F448740

General Info

Members Datasets Scaffolds Average Seq Length
461 304 922 436

Family's Representative Sequence

Representative Sequence 3300025254|Ga0209148_1002265|Ga0209148_10022655
Length 476
Sequence MGARGRLAAPRLPWRARQLVSATGSVRAVGNDAAFARAKAAIPGGVNSPVRAFGSVGGTPRFIVSAQGATVTDVEGREYVDLVMSWGPALLGHAHPAVVDAVRQAAGRGLSFGASTPGETELAELVRSRLCVDDTRAIDKLRLVSTGTEATMTAIRLARAATGRELLIKFAGHYHGHSDGLLAEAGSGVATLGLPGSAGVPEAVAALTLVLPYNDLDAVRAAFAAHPGRIAAIITEAAGANAGVLPPTRGFNRALATIAHENGALLILDEVLTGFRVGPAGWWGLEAARVVPDGAGWTPDLVTFGKVLGGGLPLAAVGGRAELLDHLAPKGPVYQAGTLSGNPLAVAAGIETLTNATPEVYARVNRAADAVAGALHDALDAEGVAHVIPRAGSLFSLAFRTGPVRSYADAQDQEAWRYPAFFHAMLDAGVSLPPSVFEAWFLSAAHDDHVLDRIMSALPVAAKASTKISPPQPPPI

