F448783

General Info

Members Datasets Scaffolds Average Seq Length
461 193 922 262

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0020691|Ga0439460_0020691_128_1021
Length 297
Sequence MFHSKALIIGVSQQASDACPKEERFIAMTGRRSNRLATVVAIALLATASAHGQQPATQKFEPQVGQAGKDVVWVPTSQALVDKMLDMAKLTPQDYLIDLGSGDGRTVITAAKRGSRALGIEYNPDMVQLSIENAKKEGVSARATFTKADLFESDFSKAQVITMFLLPSINMKLRPKLLEMKPGTRIVSNSFTMEDWEADQSETISGECSNWCTAHLWIVPAKVEGTWQLGQDKLALKQTFQMVSGTLGSNAISDGRLRGDEINFTVGNNKYTGRVNGNTISGNLSGGSNGSFTATRK

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
153 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0
Rhizoplane 1.08
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0020691 3300042461 Bacteria 1790
2 Ga0065714_10101479 3300005288 Bacteria 1642
3 Ga0065712_10009524 3300005290 Bacteria 4476
4 Ga0065712_10242568 3300005290 Bacteria 980
5 Ga0065715_10003358 3300005293 Bacteria 4968
6 Ga0065715_10006822 3300005293 Bacteria 2797
7 Ga0065715_10095403 3300005293 Unclassified 4091
8 Ga0065715_10270341 3300005293 Bacteria 1113
9 Ga0065707_10002559 3300005295 Bacteria 5788
10 Ga0065707_10103697 3300005295 Bacteria 2734
11 Ga0065707_10105607 3300005295 Unclassified 2636
12 Ga0065707_10276953 3300005295 Bacteria 1057
13 Ga0070676_10009365 3300005328 Bacteria 5293
14 Ga0070676_10039245 3300005328 Bacteria 2737
15 Ga0070676_10097368 3300005328 Bacteria 1812
16 Ga0070690_100005849 3300005330 Bacteria 6932
17 Ga0070670_100027396 3300005331 Bacteria 4903
18 Ga0070677_10003315 3300005333 Bacteria 5185
19 Ga0068869_100112911 3300005334 Bacteria 2069
20 Ga0070666_10002727 3300005335 Bacteria 10670
21 Ga0070666_10124979 3300005335 Bacteria 1785
22 Ga0070680_100034865 3300005336 Bacteria 4060
23 Ga0068868_100021615 3300005338 Bacteria 4846
24 Ga0070689_100320430 3300005340 Bacteria 1294
25 Ga0070689_100334268 3300005340 Bacteria 1268
26 Ga0070691_10114756 3300005341 Bacteria 1351
27 Ga0070687_100009142 3300005343 Unclassified 4232
28 Ga0070668_100241246 3300005347 Bacteria 1497
29 Ga0070669_100009094 3300005353 Bacteria 7081
30 Ga0070669_100496193 3300005353 Bacteria 1012
31 Ga0070675_100006897 3300005354 Bacteria 8721
32 Ga0070675_100016190 3300005354 Bacteria 5914
33 Ga0070675_100056286 3300005354 Bacteria 3240
34 Ga0070675_100176083 3300005354 Unclassified 1847
35 Ga0070675_100236538 3300005354 Bacteria 1595
36 Ga0070671_100076944 3300005355 Unclassified 2788
37 Ga0070674_100457837 3300005356 Bacteria 1054
38 Ga0070673_100159853 3300005364 Unclassified 1915
39 Ga0070688_100040257 3300005365 Bacteria 2863
40 Ga0070700_100008340 3300005441 Bacteria 5641
41 Ga0070700_100009889 3300005441 Bacteria 5246
42 Ga0070700_100113978 3300005441 Bacteria 1802
43 Ga0070700_100125345 3300005441 Bacteria 1726
44 Ga0070708_100230659 3300005445 Bacteria 1737
45 Ga0070678_100056033 3300005456 Unclassified 2880
46 Ga0070678_100133894 3300005456 Bacteria 1973
47 Ga0070678_100134023 3300005456 Bacteria 1973
48 Ga0070662_100011627 3300005457 Bacteria 5810
49 Ga0070662_100244905 3300005457 Unclassified 1439
50 Ga0070681_10012176 3300005458 Bacteria 8529
51 Ga0068867_100009084 3300005459 Bacteria 7012
52 Ga0068867_100009900 3300005459 Bacteria 6717
53 Ga0068867_100189934 3300005459 Bacteria 1638
54 Ga0068867_100476283 3300005459 Bacteria 1069
55 Ga0068867_100508207 3300005459 Bacteria 1037
56 Ga0070685_10009632 3300005466 Bacteria 4999
57 Ga0070706_100179946 3300005467 Bacteria 1974
58 Ga0070706_100269301 3300005467 Bacteria 1590
59 Ga0070698_100028320 3300005471 Bacteria 5821
60 Ga0070698_100293732 3300005471 Bacteria 1556
61 Ga0070679_100044553 3300005530 Bacteria 4420
62 Ga0070672_100011415 3300005543 Bacteria 6195
63 Ga0070686_100004112 3300005544 Bacteria 8009
64 Ga0070686_100099313 3300005544 Bacteria 1964
65 Ga0070686_100182077 3300005544 Bacteria 1494
66 Ga0070695_100012653 3300005545 Bacteria 5067
67 Ga0070693_100266148 3300005547 Bacteria 1142
68 Ga0070704_100077299 3300005549 Bacteria 2438
69 Ga0070704_100335026 3300005549 Bacteria 1272
70 Ga0070704_100570857 3300005549 Bacteria 991
71 Ga0070664_100004084 3300005564 Bacteria 11732
72 Ga0070664_100020700 3300005564 Bacteria 5419
