518
771 Ga0495629_0085275
772 Ga0495629_0128484
773 Ga0495638_0001562
774 Ga0495638_0105902
775 Ga0495641_0075938
776 Ga0495641_0078316
777 Ga0495651_0086718
778 Ga0495580_0176883
779 Ga0495580_0342342
780 Ga0495582_0026032
781 Ga0495639_0088766
782 Ga0495664_0008184
783 Ga0495596_0035387
784 Ga0495607_0101547
785 Ga0495607_0160854
786 Ga0495583_0084141
787 Ga0495606_0148157
788 Ga0495608_0046779
789 Ga0495610_0013988
790 Ga0495618_0102224
791 Ga0495620_0033221
792 Ga0495628_0090361
793 Ga0495643_0013674
794 Ga0495663_0000297
795 Ga0495663_0032350
796 Ga0495640_0181644
797 Ga0495586_0007017
798 Ga0495587_0003384
799 Ga0495645_0044773
800 Ga0495645_0126392
801 Ga0495622_0001100
802 Ga0495667_0013091
803 Ga0495667_0083019
804 Ga0495656_0079760
805 Ga0495668_0136283
806 Ga0495634_0020830
807 Ga0495625_0003360
808 Ga0495625_0006558
809 Ga0495625_0015130
810 Ga0495635_0010178
811 Ga0495659_0048509
812 Ga0495657_0017216
813 Ga0495657_0172672
814 Ga0495599_0009148
815 Ga0495669_0033849
816 Ga0495669_0043333
817 Ga0495671_0009337
818 Ga0495649_0006390
819 Ga0495649_0082395
820 Ga0495581_0077194
821 Ga0495674_0211359
822 Ga0495674_0212895
823 Ga0495680_0032014
824 Ga0495687_000010
825 Ga0495685_033185
826 Ga0495684_0027906
827 Ga0495684_0134814
828 Ga0495593_0068703
829 Ga0495602_0050945
830 Ga0495614_0021222
831 Ga0496100_0004715
832 Ga0496101_0001574
833 Ga0496102_0324810
834 Ga0496104_0175472
835 Ga0496105_0035392
836 Ga0496105_0120323
837 Ga0496109_0050851
838 Ga0496115_0001179
839 Ga0496115_0002362
840 Ga0496115_0036345
841 Ga0496115_0078518
842 Ga0496115_0162958
843 Ga0496121_0004235
844 Ga0496121_0010307
845 Ga0496123_0039857
846 Ga0496126_0046085
847 Ga0496126_0107458
848 Ga0495678_019506
849 Ga0501036_0118929
850 Ga0501040_0059523
851 Ga0501041_0030491
852 Ga0501042_0156502
853 Ga0501046_0071926
854 Ga0501047_0066858
855 Ga0501071_0089760
856 Ga0501072_0020429
857 Ga0501075_0017964
858 Ga0501075_0245162
859 Ga0501076_0010332
860 Ga0501076_0195363
861 Ga0501079_0079470
862 Ga0501080_0334802
863 Ga0501081_0008269
864 Ga0501081_0015152
865 Ga0501081_0322653
866 Ga0501044_0205135
867 Ga0501045_0146723
868 nmdc:mga0k408_781_c1
869 nmdc:mga0k408_87505_c1
870 nmdc:mga05p37_111334_c1
871 nmdc:mga0qj67_335089_c1
872 nmdc:mga06r32_318068_c1
873 nmdc:mga06r32_383131_c1
874 nmdc:mga08y16_107877_c1
875 nmdc:mga08y16_85099_c1
876 nmdc:mga0n895_13484_c1
877 nmdc:mga0n895_25132_c1
878 nmdc:mga0rr50_59241_c1
879 nmdc:mga0rr50_68382_c1
880 nmdc:mga08x19_8423_c1
881 nmdc:mga0a205_3551_c1
882 nmdc:mga0a205_48204_c1
883 Ga0495612_0086619
884 Ga0500644_0063367
885 Ga0500644_0071272
886 Ga0500641_0028115
887 Ga0500556_0001981
888 Ga0500572_024173
889 Ga0500595_007529
890 Ga0500642_0001003
891 Ga0500642_0159473
892 Ga0500559_0000185
893 Ga0500568_0002392
894 Ga0500568_0005253
895 Ga0500577_0004664
896 Ga0500604_0025931
897 Ga0500620_071368
898 Ga0500627_0141012
899 Ga0501084_0020052
900 Ga0590071_008086
901 Ga0590075_038758
902 Ga0501082_0164937
903 Ga0466962_0030399
904 Ga0530510_0441571
905 2513695787
906 2513891388
907 2514588192
908 2587759599
909 2723847252
910 2739732737
911 2765464967
912 2788434066
913 2793084158
914 2849282347
915 2874607268
916 2889038136
917 2922368564
918 2922387463
919 8003152473
920 8006968386
921 8006994834
922 8056679401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

56

140

0.92

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

32

200

0.89

PF04321

RmlD_sub_bind

RmlD substrate binding domain

29

216

0.85

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

32

240

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

31

245

0.81

PF07993

NAD_binding_4

Male sterility protein

74

203

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mfh-assembly1.cif.gz_A mutated uronate dehydrogenase 0.8095 2 299
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.8084 2 297
3ay3-assembly2.cif.gz_D crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens 0.8023 2 304
4yrb-assembly2.cif.gz_D mouse tdh mutant r180k with nad+ bound 0.7954 2 297
4yrb-assembly2.cif.gz_C mouse tdh mutant r180k with nad+ bound 0.7947 2 293
ID Description Score Start End Superfamily
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9864 1 299 3.40.50.720
af_Q6MWX3_36_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9832 1 299 3.40.50.720
4bjyA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9379 2 33 3.50.50.60
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8937 1 224 3.40.50.720
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.893 3 286 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A421DMM8-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9803 1 326
AF-A0A364WLU6-F1-model_v4 deleted 0.9799 1 113
AF-A0A537Q0W5-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9795 1 230
AF-A0A1R3VKC9-F1-model_v4 UDP-glucose 4-epimerase 0.9793 122 298
AF-A0A397I7Q6-F1-model_v4 deleted 0.9759 2 309

Map