Samples

Sample ID Description Type Environment
1 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
121 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
213 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
219 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
220 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
221 2643221546 Microbacterium sp. Root53 Isolate Unclassified
222 2643221553 Microbacterium sp. Root553 Isolate Unclassified
223 2643221572 Leifsonia sp. Root60 Isolate Unclassified
224 2643221630 Microbacterium sp. Root322 Isolate Unclassified
225 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
226 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
227 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
228 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
229 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
230 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
231 2739367653 Kocuria sp. OV113 Isolate Unclassified
232 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
233 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
234 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
235 2773857759 Microbacterium sp. 1294 Isolate Unclassified
236 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
237 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
238 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
239 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
240 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
241 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
242 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
243 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
244 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
245 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
246 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
247 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
248 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
249 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
250 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
251 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
252 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
253 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
254 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
255 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
256 2857727296 Kocuria sp. R-72562 Isolate Unclassified
257 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
258 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
259 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
260 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
261 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
262 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
263 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
264 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
265 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
266 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
267 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
268 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
269 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
270 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
271 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
272 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
273 2919069694 Microbacterium sp. 1154 Isolate Unclassified
274 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
275 2919395869 Microbacterium resistens 2980 Isolate Unclassified
276 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
277 2920879853 Kocuria salina CV6 Isolate Unclassified
278 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
279 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
280 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
281 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
282 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
283 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
284 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
285 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
286 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
287 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
288 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
289 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
290 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
291 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
292 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
293 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
294 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
295 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
296 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
297 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
298 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
299 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
300 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
301 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
302 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
303 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
304 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.13
Metatranscriptomes 0.22
Isolates 18.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 8.24
Nodule 0
Rhizoplane 4.34
Rhizosphere 65.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209148_1002265 3300025254 Bacteria 6953
2 LJQas_1000086 3300000549 Bacteria 15859
3 LJQas_1000534 3300000549 Bacteria 6248
4 JGI25154J39366_1002293 3300002738 Bacteria 5158
5 Ga0055542_1005338 3300003762 Bacteria 2923
6 Ga0070658_10057921 3300005327 Bacteria 3152
7 Ga0070658_10225843 3300005327 Bacteria 1584
8 Ga0070676_10016152 3300005328 Bacteria 4124
9 Ga0070683_100022950 3300005329 Bacteria 5579
10 Ga0070677_10000018 3300005333 Bacteria 51146
11 Ga0068868_100005726 3300005338 Bacteria 8746
12 Ga0070660_100027444 3300005339 Bacteria 4249
13 Ga0070675_100018309 3300005354 Bacteria 5575
14 Ga0070659_100000458 3300005366 Bacteria 30122
15 Ga0070667_100012070 3300005367 Bacteria 7151