73 Ga0068857_100012413 3300005577 Bacteria 7417
74 Ga0068857_100144151 3300005577 Unclassified 2155
75 Ga0068859_100036419 3300005617 Bacteria 4940
76 Ga0068859_100123031 3300005617 Bacteria 2661
77 Ga0068859_100440668 3300005617 Bacteria 1399
78 Ga0068864_100107926 3300005618 Bacteria 2477
79 Ga0068861_100044994 3300005719 Bacteria 3321
80 Ga0068861_100254138 3300005719 Bacteria 1501
81 Ga0068870_10001142 3300005840 Bacteria 10614
82 Ga0068870_10167892 3300005840 Bacteria 1307
83 Ga0068863_100027704 3300005841 Bacteria 5406
84 Ga0068863_100287631 3300005841 Unclassified 1593
85 Ga0068858_100023589 3300005842 Bacteria 5732
86 Ga0068858_100254833 3300005842 Bacteria 1667
87 Ga0068860_100019490 3300005843 Bacteria 6576
88 Ga0068862_100058197 3300005844 Bacteria 3315
89 Ga0068862_100078977 3300005844 Bacteria 2852
90 Ga0068862_100347353 3300005844 Bacteria 1375
91 Ga0068862_100563982 3300005844 Unclassified 1089
92 Ga0068862_100614899 3300005844 Bacteria 1045
93 Ga0068862_100781737 3300005844 Bacteria 931
94 Ga0075368_10034829 3300006042 Bacteria 1963
95 Ga0075364_10066350 3300006051 Bacteria 2371
96 Ga0075364_10069569 3300006051 Bacteria 2316
97 Ga0075364_10089917 3300006051 Bacteria 2036
98 Ga0075367_10014246 3300006178 Unclassified 4299
99 Ga0075367_10102129 3300006178 Bacteria 1754
100 Ga0075366_10006282 3300006195 Bacteria 6499
101 Ga0075366_10042228 3300006195 Bacteria 2700
102 Ga0097621_100118980 3300006237 Bacteria 2239
103 Ga0068871_100030397 3300006358 Unclassified 4252
104 Ga0068871_100234973 3300006358 Bacteria 1592
105 Ga0075428_100003834 3300006844 Bacteria 16508
106 Ga0075428_100008136 3300006844 Bacteria 11641
107 Ga0075428_100023538 3300006844 Bacteria 6818
108 Ga0075428_100044037 3300006844 Bacteria 4906
109 Ga0075428_100079651 3300006844 Bacteria 3575
110 Ga0075428_100097187 3300006844 Bacteria 3211
111 Ga0075428_100148614 3300006844 Bacteria 2546
112 Ga0075428_100591010 3300006844 Bacteria 1186
113 Ga0075430_100000741 3300006846 Bacteria 25064
114 Ga0075430_100000886 3300006846 Bacteria 23510
115 Ga0075430_100020436 3300006846 Bacteria 5632
116 Ga0075430_100297150 3300006846 Bacteria 1336
117 Ga0075431_100002567 3300006847 Bacteria 17534
118 Ga0075431_100006443 3300006847 Bacteria 11655
119 Ga0075431_100006482 3300006847 Bacteria 11619
120 Ga0075431_100006924 3300006847 Bacteria 11272
121 Ga0075431_100009510 3300006847 Bacteria 9761
122 Ga0075431_100010125 3300006847 Bacteria 9474
123 Ga0075431_100024673 3300006847 Bacteria 6165
124 Ga0075431_100089354 3300006847 Bacteria 3180
125 Ga0075431_100143291 3300006847 Bacteria 2463
126 Ga0075431_100238259 3300006847 Bacteria 1852
127 Ga0075433_10001821 3300006852 Bacteria 16028
128 Ga0075433_10005376 3300006852 Bacteria 10061
129 Ga0075433_10011664 3300006852 Bacteria 7078
130 Ga0075433_10013363 3300006852 Bacteria 6672
131 Ga0075433_10050762 3300006852 Bacteria 3611
132 Ga0075433_10131199 3300006852 Bacteria 2226
133 Ga0075434_100000764 3300006871 Bacteria 25371
134 Ga0075434_100001020 3300006871 Bacteria 22799
135 Ga0075434_100001208 3300006871 Bacteria 21457
136 Ga0075434_100238921 3300006871 Bacteria 1837
137 Ga0075434_100258289 3300006871 Bacteria 1761
138 Ga0075429_100001184 3300006880 Bacteria 21085
139 Ga0075429_100002240 3300006880 Bacteria 16177
140 Ga0075429_100010934 3300006880 Bacteria 7852
141 Ga0075429_100079903 3300006880 Unclassified 2850
142 Ga0075429_100100856 3300006880 Bacteria 2520
143 Ga0075429_100247430 3300006880 Bacteria 1561
144 Ga0075429_100732517 3300006880 Bacteria 866
145 Ga0068865_100002939 3300006881 Bacteria 10163
146 Ga0068865_100183067 3300006881 Bacteria 1615
147 Ga0097620_100036418 3300006931 Bacteria 4940
148 Ga0097620_100123029 3300006931 Bacteria 2661
149 Ga0097620_100440616 3300006931 Bacteria 1399
150 Ga0075435_100071415 3300007076 Bacteria 2835
151 Ga0075435_100094634 3300007076 Bacteria 2470
152 Ga0111539_10000206 3300009094 Bacteria 69598
153 Ga0111539_10012516 3300009094 Bacteria 10631
154 Ga0111539_10067061 3300009094 Bacteria 4239
155 Ga0111539_10116828 3300009094 Bacteria 3127
156 Ga0111539_10236993 3300009094 Bacteria 2124
157 Ga0111539_10358718 3300009094 Bacteria 1697