16 Ga0070662_100000008 3300005457 Bacteria 168754
17 Ga0070681_10033851 3300005458 Bacteria 5130
18 Ga0070685_10017753 3300005466 Bacteria 3814
19 Ga0070679_100000507 3300005530 Bacteria 33181
20 Ga0070684_100141949 3300005535 Bacteria 2172
21 Ga0068853_100001814 3300005539 Bacteria 15699
22 Ga0068853_100095659 3300005539 Bacteria 2619
23 Ga0070672_100016090 3300005543 Bacteria 5349
24 Ga0070693_100000093 3300005547 Bacteria 38785
25 Ga0068855_100117954 3300005563 Bacteria 3040
26 Ga0068855_100198408 3300005563 Bacteria 2260
27 Ga0068855_100314700 3300005563 Bacteria 1731
28 Ga0068857_100017419 3300005577 Bacteria 6296
29 Ga0068857_100150573 3300005577 Bacteria 2108
30 Ga0068856_100031141 3300005614 Bacteria 5218
31 Ga0068852_100002621 3300005616 Bacteria 12424
32 Ga0068852_100007120 3300005616 Bacteria 8148
33 Ga0068852_100099257 3300005616 Bacteria 2624
34 Ga0068859_100210784 3300005617 Bacteria 2029
35 Ga0068864_100023875 3300005618 Bacteria 5139
36 Ga0068851_10000033 3300005834 Bacteria 108511
37 Ga0068858_100000943 3300005842 Bacteria 30121
38 Ga0068860_100019843 3300005843 Bacteria 6519
39 Ga0075365_10015068 3300006038 Bacteria 4667
40 Ga0075365_10040184 3300006038 Bacteria 3050
41 Ga0075364_10031335 3300006051 Bacteria 3417
42 Ga0075432_10001712 3300006058 Bacteria 7214
43 Ga0075432_10003827 3300006058 Bacteria 5131
44 Ga0075370_10018612 3300006353 Bacteria 3769
45 Ga0075370_10029167 3300006353 Bacteria 3071
46 Ga0075428_100038780 3300006844 Bacteria 5243
47 Ga0097620_100210784 3300006931 Bacteria 2029
48 Ga0105251_10021738 3300009011 Bacteria 3343
49 Ga0105240_10001915 3300009093 Bacteria 34563
50 Ga0105240_10226822 3300009093 Bacteria 2173
51 Ga0105240_10369527 3300009093 Bacteria 1622
52 Ga0105245_10000488 3300009098 Bacteria 36321
53 Ga0105245_10036420 3300009098 Bacteria 4371
54 Ga0105245_10105761 3300009098 Bacteria 2610
55 Ga0105241_10002014 3300009174 Bacteria 15372
56 Ga0105248_10000491 3300009177 Bacteria 44907
57 Ga0105248_10288731 3300009177 Bacteria 1847
58 Ga0105237_10000907 3300009545 Bacteria 39837
59 Ga0105238_10002651 3300009551 Bacteria 17803
60 Ga0105238_10152223 3300009551 Bacteria 2288
61 Ga0105239_10040478 3300010375 Bacteria 5106
62 Ga0105239_10354266 3300010375 Bacteria 1657
63 Ga0157369_10000337 3300013105 Bacteria 62293
64 Ga0157374_10072483 3300013296 Bacteria 3250
65 Ga0163162_10062954 3300013306 Bacteria 3751
66 Ga0157372_10180958 3300013307 Bacteria 2440
67 Ga0163163_10001832 3300014325 Bacteria 17941
68 Ga0163163_10158847 3300014325 Bacteria 2306
69 Ga0157379_10230375 3300014968 Bacteria 1679
70 Ga0209646_1000014 3300025246 Bacteria 550484
71 Ga0209148_1002418 3300025254 Bacteria 6469
72 Ga0209455_1001262 3300025272 Bacteria 11867
73 Ga0209051_1001059 3300025303 Bacteria 25694
74 Ga0207697_10003206 3300025315 Bacteria 8140
75 Ga0207656_10000001 3300025321 Bacteria 1323684
76 Ga0207655_1003273 3300025728 Bacteria 12152
77 Ga0207655_1012825 3300025728 Bacteria 4857
78 Ga0207713_1020629 3300025735 Bacteria 3186
79 Ga0207682_10027025 3300025893 Bacteria 2284
80 Ga0207680_10101118 3300025903 Bacteria 1853
81 Ga0207645_10014263 3300025907 Bacteria 5322
82 Ga0207705_10005295 3300025909 Bacteria 9652
83 Ga0207654_10000001 3300025911 Bacteria 1816198
84 Ga0207695_10005577 3300025913 Bacteria 16620
85 Ga0207695_10007700 3300025913 Bacteria 13638
86 Ga0207671_10000001 3300025914 Bacteria 1318881
87 Ga0207671_10208526 3300025914 Bacteria 1528
88 Ga0207657_10052954 3300025919 Bacteria 3519
89 Ga0207652_10000177 3300025921 Bacteria 67555
90 Ga0207681_10005539 3300025923 Bacteria 7757
91 Ga0207694_10000019 3300025924 Bacteria 312382
92 Ga0207694_10157959 3300025924 Bacteria 1830
93 Ga0207650_10020174 3300025925 Bacteria 4697
94 Ga0207659_10013444 3300025926 Bacteria 5243
95 Ga0207687_10000241 3300025927 Bacteria 37298
96 Ga0207687_10057362 3300025927 Bacteria 2736
97 Ga0207690_10000539 3300025932 Bacteria 24682
98 Ga0207706_10000016 3300025933 Bacteria 170697
99 Ga0207691_10002104 3300025940 Bacteria 19455
100 Ga0207711_10001157 3300025941 Bacteria 25105
101 Ga0207661_10009721 3300025944 Bacteria 6905
102 Ga0207667_10007932 3300025949 Bacteria 12670
103 Ga0207667_10068654 3300025949 Bacteria 3690
104 Ga0207667_10077893 3300025949 Bacteria 3436
105 Ga0207651_10035685 3300025960 Bacteria 3237
106 Ga0207658_10034353 3300025986 Bacteria 3624
107 Ga0207677_10000429 3300026023 Bacteria 28292
108 Ga0207677_10073142 3300026023 Bacteria 2426
109 Ga0207703_10000815 3300026035 Bacteria 30734
110 Ga0207639_10001394 3300026041 Bacteria 16320
111 Ga0207702_10164864 3300026078 Bacteria 2026
112 Ga0207641_10052504 3300026088 Bacteria 3453
113 Ga0207676_10082137 3300026095 Bacteria 2620
114 Ga0207674_10006184 3300026116 Bacteria 14123
115 Ga0207683_10004789 3300026121 Bacteria 11653
116 Ga0207698_10000154 3300026142 Bacteria 44301
117 Ga0207698_10000494 3300026142 Bacteria 23028
118 Ga0207428_10004464 3300027907 Bacteria 13277
119 Ga0268264_10013630 3300028381 Bacteria 6690
120 Ga0307515_10190792 3300028794 Bacteria 1960
121 Ga0265338_10104456 3300028800 Bacteria 2299
122 Ga0307408_100018456 3300031548 Bacteria 4683
123 Ga0307408_100066848 3300031548 Bacteria 2641
124 Ga0307408_100122857 3300031548 Bacteria 2014
125 Ga0307408_100180748 3300031548 Bacteria 1691
126 Ga0307514_10004259 3300031649 Bacteria 13222
127 Ga0307405_10018697 3300031731 Bacteria 3829
128 Ga0307405_10068150 3300031731 Bacteria 2276
129 Ga0307405_10136885 3300031731 Bacteria 1701
130 Ga0307518_10102376 3300031838 Bacteria 2049
131 Ga0307410_10000891 3300031852 Bacteria 12759
132 Ga0307410_10015110 3300031852 Bacteria 4569
133 Ga0307410_10031328 3300031852 Bacteria 3411
134 Ga0307410_10092511 3300031852 Bacteria 2150
135 Ga0307406_10000812 3300031901 Bacteria 17544
136 Ga0307406_10001097 3300031901 Bacteria 15087
137 Ga0307407_10094946 3300031903 Bacteria 1837
138 Ga0307412_10003144 3300031911 Bacteria 9170
139 Ga0307412_10007304 3300031911 Bacteria 6265
140 Ga0307412_10026747 3300031911 Bacteria 3590
141 Ga0307412_10035454 3300031911 Bacteria 3188
142 Ga0307409_100018829 3300031995 Bacteria 4656
143 Ga0307409_100043508 3300031995 Bacteria 3373
144 Ga0307409_100053151 3300031995 Bacteria 3111
145 Ga0307409_100090219 3300031995 Bacteria 2508
146 Ga0307409_100164815 3300031995 Bacteria 1943
147 Ga0307416_100006299 3300032002 Bacteria 7416
148 Ga0307416_100012801 3300032002 Bacteria 5672
149 Ga0307416_100039375 3300032002 Bacteria 3658
150 Ga0307416_100063876 3300032002 Bacteria 3017
151 Ga0307416_100252839 3300032002 Bacteria 1716
152 Ga0307414_10005890 3300032004 Bacteria 6784
153 Ga0307414_10150589 3300032004 Bacteria 1835
154 Ga0373961_0012317 3300035241 Bacteria 2139
155 Ga0395899_0001441 3300037312 Bacteria 20309
156 Ga0395899_0010773 3300037312 Bacteria 7008
157 Ga0395899_0050211 3300037312 Bacteria 3098
158 Ga0395900_0012483 3300037418 Bacteria 8687
159 Ga0395900_0030808 3300037418 Bacteria 5509
160 Ga0395900_0268837 3300037418 Bacteria 1700
161 Ga0395898_0007619 3300037466 Bacteria 11491
162 Ga0395898_0008489 3300037466 Bacteria 10852
163 Ga0395898_0020548 3300037466 Bacteria 6706
164 Ga0395898_0108799 3300037466 Bacteria 2657
165 Ga0395898_0160607 3300037466 Bacteria 2149
166 Ga0395898_0261019 3300037466 Bacteria 1652
167 Ga0395898_0270849 3300037466 Bacteria 1620
168 Ga0395905_0009139 3300037471 Bacteria 9711
169 Ga0395905_0029519 3300037471 Bacteria 5166
170 Ga0395905_0069012 3300037471 Bacteria 3311
171 Ga0395901_0011818 3300038443 Bacteria 8852
172 Ga0395901_0014073 3300038443 Bacteria 8145
173 Ga0395901_0108139 3300038443 Bacteria 2919
174 Ga0395901_0108168 3300038443 Bacteria 2919
175 Ga0395901_0115501 3300038443 Bacteria 2819
176 Ga0395901_0159403 3300038443 Bacteria 2369
177 Ga0395901_0184384 3300038443 Bacteria 2189
178 Ga0395901_0206356 3300038443 Bacteria 2058
179 Ga0439436_0037285 3300041404 Bacteria 1400
180 Ga0439439_0016108 3300041406 Bacteria 1829
181 Ga0439447_009447 3300041407 Bacteria 2955
182 Ga0439466_0002272 3300041411 Bacteria 7532
183 Ga0439466_0015794 3300041411 Bacteria 2739
184 Ga0439433_0000043 3300041999 Bacteria 15638
185 Ga0439433_0000638 3300041999 Bacteria 6703
186 Ga0439442_001587 3300042002 Bacteria 4457
187 Ga0439449_0001126 3300042007 Bacteria 10485
188 Ga0439449_0028894 3300042007 Bacteria 2066
189 Ga0439452_016768 3300042010 Bacteria 1982
190 Ga0439457_007610 3300042014 Bacteria 2594
191 Ga0439457_015833 3300042014 Bacteria 1683
192 Ga0439462_0005436 3300042015 Bacteria 3141
193 Ga0439462_0007061 3300042015 Bacteria 2807
194 Ga0450919_001112 3300042121 Bacteria 3486
195 Ga0450920_002024 3300042122 Bacteria 3426
196 Ga0439446_0018679 3300042156 Bacteria 1945
197 Ga0450908_005776 3300042184 Bacteria 2365
198 Ga0439434_0012694 3300042435 Bacteria 2495
199 Ga0450918_001240 3300042531 Bacteria 5183
200 Ga0466969_0033070 3300044656 Bacteria 2628
201 Ga0466972_0030313 3300044658 Bacteria 2663
202 Ga0466965_0000004 3300044683 Bacteria 229348
203 Ga0466970_0000182 3300044765 Bacteria 30079
204 Ga0466970_0021191 3300044765 Bacteria 3384
205 Ga0466960_0052796 3300044901 Bacteria 1968
206 Ga0466967_0022011 3300045976 Bacteria 5191
207 Ga0495641_0000001 3300046461 Bacteria 485224
208 Ga0495653_0009391 3300046463 Bacteria 8005
209 Ga0495650_0000211 3300046471 Bacteria 125248
210 Ga0495580_0020572 3300046472 Bacteria 4882
211 Ga0495580_0020636 3300046472 Bacteria 4873
212 Ga0495582_0031325 3300046473 Bacteria 2923
213 Ga0495639_0001140 3300046475 Bacteria 12001
214 Ga0495662_0004919 3300046476 Bacteria 6689
215 Ga0495664_0037970 3300046477 Bacteria 2843
216 Ga0495594_0068275 3300046499 Bacteria 1974
217 Ga0495644_0000296 3300046523 Bacteria 23051
218 Ga0495665_0004831 3300046531 Bacteria 7271
219 Ga0495665_0054617 3300046531 Bacteria 2110
220 Ga0495640_0076801 3300046533 Bacteria 2228
221 Ga0495586_0000411 3300046535 Bacteria 26021
222 Ga0495586_0012810 3300046535 Bacteria 4444
223 Ga0495587_0001102 3300046536 Bacteria 17749
224 Ga0495587_0062703 3300046536 Bacteria 2176
225 Ga0495645_0002611 3300046543 Bacteria 12254
226 Ga0495667_0016653 3300046559 Bacteria 4963
227 Ga0495588_0002768 3300046674 Bacteria 7533
228 Ga0495588_0025735 3300046674 Bacteria 2934
229 Ga0495657_0017190 3300046675 Bacteria 5255
230 Ga0495670_0060096 3300046691 Bacteria 1909
231 Ga0495649_0001084 3300046694 Bacteria 21240
232 Ga0495600_0000804 3300046809 Bacteria 16637
233 Ga0495581_0000375 3300047315 Bacteria 22364
234 Ga0495604_0143163 3300047317 Bacteria 1706
235 Ga0495636_0092269 3300047318 Bacteria 1316
236 Ga0495674_0000025 3300047319 Bacteria 141103
237 Ga0495676_0000091 3300047321 Bacteria 66575
238 Ga0495676_0007581 3300047321 Bacteria 9947
239 Ga0495680_0000286 3300047322 Bacteria 56839
240 Ga0495680_0003949 3300047322 Bacteria 14338
241 Ga0495677_0066478 3300047445 Bacteria 1341
242 Ga0495686_0051228 3300047472 Bacteria 2591
243 Ga0495593_0040796 3300047673 Bacteria 2498
244 Ga0496100_0006908 3300048903 Bacteria 6218
245 Ga0496101_0017951 3300048904 Bacteria 4803
246 Ga0496102_0072883 3300048905 Bacteria 3157
247 Ga0496103_0004538 3300048906 Bacteria 8405
248 Ga0496103_0005094 3300048906 Bacteria 7917
249 Ga0496104_0098129 3300048907 Bacteria 2804
250 Ga0496104_0142035 3300048907 Bacteria 2306
251 Ga0496105_0180103 3300048908 Bacteria 1731
252 Ga0496106_0010066 3300048909 Bacteria 6983
253 Ga0496107_0072184 3300048910 Bacteria 2509
254 Ga0496108_0051492 3300048911 Bacteria 3450
255 Ga0496108_0099346 3300048911 Bacteria 2480
256 Ga0496109_0138839 3300048912 Bacteria 2272
257 Ga0496109_0147946 3300048912 Bacteria 2198
258 Ga0496110_0055979 3300048913 Bacteria 3471
259 Ga0496110_0213039 3300048913 Bacteria 1756
260 Ga0496111_0029392 3300048914 Bacteria 3903
261 Ga0496111_0049343 3300048914 Bacteria 3035
262 Ga0496112_0044163 3300048915 Bacteria 4366
263 Ga0496113_0091285 3300048916 Bacteria 2347
264 Ga0496116_0042200 3300048919 Bacteria 3121
265 Ga0496117_0000014 3300048920 Bacteria 584427
266 Ga0496117_0001818 3300048920 Bacteria 28966
267 Ga0496117_0004343 3300048920 Bacteria 15736
268 Ga0496117_0019399 3300048920 Bacteria 5585
269 Ga0496117_0023630 3300048920 Bacteria 4891
270 Ga0496117_0033239 3300048920 Bacteria 3902
271 Ga0496117_0052912 3300048920 Bacteria 2857
272 Ga0496118_0009469 3300048921 Bacteria 9833
273 Ga0496118_0022936 3300048921 Bacteria 5438