158 Ga0111539_10394353 3300009094 Bacteria 1612
159 Ga0111539_10467397 3300009094 Bacteria 1469
160 Ga0114129_10002777 3300009147 Bacteria 24396
161 Ga0114129_10005257 3300009147 Bacteria 18252
162 Ga0114129_10023757 3300009147 Bacteria 8688
163 Ga0114129_10076828 3300009147 Bacteria 4648
164 Ga0114129_10089091 3300009147 Bacteria 4277
165 Ga0114129_10093215 3300009147 Bacteria 4172
166 Ga0114129_10123559 3300009147 Bacteria 3560
167 Ga0114129_10140264 3300009147 Bacteria 3314
168 Ga0114129_10238514 3300009147 Bacteria 2445
169 Ga0114129_10452115 3300009147 Bacteria 1684
170 Ga0114129_10613281 3300009147 Bacteria 1408
171 Ga0105243_10534507 3300009148 Bacteria 1117
172 Ga0105242_10004902 3300009176 Bacteria 10362
173 Ga0105248_10070160 3300009177 Bacteria 3935
174 Ga0105248_10107794 3300009177 Unclassified 3141
175 Ga0105248_10140715 3300009177 Unclassified 2722
176 Ga0105248_10219031 3300009177 Bacteria 2143
177 Ga0105249_10010440 3300009553 Bacteria 8161
178 Ga0105249_10081640 3300009553 Bacteria 3006
179 Ga0105249_10209533 3300009553 Bacteria 1912
180 Ga0105249_10416070 3300009553 Bacteria 1377
181 Ga0163162_10043807 3300013306 Bacteria 4481
182 Ga0163162_10140780 3300013306 Bacteria 2526
183 Ga0163162_10408398 3300013306 Unclassified 1491
184 Ga0157375_10083914 3300013308 Bacteria 3232
185 Ga0157375_10145778 3300013308 Bacteria 2498
186 Ga0163163_10017634 3300014325 Bacteria 6664
187 Ga0163163_10035915 3300014325 Bacteria 4811
188 Ga0157380_10002849 3300014326 Bacteria 11741
189 Ga0157380_10005757 3300014326 Bacteria 8673
190 Ga0157380_10037606 3300014326 Bacteria 3750
191 Ga0157380_10051448 3300014326 Bacteria 3258
192 Ga0157380_10072438 3300014326 Bacteria 2791
193 Ga0157380_10084909 3300014326 Bacteria 2597
194 Ga0157380_10161674 3300014326 Bacteria 1947
195 Ga0157377_10001090 3300014745 Bacteria 11488
196 Ga0157377_10077994 3300014745 Bacteria 1930
197 Ga0157377_10217832 3300014745 Bacteria 1220
198 Ga0157376_10084142 3300014969 Bacteria 2738
199 Ga0157376_10267540 3300014969 Unclassified 1604
200 Ga0163161_10005848 3300017792 Bacteria 8525
201 Ga0163161_10181831 3300017792 Bacteria 1613
202 Ga0207697_10009740 3300025315 Unclassified 4136
203 Ga0207682_10010800 3300025893 Unclassified 3576
204 Ga0207642_10043450 3300025899 Bacteria 1982
205 Ga0207688_10000307 3300025901 Bacteria 22498
206 Ga0207680_10151198 3300025903 Bacteria 1548
207 Ga0207645_10001355 3300025907 Bacteria 20101
208 Ga0207645_10021016 3300025907 Bacteria 4262
209 Ga0207645_10290713 3300025907 Bacteria 1087
210 Ga0207643_10000850 3300025908 Bacteria 18532
211 Ga0207643_10105431 3300025908 Bacteria 1656
212 Ga0207643_10209897 3300025908 Bacteria 1188
213 Ga0207684_10605146 3300025910 Unclassified 936
214 Ga0207707_10022040 3300025912 Bacteria 5568
215 Ga0207707_10210222 3300025912 Bacteria 1695
216 Ga0207660_10097208 3300025917 Bacteria 2194
217 Ga0207646_10326432 3300025922 Bacteria 1386
218 Ga0207681_10021493 3300025923 Bacteria 4102
219 Ga0207681_10073140 3300025923 Unclassified 2396
220 Ga0207650_10013154 3300025925 Bacteria 5728
221 Ga0207650_10015642 3300025925 Bacteria 5288
222 Ga0207650_10025425 3300025925 Bacteria 4217
223 Ga0207650_10319656 3300025925 Bacteria 1271
224 Ga0207659_10004408 3300025926 Bacteria 8507
225 Ga0207659_10010869 3300025926 Bacteria 5731
226 Ga0207659_10571324 3300025926 Unclassified 962
227 Ga0207644_10056888 3300025931 Unclassified 2823
228 Ga0207644_10062014 3300025931 Bacteria 2710
229 Ga0207690_10229073 3300025932 Bacteria 1425
230 Ga0207706_10004040 3300025933 Bacteria 13882
231 Ga0207706_10523934 3300025933 Bacteria 1022
232 Ga0207686_10010670 3300025934 Bacteria 5004
233 Ga0207709_10041116 3300025935 Bacteria 2773
234 Ga0207670_10008648 3300025936 Bacteria 5759
235 Ga0207670_10269151 3300025936 Bacteria 1324
236 Ga0207669_10132033 3300025937 Bacteria 1718
237 Ga0207704_10006264 3300025938 Bacteria 5534
238 Ga0207704_10038519 3300025938 Bacteria 2773
239 Ga0207704_10207482 3300025938 Bacteria 1439
240 Ga0207691_10008258 3300025940 Bacteria 9997
241 Ga0207691_10015398 3300025940 Bacteria 7276
242 Ga0207691_10130951 3300025940 Bacteria 2216