274 Ga0496118_0031549 3300048921 Bacteria 4390
275 Ga0496118_0033726 3300048921 Bacteria 4193
276 Ga0496119_0000256 3300048922 Bacteria 75557
277 Ga0496119_0000665 3300048922 Bacteria 46063
278 Ga0496119_0001672 3300048922 Bacteria 25921
279 Ga0496119_0006877 3300048922 Bacteria 10385
280 Ga0496120_0001067 3300048923 Bacteria 36237
281 Ga0496120_0001070 3300048923 Bacteria 36178
282 Ga0496120_0001926 3300048923 Bacteria 22867
283 Ga0496120_0006465 3300048923 Bacteria 8987
284 Ga0496120_0012096 3300048923 Bacteria 5893
285 Ga0496120_0019196 3300048923 Bacteria 4381
286 Ga0496120_0059460 3300048923 Bacteria 2142
287 Ga0496121_0000046 3300048924 Bacteria 335942
288 Ga0496121_0109827 3300048924 Bacteria 2106
289 Ga0496122_0000358 3300048925 Bacteria 98103
290 Ga0496122_0003957 3300048925 Bacteria 18927
291 Ga0496122_0010482 3300048925 Bacteria 9542
292 Ga0496122_0041296 3300048925 Bacteria 3650
293 Ga0496122_0058609 3300048925 Bacteria 2848
294 Ga0496123_0000011 3300048926 Bacteria 493925
295 Ga0496123_0000280 3300048926 Bacteria 100544
296 Ga0496123_0001267 3300048926 Bacteria 36223
297 Ga0496124_0001222 3300048927 Bacteria 39704
298 Ga0496124_0001548 3300048927 Bacteria 33313
299 Ga0496124_0002588 3300048927 Bacteria 23409
300 Ga0496124_0073182 3300048927 Bacteria 2836
301 Ga0496125_0012209 3300048928 Bacteria 8546
302 Ga0496125_0024378 3300048928 Bacteria 5565
303 Ga0496125_0027000 3300048928 Bacteria 5213
304 Ga0496125_0028179 3300048928 Bacteria 5078
305 Ga0496125_0036820 3300048928 Bacteria 4263
306 Ga0496126_0002989 3300048929 Bacteria 21953
307 Ga0496126_0011674 3300048929 Bacteria 9062
308 Ga0496126_0034456 3300048929 Bacteria 4755
309 Ga0496126_0130877 3300048929 Bacteria 2168
310 Ga0501321_003818 3300049537 Bacteria 1406
311 Ga0501032_0000135 3300049569 Bacteria 60174
312 Ga0501032_0105939 3300049569 Bacteria 1862
313 Ga0501032_0181130 3300049569 Bacteria 1379
314 Ga0501034_0000505 3300049571 Bacteria 62933
315 Ga0501034_0009794 3300049571 Bacteria 10022
316 Ga0501034_0010404 3300049571 Bacteria 9694
317 Ga0501034_0010414 3300049571 Bacteria 9690
318 Ga0501034_0027195 3300049571 Bacteria 5819
319 Ga0501034_0029700 3300049571 Bacteria 5557
320 Ga0501034_0045522 3300049571 Bacteria 4433
321 Ga0501034_0055089 3300049571 Bacteria 4002
322 Ga0501034_0142349 3300049571 Bacteria 2377
323 Ga0501036_0140801 3300049572 Bacteria 2036
324 Ga0501037_0003634 3300049573 Bacteria 11187
325 Ga0501037_0139547 3300049573 Bacteria 1735
326 Ga0501038_0015872 3300049574 Bacteria 6842
327 Ga0501038_0047871 3300049574 Bacteria 3702
328 Ga0501038_0158361 3300049574 Bacteria 1842
329 Ga0501043_0013013 3300049579 Bacteria 6504
330 Ga0501043_0019649 3300049579 Bacteria 5304
331 Ga0501043_0173079 3300049579 Bacteria 1684
332 Ga0501043_0193568 3300049579 Bacteria 1581
333 Ga0501047_0002416 3300049581 Bacteria 17854
334 Ga0501047_0033854 3300049581 Bacteria 4931
335 Ga0501047_0044490 3300049581 Bacteria 4290
336 Ga0501070_0073323 3300049586 Bacteria 2832
337 Ga0501073_0029244 3300049589 Bacteria 3937
338 Ga0501080_0001210 3300049742 Bacteria 21423
339 Ga0501083_0000051 3300049744 Bacteria 85348
340 Ga0501083_0008723 3300049744 Bacteria 7152
341 Ga0501083_0135091 3300049744 Bacteria 1616
342 Ga0501035_0008360 3300049822 Bacteria 9634
343 Ga0501035_0174729 3300049822 Bacteria 1854
344 Ga0501044_0052061 3300049823 Bacteria 4221
345 Ga0501044_0072585 3300049823 Bacteria 3499
346 Ga0501044_0150368 3300049823 Bacteria 2311
347 nmdc:mga00v17_15384_c1 3300050491 Bacteria 4293
348 nmdc:mga00v17_164831_c1 3300050491 Bacteria 1428
349 nmdc:mga00v17_96911_c1 3300050491 Bacteria 1858
350 nmdc:mga0yw44_106732_c1 3300050492 Bacteria 1790
351 nmdc:mga0yw44_22368_c1 3300050492 Bacteria 3067
352 nmdc:mga06z11_8896_c1 3300050494 Bacteria 4210
353 nmdc:mga07m45_18422_c1 3300050496 Bacteria 3769
354 nmdc:mga0sz30_46626_c1 3300050516 Bacteria 1830
355 Ga0495601_0000344 3300053077 Bacteria 24491
356 Ga0500635_0002103 3300053080 Bacteria 4885
357 Ga0500643_000176 3300053087 Bacteria 63098
358 Ga0500651_0000041 3300053093 Bacteria 88035
359 Ga0500556_0000008 3300053104 Bacteria 304943
360 Ga0500556_0000566 3300053104 Bacteria 24569
361 Ga0500562_002715 3300053108 Bacteria 4400
362 Ga0500593_010956 3300053117 Bacteria 3817
363 Ga0500655_002074 3300053133 Bacteria 3727
364 Ga0500559_0000220 3300053136 Bacteria 45779
365 Ga0500559_0000592 3300053136 Bacteria 24627
366 Ga0500559_0003093 3300053136 Bacteria 8287
367 Ga0500568_0000003 3300053139 Bacteria 863587
368 Ga0500568_0000383 3300053139 Bacteria 33849
369 Ga0500568_0001034 3300053139 Bacteria 19025
370 Ga0500568_0014945 3300053139 Bacteria 3486
371 Ga0500573_0000005 3300053140 Bacteria 315762
372 Ga0500573_0035245 3300053140 Bacteria 2887
373 Ga0500573_0037736 3300053140 Bacteria 2792
374 Ga0500616_0004309 3300053153 Bacteria 10205
375 Ga0500620_000041 3300053155 Bacteria 23506
376 2588107298 2585428157 Bacteria 3018951
377 2643732914 2643221542 Bacteria 3563959
378 2643751709 2643221546 Bacteria 2910897
379 2643784757 2643221553 Bacteria 3544260
380 2643877269 2643221572 Bacteria 3614809
381 2644171704 2643221630 Bacteria 3601215
382 2644181674 2643221632 Bacteria 3406696
383 2644197662 2643221635 Bacteria 2632343
384 2644384324 2643221669 Bacteria 3611286
385 2644681533 2643221724 Bacteria 3593515
386 2691514629 2690315906 Bacteria 4517044
387 2730231063 2728369380 Bacteria 3620317
388 2739602758 2739367653 Bacteria 2780952
389 2747953245 2747842429 Bacteria 3914386
390 2758225606 2757320536 Bacteria 3629334
391 2774379688 2773857758 Bacteria 3592392
392 2774384002 2773857759 Bacteria 2963774
393 2775655033 2775506735 Bacteria 4556596
394 2808630682 2808606306 Bacteria 3608896
395 2808827742 2808606357 Bacteria 4466944
396 2808853096 2808606360 Bacteria 4404006
397 2808878402 2808606366 Bacteria 4415912
398 2808891985 2808606370 Bacteria 4942454
399 2808897079 2808606371 Bacteria 4251511
400 2809227879 2808606447 Bacteria 3572005
401 2810364242 2808606700 Bacteria 3482157
402 2812320495 2811994871 Bacteria 4497550
403 2812323833 2811994872 Bacteria 4121241
404 2817508742 2816332305 Bacteria 2697803