243 Ga0207711_10013942 3300025941 Bacteria 6674
244 Ga0207711_10394181 3300025941 Unclassified 1286
245 Ga0207689_10000842 3300025942 Bacteria 29533
246 Ga0207689_10006757 3300025942 Bacteria 10106
247 Ga0207689_10308483 3300025942 Bacteria 1312
248 Ga0207679_10022692 3300025945 Unclassified 4278
249 Ga0207679_10051750 3300025945 Bacteria 3008
250 Ga0207651_10052579 3300025960 Bacteria 2778
251 Ga0207651_10088025 3300025960 Unclassified 2262
252 Ga0207712_10013665 3300025961 Bacteria 5206
253 Ga0207712_10176869 3300025961 Bacteria 1673
254 Ga0207668_10302596 3300025972 Bacteria 1320
255 Ga0207658_10017547 3300025986 Bacteria 4934
256 Ga0207703_10035806 3300026035 Bacteria 3946
257 Ga0207708_10004387 3300026075 Bacteria 10397
258 Ga0207708_10010276 3300026075 Bacteria 6949
259 Ga0207708_10035739 3300026075 Bacteria 3781
260 Ga0207708_10056943 3300026075 Bacteria 2982
261 Ga0207708_10171881 3300026075 Bacteria 1717
262 Ga0207708_10225892 3300026075 Bacteria 1502
263 Ga0207708_10537412 3300026075 Bacteria 984
264 Ga0207641_10008789 3300026088 Bacteria 8344
265 Ga0207641_10377505 3300026088 Unclassified 1357
266 Ga0207648_10000566 3300026089 Bacteria 41515
267 Ga0207648_10014246 3300026089 Bacteria 7353
268 Ga0207648_10022444 3300026089 Bacteria 5665
269 Ga0207648_10267377 3300026089 Bacteria 1527
270 Ga0207674_10010176 3300026116 Bacteria 10685
271 Ga0207674_10108572 3300026116 Bacteria 2751
272 Ga0207674_10332328 3300026116 Unclassified 1470
273 Ga0207675_100007332 3300026118 Bacteria 10421
274 Ga0207675_100035040 3300026118 Bacteria 4681
275 Ga0207675_100082855 3300026118 Bacteria 3008
276 Ga0207683_10033871 3300026121 Bacteria 4438
277 Ga0207698_10283998 3300026142 Bacteria 1532
278 Ga0207428_10002465 3300027907 Bacteria 18485
279 Ga0207428_10014088 3300027907 Bacteria 6962
280 Ga0207428_10042332 3300027907 Unclassified 3683
281 Ga0268266_10169273 3300028379 Unclassified 1982
282 Ga0268266_10656357 3300028379 Bacteria 1010
283 Ga0268265_10069454 3300028380 Bacteria 2736
284 Ga0268265_10621557 3300028380 Bacteria 1035
285 Ga0268264_10063989 3300028381 Bacteria 3095
286 Ga0268264_10164944 3300028381 Unclassified 1999
287 Ga0307408_100031817 3300031548 Bacteria 3675
288 Ga0307408_100072294 3300031548 Bacteria 2553
289 Ga0307408_100195516 3300031548 Bacteria 1633
290 Ga0307405_10170917 3300031731 Bacteria 1550
291 Ga0307405_10327940 3300031731 Unclassified 1172
292 Ga0307405_10455928 3300031731 Bacteria 1015
293 Ga0307413_10119203 3300031824 Bacteria 1783
294 Ga0307410_10048435 3300031852 Bacteria 2846
295 Ga0307406_10075710 3300031901 Bacteria 2221
296 Ga0307407_10132484 3300031903 Bacteria 1597
297 Ga0307407_10322154 3300031903 Bacteria 1085
298 Ga0307407_10330246 3300031903 Bacteria 1073
299 Ga0307407_10380217 3300031903 Bacteria 1008
300 Ga0307412_10066264 3300031911 Bacteria 2447
301 Ga0307409_100039098 3300031995 Bacteria 3517
302 Ga0307409_100083299 3300031995 Bacteria 2593
303 Ga0307409_100270537 3300031995 Bacteria 1564
304 Ga0307409_100673448 3300031995 Bacteria 1031
305 Ga0307416_100058933 3300032002 Bacteria 3117
306 Ga0307416_100065913 3300032002 Bacteria 2979
307 Ga0307416_100340378 3300032002 Bacteria 1512
308 Ga0307411_10071339 3300032005 Bacteria 2354
309 Ga0307411_10084493 3300032005 Bacteria 2196
310 Ga0307411_10124897 3300032005 Bacteria 1869
311 Ga0307411_10249931 3300032005 Bacteria 1393
312 Ga0307411_10256677 3300032005 Bacteria 1378
313 Ga0307411_10653257 3300032005 Bacteria 911
314 Ga0307415_100243827 3300032126 Bacteria 1455
315 Ga0373928_0038226 3300035084 Bacteria 1092
316 Ga0373941_0029157 3300035115 Unclassified 1626
317 Ga0373942_0034561 3300035207 Bacteria 1353
318 Ga0373961_0027956 3300035241 Bacteria 1552
319 Ga0373961_0115965 3300035241 Bacteria 882
320 Ga0373962_0026924 3300035242 Unclassified 1552
321 Ga0439439_0044710 3300041406 Bacteria 1153
322 Ga0439453_0033489 3300041408 Bacteria 982
323 Ga0439431_0062589 3300041997 Bacteria 981
324 Ga0450923_003399 3300042125 Bacteria 2399
325 Ga0439435_0002900 3300042436 Bacteria 3483
326 Ga0439460_0135513 3300042461 Bacteria 814
327 Ga0451577_0083396 3300042876 Bacteria 2851