405 2821270973 2821268502 Bacteria 3750023
406 2844849589 2844849076 Bacteria 4091819
407 2852634637 2852632344 Bacteria 3463163
408 2852643889 2852643534 Bacteria 3013378
409 2852647944 2852646457 Bacteria 3408613
410 2852663700 2852663356 Bacteria 4090475
411 2857722222 2857720070 Bacteria 3189373
412 2857726402 2857723135 Bacteria 4217853
413 2857727687 2857727296 Bacteria 2745552
414 2857738974 2857737099 Bacteria 3104305
415 2857741286 2857740372 Bacteria 4782044
416 2870630869 2870628048 Bacteria 3696012
417 2893686517 2893684298 Bacteria 2897960
418 2895661922 2895660088 Bacteria 3782833
419 2897561864 2897561785 Bacteria 3256946
420 2904499761 2904497146 Bacteria 4731781
421 2904512479 2904509784 Bacteria 3520416
422 2904776682 2904776348 Bacteria 4658726
423 2905927779 2905926851 Bacteria 4423176
424 2906802319 2906799679 Bacteria 4031749
425 2908679283 2908678064 Bacteria 3482747
426 2910813244 2910809715 Bacteria 4982797
427 2919036231 2919034639 Bacteria 4763403
428 2919052282 2919051321 Bacteria 4210889
429 2919061656 2919059106 Bacteria 4991624
430 2919069927 2919069694 Bacteria 3622919
431 2919391487 2919391150 Bacteria 4884741
432 2919397352 2919395869 Bacteria 3704152
433 2919542206 2919538618 Bacteria 4677069
434 2920882287 2920879853 Bacteria 4216831
435 2928091664 2928090899 Bacteria 3158267
436 2932400737 2932398195 Bacteria 3847976
437 2932429276 2932426870 Bacteria 4547726
438 2939598712 2939598168 Bacteria 4687164
439 2939676027 2939674588 Bacteria 4844420
440 2945921459 2945920336 Bacteria 4501603
441 2945942356 2945941187 Bacteria 4682474
442 2945959879 2945956166 Bacteria 5110334
443 2945969192 2945968032 Bacteria 4111363
444 2946005394 2946003308 Bacteria 3857229
445 2946026457 2946024296 Bacteria 3508095
446 2946036002 2946033335 Bacteria 3835514
447 2946038301 2946037020 Bacteria 4900426
448 2946041644 2946041624 Bacteria 4191385
449 2946083651 2946080515 Bacteria 4310960
450 2953999576 2953998280 Bacteria 4812144
451 2974295896 2974294766 Bacteria 3767688
452 2974306287 2974302888 Bacteria 4369871
453 2974327841 2974324384 Bacteria 3750535
454 2977238472 2977236895 Bacteria 3569373
455 2977254471 2977251589 Bacteria 2952848
456 2977264700 2977264416 Bacteria 3750737
457 2984543747 2984542743 Bacteria 3569378
458 2984581583 2984580707 Bacteria 3351387
459 8004184093 8004182704 Bacteria 3391155
460 8004213252 8004212874 Bacteria 2861420
461 8016256112 8016254467 Bacteria 3797036
462 Ga0209148_1002265
463 LJQas_1000086
464 LJQas_1000534
465 JGI25154J39366_1002293
466 Ga0055542_1005338
467 Ga0070658_10057921
468 Ga0070658_10225843
469 Ga0070676_10016152
470 Ga0070683_100022950
471 Ga0070677_10000018
472 Ga0068868_100005726
473 Ga0070660_100027444
474 Ga0070675_100018309
475 Ga0070659_100000458
476 Ga0070667_100012070
477 Ga0070662_100000008
478 Ga0070681_10033851
479 Ga0070685_10017753
480 Ga0070679_100000507
481 Ga0070684_100141949
482 Ga0068853_100001814
483 Ga0068853_100095659
484 Ga0070672_100016090
485 Ga0070693_100000093
486 Ga0068855_100117954
487 Ga0068855_100198408
488 Ga0068855_100314700
489 Ga0068857_100017419
490 Ga0068857_100150573
491 Ga0068856_100031141
492 Ga0068852_100002621
493 Ga0068852_100007120
494 Ga0068852_100099257
495 Ga0068859_100210784
496 Ga0068864_100023875
497 Ga0068851_10000033
498 Ga0068858_100000943
499 Ga0068860_100019843
500 Ga0075365_10015068
501 Ga0075365_10040184
502 Ga0075364_10031335
503 Ga0075432_10001712
504 Ga0075432_10003827
505 Ga0075370_10018612
506 Ga0075370_10029167
507 Ga0075428_100038780
508 Ga0097620_100210784
509 Ga0105251_10021738
510 Ga0105240_10001915
511 Ga0105240_10226822
512 Ga0105240_10369527
513 Ga0105245_10000488
514 Ga0105245_10036420
515 Ga0105245_10105761
516 Ga0105241_10002014
517 Ga0105248_10000491
518 Ga0105248_10288731
519 Ga0105237_10000907
520 Ga0105238_10002651
521 Ga0105238_10152223
522 Ga0105239_10040478
523 Ga0105239_10354266
524 Ga0157369_10000337
525 Ga0157374_10072483
526 Ga0163162_10062954
527 Ga0157372_10180958
528 Ga0163163_10001832
529 Ga0163163_10158847
530 Ga0157379_10230375
531 Ga0209646_1000014
532 Ga0209148_1002418
533 Ga0209455_1001262
534 Ga0209051_1001059
535 Ga0207697_10003206
536 Ga0207656_10000001
537 Ga0207655_1003273
538 Ga0207655_1012825
539 Ga0207713_1020629
540 Ga0207682_10027025
541 Ga0207680_10101118
542 Ga0207645_10014263
543 Ga0207705_10005295
544 Ga0207654_10000001
545 Ga0207695_10005577
546 Ga0207695_10007700
547 Ga0207671_10000001
548 Ga0207671_10208526
549 Ga0207657_10052954
550 Ga0207652_10000177
551 Ga0207681_10005539
552 Ga0207694_10000019
553 Ga0207694_10157959
554 Ga0207650_10020174
555 Ga0207659_10013444
556 Ga0207687_10000241
557 Ga0207687_10057362
558 Ga0207690_10000539
559 Ga0207706_10000016
560 Ga0207691_10002104
561 Ga0207711_10001157
562 Ga0207661_10009721
563 Ga0207667_10007932
564 Ga0207667_10068654
565 Ga0207667_10077893
566 Ga0207651_10035685
567 Ga0207658_10034353
568 Ga0207677_10000429
569 Ga0207677_10073142
570 Ga0207703_10000815
571 Ga0207639_10001394
572 Ga0207702_10164864
573 Ga0207641_10052504
574 Ga0207676_10082137
575 Ga0207674_10006184
576 Ga0207683_10004789
577 Ga0207698_10000154
578 Ga0207698_10000494
579 Ga0207428_10004464
580 Ga0268264_10013630
581 Ga0307515_10190792
582 Ga0265338_10104456
583 Ga0307408_100018456
584 Ga0307408_100066848
585 Ga0307408_100122857
586 Ga0307408_100180748
587 Ga0307514_10004259
588 Ga0307405_10018697
589 Ga0307405_10068150
590 Ga0307405_10136885
591 Ga0307518_10102376
592 Ga0307410_10000891
593 Ga0307410_10015110
594 Ga0307410_10031328
595 Ga0307410_10092511
596 Ga0307406_10000812
597 Ga0307406_10001097
598 Ga0307407_10094946
599 Ga0307412_10003144
600 Ga0307412_10007304
601 Ga0307412_10026747
602 Ga0307412_10035454
603 Ga0307409_100018829
604 Ga0307409_100043508
605 Ga0307409_100053151
606 Ga0307409_100090219
607 Ga0307409_100164815
608 Ga0307416_100006299
609 Ga0307416_100012801
610 Ga0307416_100039375
611 Ga0307416_100063876
612 Ga0307416_100252839
613 Ga0307414_10005890
614 Ga0307414_10150589
615 Ga0373961_0012317
616 Ga0395899_0001441
617 Ga0395899_0010773
618 Ga0395899_0050211
619 Ga0395900_0012483
620 Ga0395900_0030808