328 Ga0451577_0167036 3300042876 Bacteria 1982
329 Ga0453684_0125845 3300044712 Bacteria 3085
330 Ga0453684_0297301 3300044712 Bacteria 1836
331 Ga0451576_0090030 3300045051 Unclassified 3191
332 Ga0495580_0224340 3300046472 Bacteria 1291
333 Ga0495643_0025839 3300046522 Bacteria 3319
334 Ga0495621_0092157 3300046539 Bacteria 1143
335 Ga0495621_0114435 3300046539 Bacteria 1037
336 Ga0495656_0018828 3300046615 Bacteria 2658
337 Ga0495672_0047828 3300047320 Bacteria 2541
338 Ga0496102_0576611 3300048905 Unclassified 1048
339 Ga0496106_0383169 3300048909 Bacteria 1130
340 Ga0496106_0410906 3300048909 Unclassified 1088
341 Ga0496110_0342264 3300048913 Unclassified 1362
342 Ga0496112_0453377 3300048915 Bacteria 1220
343 Ga0501291_013358 3300049514 Bacteria 1214
344 Ga0501300_015108 3300049523 Bacteria 1128
345 Ga0501031_0213819 3300049568 Bacteria 1256
346 Ga0501036_0170090 3300049572 Bacteria 1836
347 Ga0501036_0423430 3300049572 Bacteria 1110
348 Ga0501039_0057860 3300049575 Bacteria 3002
349 Ga0501039_0352678 3300049575 Bacteria 1156
350 Ga0501041_0110646 3300049577 Bacteria 1704
351 Ga0501046_0037591 3300049580 Bacteria 3890
352 Ga0501048_0012650 3300049582 Bacteria 6277
353 Ga0501048_0056806 3300049582 Bacteria 2777
354 Ga0501048_0182186 3300049582 Unclassified 1489
355 Ga0501067_0272367 3300049583 Bacteria 943
356 Ga0501071_0090217 3300049587 Bacteria 2250
357 Ga0501071_0261182 3300049587 Bacteria 1308
358 Ga0501072_0021512 3300049588 Bacteria 5001
359 Ga0501072_0068116 3300049588 Bacteria 2810
360 Ga0501072_0424817 3300049588 Bacteria 1053
361 Ga0501073_0173960 3300049589 Bacteria 1490
362 Ga0501075_0009308 3300049591 Bacteria 6874
363 Ga0501076_0015880 3300049592 Bacteria 5698
364 Ga0501076_0112810 3300049592 Bacteria 2199
365 Ga0501076_0142033 3300049592 Bacteria 1951
366 Ga0501076_0154692 3300049592 Bacteria 1866
367 Ga0501077_0372238 3300049593 Bacteria 912
368 Ga0501225_0048494 3300049705 Bacteria 1180
369 Ga0501079_0023533 3300049741 Bacteria 4727
370 Ga0501079_0382626 3300049741 Bacteria 1103
371 Ga0501080_0064399 3300049742 Bacteria 3410
372 Ga0501080_0343695 3300049742 Bacteria 1348
373 Ga0501283_016050 3300049779 Bacteria 1158
374 Ga0501035_0215387 3300049822 Bacteria 1642
375 Ga0501045_0038975 3300049824 Bacteria 3457
376 Ga0501045_0253253 3300049824 Bacteria 1310
377 Ga0501045_0256972 3300049824 Bacteria 1300
378 Ga0501045_0357121 3300049824 Bacteria 1087
379 nmdc:mga00v17_28156_c1 3300050491 Bacteria 3289
380 nmdc:mga00v17_83293_c1 3300050491 Bacteria 2000
381 nmdc:mga0k408_10279_c1 3300050493 Bacteria 5058
382 nmdc:mga06z11_13994_c1 3300050494 Bacteria 3539
383 nmdc:mga06z11_217657_c1 3300050494 Bacteria 1115
384 nmdc:mga05p37_11610_c1 3300050507 Bacteria 10497
385 nmdc:mga05p37_1832_c1 3300050507 Bacteria 24795
386 nmdc:mga05p37_210571_c1 3300050507 Bacteria 2350
387 nmdc:mga05p37_40977_c1 3300050507 Bacteria 5687
388 nmdc:mga05p37_43318_c1 3300050507 Bacteria 5537
389 nmdc:mga05p37_5007_c1 3300050507 Bacteria 15532
390 nmdc:mga05p37_576632_c1 3300050507 Bacteria 1275
391 nmdc:mga05p37_653398_c1 3300050507 Unclassified 1177
392 nmdc:mga05p37_77812_c1 3300050507 Bacteria 3645
393 nmdc:mga09592_120917_c1 3300050508 Bacteria 2249
394 nmdc:mga09592_129780_c1 3300050508 Bacteria 2168
395 nmdc:mga09592_146045_c1 3300050508 Bacteria 2040
396 nmdc:mga09592_28003_c1 3300050508 Bacteria 4678
397 nmdc:mga09592_33253_c1 3300050508 Bacteria 4303
398 nmdc:mga09592_6074_c1 3300050508 Bacteria 9843
399 nmdc:mga09592_636118_c1 3300050508 Bacteria 912
400 nmdc:mga0qj67_100811_c1 3300050509 Bacteria 2328
401 nmdc:mga0qj67_11878_c1 3300050509 Bacteria 6540
402 nmdc:mga0qj67_2284_c1 3300050509 Bacteria 13614
403 nmdc:mga0qj67_495157_c1 3300050509 Bacteria 983
404 nmdc:mga0qj67_59767_c1 3300050509 Bacteria 3024
405 nmdc:mga06r32_11150_c1 3300050510 Bacteria 8094
406 nmdc:mga06r32_15008_c1 3300050510 Bacteria 7031
407 nmdc:mga06r32_1655_c1 3300050510 Bacteria 20117
408 nmdc:mga06r32_17539_c1 3300050510 Bacteria 6535
409 nmdc:mga06r32_19394_c1 3300050510 Bacteria 6240
410 nmdc:mga06r32_21509_c1 3300050510 Bacteria 5955
411 nmdc:mga06r32_217170_c1 3300050510 Bacteria 1900
412 nmdc:mga06r32_28440_c1 3300050510 Bacteria 5230
413 nmdc:mga06r32_3023_c1 3300050510 Bacteria 15070
414 nmdc:mga06r32_7391_c1 3300050510 Bacteria 9885
415 nmdc:mga08y16_113844_c1 3300050511 Bacteria 2816
416 nmdc:mga08y16_352042_c1 3300050511 Bacteria 1513
417 nmdc:mga08y16_368423_c1 3300050511 Bacteria 1474
418 nmdc:mga08y16_419308_c1 3300050511 Bacteria 1368
419 nmdc:mga08y16_43164_c1 3300050511 Bacteria 4724
420 nmdc:mga08y16_46586_c1 3300050511 Bacteria 4539
421 nmdc:mga08y16_887_c1 3300050511 Bacteria 28853
422 nmdc:mga08y16_908539_c1 3300050511 Bacteria 866
423 nmdc:mga0n895_16567_c1 3300050512 Bacteria 6768
424 nmdc:mga0n895_41626_c1 3300050512 Bacteria 4467
425 nmdc:mga0n895_48507_c1 3300050512 Bacteria 4157
426 nmdc:mga0n895_74990_c1 3300050512 Unclassified 3362
427 nmdc:mga0n895_8372_c1 3300050512 Bacteria 8952
428 nmdc:mga0rr50_207117_c1 3300050513 Bacteria 1614
429 nmdc:mga0rr50_22417_c2 3300050513 Unclassified 2815
430 nmdc:mga0rr50_8362_c1 3300050513 Bacteria 6439
431 nmdc:mga0a205_1028_c1 3300050515 Bacteria 23210
432 nmdc:mga0a205_152235_c1 3300050515 Bacteria 2212
433 nmdc:mga0a205_162963_c1 3300050515 Bacteria 2125
434 nmdc:mga0a205_1776_c1 3300050515 Bacteria 18639
435 nmdc:mga0a205_331083_c1 3300050515 Unclassified 1392
436 nmdc:mga0a205_365244_c1 3300050515 Unclassified 1310
437 nmdc:mga0a205_4251_c1 3300050515 Bacteria 12851
438 Ga0500641_0098548 3300053096 Bacteria 1252
439 Ga0500555_023157 3300053103 Bacteria 1782
440 Ga0500568_0005485 3300053139 Bacteria 6544
441 Ga0501084_0034390 3300054114 Bacteria 4239
442 Ga0501084_0137242 3300054114 Bacteria 2059
443 Ga0501084_0349193 3300054114 Bacteria 1250
444 Ga0590071_000053 3300059421 Bacteria 30721
445 Ga0590071_001390 3300059421 Bacteria 6410
446 Ga0590071_025347 3300059421 Bacteria 1406
447 Ga0590074_001045 3300059423 Bacteria 4350
448 Ga0590074_008919 3300059423 Bacteria 1669
449 Ga0590075_000420 3300059424 Bacteria 11479
450 Ga0590075_001583 3300059424 Bacteria 5637
451 Ga0590075_004797 3300059424 Unclassified 3197
452 Ga0590077_000124 3300059426 Bacteria 20908
453 Ga0590077_000478 3300059426 Bacteria 11269
454 Ga0501082_0030667 3300060353 Bacteria 4634
455 Ga0501082_0160420 3300060353 Bacteria 1954
456 Ga0501082_0225447 3300060353 Bacteria 1631
457 Ga0501082_0247261 3300060353 Bacteria 1552
458 Ga0501082_0371730 3300060353 Bacteria 1247
459 Ga0530510_0009602 3300061734 Bacteria 6785
460 Ga0530510_0037215 3300061734 Bacteria 3508
461 Ga0530510_0472143 3300061734 Unclassified 950
462 Ga0439460_0020691
463 Ga0065714_10101479
464 Ga0065712_10009524
465 Ga0065712_10242568
466 Ga0065715_10003358
467 Ga0065715_10006822
468 Ga0065715_10095403
469 Ga0065715_10270341
470 Ga0065707_10002559
471 Ga0065707_10103697
472 Ga0065707_10105607
473 Ga0065707_10276953
474 Ga0070676_10009365
475 Ga0070676_10039245
476 Ga0070676_10097368
477 Ga0070690_100005849
478 Ga0070670_100027396
479 Ga0070677_10003315
480 Ga0068869_100112911
481 Ga0070666_10002727
482 Ga0070666_10124979
483 Ga0070680_100034865
484 Ga0068868_100021615
485 Ga0070689_100320430
486 Ga0070689_100334268
487 Ga0070691_10114756
488 Ga0070687_100009142
489 Ga0070668_100241246
490 Ga0070669_100009094
491 Ga0070669_100496193
492 Ga0070675_100006897
493 Ga0070675_100016190
494 Ga0070675_100056286
495 Ga0070675_100176083
496 Ga0070675_100236538
497 Ga0070671_100076944
498 Ga0070674_100457837
499 Ga0070673_100159853
500 Ga0070688_100040257
501 Ga0070700_100008340
502 Ga0070700_100009889
503 Ga0070700_100113978
504 Ga0070700_100125345
505 Ga0070708_100230659
506 Ga0070678_100056033
507 Ga0070678_100133894
508 Ga0070678_100134023
509 Ga0070662_100011627
510 Ga0070662_100244905
511 Ga0070681_10012176
512 Ga0068867_100009084
513 Ga0068867_100009900
514 Ga0068867_100189934
515 Ga0068867_100476283
516 Ga0068867_100508207
517 Ga0070685_10009632
518 Ga0070706_100179946
519 Ga0070706_100269301
520 Ga0070698_100028320
521 Ga0070698_100293732
522 Ga0070679_100044553
523 Ga0070672_100011415
524 Ga0070686_100004112
525 Ga0070686_100099313
526 Ga0070686_100182077
527 Ga0070695_100012653
528 Ga0070693_100266148
529 Ga0070704_100077299