621 Ga0395900_0268837
622 Ga0395898_0007619
623 Ga0395898_0008489
624 Ga0395898_0020548
625 Ga0395898_0108799
626 Ga0395898_0160607
627 Ga0395898_0261019
628 Ga0395898_0270849
629 Ga0395905_0009139
630 Ga0395905_0029519
631 Ga0395905_0069012
632 Ga0395901_0011818
633 Ga0395901_0014073
634 Ga0395901_0108139
635 Ga0395901_0108168
636 Ga0395901_0115501
637 Ga0395901_0159403
638 Ga0395901_0184384
639 Ga0395901_0206356
640 Ga0439436_0037285
641 Ga0439439_0016108
642 Ga0439447_009447
643 Ga0439466_0002272
644 Ga0439466_0015794
645 Ga0439433_0000043
646 Ga0439433_0000638
647 Ga0439442_001587
648 Ga0439449_0001126
649 Ga0439449_0028894
650 Ga0439452_016768
651 Ga0439457_007610
652 Ga0439457_015833
653 Ga0439462_0005436
654 Ga0439462_0007061
655 Ga0450919_001112
656 Ga0450920_002024
657 Ga0439446_0018679
658 Ga0450908_005776
659 Ga0439434_0012694
660 Ga0450918_001240
661 Ga0466969_0033070
662 Ga0466972_0030313
663 Ga0466965_0000004
664 Ga0466970_0000182
665 Ga0466970_0021191
666 Ga0466960_0052796
667 Ga0466967_0022011
668 Ga0495641_0000001
669 Ga0495653_0009391
670 Ga0495650_0000211
671 Ga0495580_0020572
672 Ga0495580_0020636
673 Ga0495582_0031325
674 Ga0495639_0001140
675 Ga0495662_0004919
676 Ga0495664_0037970
677 Ga0495594_0068275
678 Ga0495644_0000296
679 Ga0495665_0004831
680 Ga0495665_0054617
681 Ga0495640_0076801
682 Ga0495586_0000411
683 Ga0495586_0012810
684 Ga0495587_0001102
685 Ga0495587_0062703
686 Ga0495645_0002611
687 Ga0495667_0016653
688 Ga0495588_0002768
689 Ga0495588_0025735
690 Ga0495657_0017190
691 Ga0495670_0060096
692 Ga0495649_0001084
693 Ga0495600_0000804
694 Ga0495581_0000375
695 Ga0495604_0143163
696 Ga0495636_0092269
697 Ga0495674_0000025
698 Ga0495676_0000091
699 Ga0495676_0007581
700 Ga0495680_0000286
701 Ga0495680_0003949
702 Ga0495677_0066478
703 Ga0495686_0051228
704 Ga0495593_0040796
705 Ga0496100_0006908
706 Ga0496101_0017951
707 Ga0496102_0072883
708 Ga0496103_0004538
709 Ga0496103_0005094
710 Ga0496104_0098129
711 Ga0496104_0142035
712 Ga0496105_0180103
713 Ga0496106_0010066
714 Ga0496107_0072184
715 Ga0496108_0051492
716 Ga0496108_0099346
717 Ga0496109_0138839
718 Ga0496109_0147946
719 Ga0496110_0055979
720 Ga0496110_0213039
721 Ga0496111_0029392
722 Ga0496111_0049343
723 Ga0496112_0044163
724 Ga0496113_0091285
725 Ga0496116_0042200
726 Ga0496117_0000014
727 Ga0496117_0001818
728 Ga0496117_0004343
729 Ga0496117_0019399
730 Ga0496117_0023630
731 Ga0496117_0033239
732 Ga0496117_0052912
733 Ga0496118_0009469
734 Ga0496118_0022936
735 Ga0496118_0031549
736 Ga0496118_0033726
737 Ga0496119_0000256
738 Ga0496119_0000665
739 Ga0496119_0001672
740 Ga0496119_0006877
741 Ga0496120_0001067
742 Ga0496120_0001070
743 Ga0496120_0001926
744 Ga0496120_0006465
745 Ga0496120_0012096
746 Ga0496120_0019196
747 Ga0496120_0059460
748 Ga0496121_0000046
749 Ga0496121_0109827
750 Ga0496122_0000358
751 Ga0496122_0003957
752 Ga0496122_0010482
753 Ga0496122_0041296
754 Ga0496122_0058609
755 Ga0496123_0000011
756 Ga0496123_0000280
757 Ga0496123_0001267
758 Ga0496124_0001222
759 Ga0496124_0001548
760 Ga0496124_0002588
761 Ga0496124_0073182
762 Ga0496125_0012209
763 Ga0496125_0024378
764 Ga0496125_0027000
765 Ga0496125_0028179
766 Ga0496125_0036820
767 Ga0496126_0002989
768 Ga0496126_0011674
769 Ga0496126_0034456
770 Ga0496126_0130877
771 Ga0501321_003818
772 Ga0501032_0000135
773 Ga0501032_0105939
774 Ga0501032_0181130
775 Ga0501034_0000505
776 Ga0501034_0009794
777 Ga0501034_0010404
778 Ga0501034_0010414
779 Ga0501034_0027195
780 Ga0501034_0029700
781 Ga0501034_0045522
782 Ga0501034_0055089
783 Ga0501034_0142349
784 Ga0501036_0140801
785 Ga0501037_0003634
786 Ga0501037_0139547
787 Ga0501038_0015872
788 Ga0501038_0047871
789 Ga0501038_0158361
790 Ga0501043_0013013
791 Ga0501043_0019649
792 Ga0501043_0173079
793 Ga0501043_0193568
794 Ga0501047_0002416
795 Ga0501047_0033854
796 Ga0501047_0044490
797 Ga0501070_0073323
798 Ga0501073_0029244
799 Ga0501080_0001210
800 Ga0501083_0000051
801 Ga0501083_0008723
802 Ga0501083_0135091
803 Ga0501035_0008360
804 Ga0501035_0174729
805 Ga0501044_0052061
806 Ga0501044_0072585
807 Ga0501044_0150368
808 nmdc:mga00v17_15384_c1
809 nmdc:mga00v17_164831_c1
810 nmdc:mga00v17_96911_c1
811 nmdc:mga0yw44_106732_c1
812 nmdc:mga0yw44_22368_c1
813 nmdc:mga06z11_8896_c1
814 nmdc:mga07m45_18422_c1
815 nmdc:mga0sz30_46626_c1
816 Ga0495601_0000344
817 Ga0500635_0002103
818 Ga0500643_000176
819 Ga0500651_0000041
820 Ga0500556_0000008
821 Ga0500556_0000566
822 Ga0500562_002715
823 Ga0500593_010956
824 Ga0500655_002074
825 Ga0500559_0000220
826 Ga0500559_0000592
827 Ga0500559_0003093
828 Ga0500568_0000003
829 Ga0500568_0000383
830 Ga0500568_0001034
831 Ga0500568_0014945
832 Ga0500573_0000005
833 Ga0500573_0035245
834 Ga0500573_0037736
835 Ga0500616_0004309
836 Ga0500620_000041
837 2588107298
838 2643732914
839 2643751709
840 2643784757
841 2643877269
842 2644171704
843 2644181674
844 2644197662
845 2644384324
846 2644681533
847 2691514629
848 2730231063
849 2739602758
850 2747953245
851 2758225606
852 2774379688
853 2774384002
854 2775655033
855 2808630682
856 2808827742
857 2808853096
858 2808878402
859 2808891985
860 2808897079
861 2809227879
862 2810364242
863 2812320495
864 2812323833
865 2817508742
866 2821270973
867 2844849589
868 2852634637
869 2852643889
870 2852647944
871 2852663700
872 2857722222
873 2857726402
874 2857727687
875 2857738974
876 2857741286
877 2870630869
878 2893686517
879 2895661922
880 2897561864
881 2904499761
882 2904512479
883 2904776682
884 2905927779
885 2906802319
886 2908679283
887 2910813244
888 2919036231
889 2919052282
890 2919061656
891 2919069927
892 2919391487
893 2919397352
894 2919542206
895 2920882287
896 2928091664
897 2932400737
898 2932429276
899 2939598712
900 2939676027
901 2945921459
902 2945942356
903 2945959879
904 2945969192
905 2946005394
906 2946026457
907 2946036002
908 2946038301
909 2946041644
910 2946083651
911 2953999576
912 2974295896
913 2974306287
914 2974327841
915 2977238472
916 2977254471
917 2977264700
918 2984543747
919 2984581583
920 8004184093
921 8004213252
922 8016256112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