530 Ga0070704_100335026
531 Ga0070704_100570857
532 Ga0070664_100004084
533 Ga0070664_100020700
534 Ga0068857_100012413
535 Ga0068857_100144151
536 Ga0068859_100036419
537 Ga0068859_100123031
538 Ga0068859_100440668
539 Ga0068864_100107926
540 Ga0068861_100044994
541 Ga0068861_100254138
542 Ga0068870_10001142
543 Ga0068870_10167892
544 Ga0068863_100027704
545 Ga0068863_100287631
546 Ga0068858_100023589
547 Ga0068858_100254833
548 Ga0068860_100019490
549 Ga0068862_100058197
550 Ga0068862_100078977
551 Ga0068862_100347353
552 Ga0068862_100563982
553 Ga0068862_100614899
554 Ga0068862_100781737
555 Ga0075368_10034829
556 Ga0075364_10066350
557 Ga0075364_10069569
558 Ga0075364_10089917
559 Ga0075367_10014246
560 Ga0075367_10102129
561 Ga0075366_10006282
562 Ga0075366_10042228
563 Ga0097621_100118980
564 Ga0068871_100030397
565 Ga0068871_100234973
566 Ga0075428_100003834
567 Ga0075428_100008136
568 Ga0075428_100023538
569 Ga0075428_100044037
570 Ga0075428_100079651
571 Ga0075428_100097187
572 Ga0075428_100148614
573 Ga0075428_100591010
574 Ga0075430_100000741
575 Ga0075430_100000886
576 Ga0075430_100020436
577 Ga0075430_100297150
578 Ga0075431_100002567
579 Ga0075431_100006443
580 Ga0075431_100006482
581 Ga0075431_100006924
582 Ga0075431_100009510
583 Ga0075431_100010125
584 Ga0075431_100024673
585 Ga0075431_100089354
586 Ga0075431_100143291
587 Ga0075431_100238259
588 Ga0075433_10001821
589 Ga0075433_10005376
590 Ga0075433_10011664
591 Ga0075433_10013363
592 Ga0075433_10050762
593 Ga0075433_10131199
594 Ga0075434_100000764
595 Ga0075434_100001020
596 Ga0075434_100001208
597 Ga0075434_100238921
598 Ga0075434_100258289
599 Ga0075429_100001184
600 Ga0075429_100002240
601 Ga0075429_100010934
602 Ga0075429_100079903
603 Ga0075429_100100856
604 Ga0075429_100247430
605 Ga0075429_100732517
606 Ga0068865_100002939
607 Ga0068865_100183067
608 Ga0097620_100036418
609 Ga0097620_100123029
610 Ga0097620_100440616
611 Ga0075435_100071415
612 Ga0075435_100094634
613 Ga0111539_10000206
614 Ga0111539_10012516
615 Ga0111539_10067061
616 Ga0111539_10116828
617 Ga0111539_10236993
618 Ga0111539_10358718
619 Ga0111539_10394353
620 Ga0111539_10467397
621 Ga0114129_10002777
622 Ga0114129_10005257
623 Ga0114129_10023757
624 Ga0114129_10076828
625 Ga0114129_10089091
626 Ga0114129_10093215
627 Ga0114129_10123559
628 Ga0114129_10140264
629 Ga0114129_10238514
630 Ga0114129_10452115
631 Ga0114129_10613281
632 Ga0105243_10534507
633 Ga0105242_10004902
634 Ga0105248_10070160
635 Ga0105248_10107794
636 Ga0105248_10140715
637 Ga0105248_10219031
638 Ga0105249_10010440
639 Ga0105249_10081640
640 Ga0105249_10209533
641 Ga0105249_10416070
642 Ga0163162_10043807
643 Ga0163162_10140780
644 Ga0163162_10408398
645 Ga0157375_10083914
646 Ga0157375_10145778
647 Ga0163163_10017634
648 Ga0163163_10035915
649 Ga0157380_10002849
650 Ga0157380_10005757
651 Ga0157380_10037606
652 Ga0157380_10051448
653 Ga0157380_10072438
654 Ga0157380_10084909
655 Ga0157380_10161674
656 Ga0157377_10001090
657 Ga0157377_10077994
658 Ga0157377_10217832
659 Ga0157376_10084142
660 Ga0157376_10267540
661 Ga0163161_10005848
662 Ga0163161_10181831
663 Ga0207697_10009740
664 Ga0207682_10010800
665 Ga0207642_10043450
666 Ga0207688_10000307
667 Ga0207680_10151198
668 Ga0207645_10001355
669 Ga0207645_10021016
670 Ga0207645_10290713
671 Ga0207643_10000850
672 Ga0207643_10105431
673 Ga0207643_10209897
674 Ga0207684_10605146
675 Ga0207707_10022040
676 Ga0207707_10210222
677 Ga0207660_10097208
678 Ga0207646_10326432
679 Ga0207681_10021493
680 Ga0207681_10073140
681 Ga0207650_10013154
682 Ga0207650_10015642
683 Ga0207650_10025425
684 Ga0207650_10319656
685 Ga0207659_10004408
686 Ga0207659_10010869
687 Ga0207659_10571324
688 Ga0207644_10056888
689 Ga0207644_10062014
690 Ga0207690_10229073
691 Ga0207706_10004040
692 Ga0207706_10523934
693 Ga0207686_10010670
694 Ga0207709_10041116
695 Ga0207670_10008648
696 Ga0207670_10269151
697 Ga0207669_10132033
698 Ga0207704_10006264
699 Ga0207704_10038519
700 Ga0207704_10207482
701 Ga0207691_10008258
702 Ga0207691_10015398
703 Ga0207691_10130951
704 Ga0207711_10013942
705 Ga0207711_10394181