53

458

0.91

PF00155

Aminotran_1_2

Aminotransferase class I and II

209

458

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfb-assembly1.cif.gz_A-2 glutamate-1-semialdehyde 2,1-aminomutase from thermosynechococcus elongatus 0.9679 37 436
3k28-assembly1.cif.gz_A crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate 0.9668 7 436
2hp1-assembly1.cif.gz_B inter-subunit signaling in gsam 0.9668 7 437
2hoy-assembly1.cif.gz_A inter-subunit signaling in gsam 0.966 7 436
3k28-assembly2.cif.gz_D crystal structure of a glutamate-1-semialdehyde aminotransferase from bacillus anthracis with bound pyridoxal 5'phosphate 0.9645 7 436
ID Description Score Start End Superfamily
2gsaA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9397 73 325 3.40.640.10
3l44A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9389 7 439 3.90.1150.10
2epjA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9375 7 441 3.90.1150.10
af_Q58020_48_419_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9333 51 431 3.40.640.10
af_Q2G283_321_426_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9293 331 435 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A257LEK7-F1-model_v4 Aspartate aminotransferase family protein (EC 5.4.3.8) 0.9898 8 121 GO:0008483
GO:0030170
GO:0042286
AF-K2D2N5-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase 0.9873 7 112 GO:0008483
GO:0030170
AF-A0A2X3HJA9-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) 0.9866 7 144 GO:0008483
GO:0030170
GO:0042286
AF-A0A6G3XL69-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9861 6 100 GO:0008483
GO:0030170
AF-A0A6L3X6E4-F1-model_v4 Glutamate-1-semialdehyde 2,1-aminomutase (Glutamate-1-semialdehyde aminotransferase) 0.9834 7 154 GO:0008483
GO:0030170

Map