706 Ga0207689_10000842
707 Ga0207689_10006757
708 Ga0207689_10308483
709 Ga0207679_10022692
710 Ga0207679_10051750
711 Ga0207651_10052579
712 Ga0207651_10088025
713 Ga0207712_10013665
714 Ga0207712_10176869
715 Ga0207668_10302596
716 Ga0207658_10017547
717 Ga0207703_10035806
718 Ga0207708_10004387
719 Ga0207708_10010276
720 Ga0207708_10035739
721 Ga0207708_10056943
722 Ga0207708_10171881
723 Ga0207708_10225892
724 Ga0207708_10537412
725 Ga0207641_10008789
726 Ga0207641_10377505
727 Ga0207648_10000566
728 Ga0207648_10014246
729 Ga0207648_10022444
730 Ga0207648_10267377
731 Ga0207674_10010176
732 Ga0207674_10108572
733 Ga0207674_10332328
734 Ga0207675_100007332
735 Ga0207675_100035040
736 Ga0207675_100082855
737 Ga0207683_10033871
738 Ga0207698_10283998
739 Ga0207428_10002465
740 Ga0207428_10014088
741 Ga0207428_10042332
742 Ga0268266_10169273
743 Ga0268266_10656357
744 Ga0268265_10069454
745 Ga0268265_10621557
746 Ga0268264_10063989
747 Ga0268264_10164944
748 Ga0307408_100031817
749 Ga0307408_100072294
750 Ga0307408_100195516
751 Ga0307405_10170917
752 Ga0307405_10327940
753 Ga0307405_10455928
754 Ga0307413_10119203
755 Ga0307410_10048435
756 Ga0307406_10075710
757 Ga0307407_10132484
758 Ga0307407_10322154
759 Ga0307407_10330246
760 Ga0307407_10380217
761 Ga0307412_10066264
762 Ga0307409_100039098
763 Ga0307409_100083299
764 Ga0307409_100270537
765 Ga0307409_100673448
766 Ga0307416_100058933
767 Ga0307416_100065913
768 Ga0307416_100340378
769 Ga0307411_10071339
770 Ga0307411_10084493
771 Ga0307411_10124897
772 Ga0307411_10249931
773 Ga0307411_10256677
774 Ga0307411_10653257
775 Ga0307415_100243827
776 Ga0373928_0038226
777 Ga0373941_0029157
778 Ga0373942_0034561
779 Ga0373961_0027956
780 Ga0373961_0115965
781 Ga0373962_0026924
782 Ga0439439_0044710
783 Ga0439453_0033489
784 Ga0439431_0062589
785 Ga0450923_003399
786 Ga0439435_0002900
787 Ga0439460_0135513
788 Ga0451577_0083396
789 Ga0451577_0167036
790 Ga0453684_0125845
791 Ga0453684_0297301
792 Ga0451576_0090030
793 Ga0495580_0224340
794 Ga0495643_0025839
795 Ga0495621_0092157
796 Ga0495621_0114435
797 Ga0495656_0018828
798 Ga0495672_0047828
799 Ga0496102_0576611
800 Ga0496106_0383169
801 Ga0496106_0410906
802 Ga0496110_0342264
803 Ga0496112_0453377
804 Ga0501291_013358
805 Ga0501300_015108
806 Ga0501031_0213819
807 Ga0501036_0170090
808 Ga0501036_0423430
809 Ga0501039_0057860
810 Ga0501039_0352678
811 Ga0501041_0110646
812 Ga0501046_0037591
813 Ga0501048_0012650
814 Ga0501048_0056806
815 Ga0501048_0182186
816 Ga0501067_0272367
817 Ga0501071_0090217
818 Ga0501071_0261182
819 Ga0501072_0021512
820 Ga0501072_0068116
821 Ga0501072_0424817
822 Ga0501073_0173960
823 Ga0501075_0009308
824 Ga0501076_0015880
825 Ga0501076_0112810
826 Ga0501076_0142033
827 Ga0501076_0154692
828 Ga0501077_0372238
829 Ga0501225_0048494
830 Ga0501079_0023533
831 Ga0501079_0382626
832 Ga0501080_0064399
833 Ga0501080_0343695
834 Ga0501283_016050
835 Ga0501035_0215387
836 Ga0501045_0038975
837 Ga0501045_0253253
838 Ga0501045_0256972
839 Ga0501045_0357121
840 nmdc:mga00v17_28156_c1
841 nmdc:mga00v17_83293_c1
842 nmdc:mga0k408_10279_c1
843 nmdc:mga06z11_13994_c1
844 nmdc:mga06z11_217657_c1
845 nmdc:mga05p37_11610_c1
846 nmdc:mga05p37_1832_c1
847 nmdc:mga05p37_210571_c1
848 nmdc:mga05p37_40977_c1
849 nmdc:mga05p37_43318_c1
850 nmdc:mga05p37_5007_c1
851 nmdc:mga05p37_576632_c1
852 nmdc:mga05p37_653398_c1
853 nmdc:mga05p37_77812_c1
854 nmdc:mga09592_120917_c1
855 nmdc:mga09592_129780_c1
856 nmdc:mga09592_146045_c1
857 nmdc:mga09592_28003_c1
858 nmdc:mga09592_33253_c1
859 nmdc:mga09592_6074_c1
860 nmdc:mga09592_636118_c1
861 nmdc:mga0qj67_100811_c1
862 nmdc:mga0qj67_11878_c1
863 nmdc:mga0qj67_2284_c1
864 nmdc:mga0qj67_495157_c1
865 nmdc:mga0qj67_59767_c1
866 nmdc:mga06r32_11150_c1
867 nmdc:mga06r32_15008_c1
868 nmdc:mga06r32_1655_c1
869 nmdc:mga06r32_17539_c1
870 nmdc:mga06r32_19394_c1
871 nmdc:mga06r32_21509_c1
872 nmdc:mga06r32_217170_c1
873 nmdc:mga06r32_28440_c1
874 nmdc:mga06r32_3023_c1
875 nmdc:mga06r32_7391_c1
876 nmdc:mga08y16_113844_c1
877 nmdc:mga08y16_352042_c1
878 nmdc:mga08y16_368423_c1
879 nmdc:mga08y16_419308_c1
880 nmdc:mga08y16_43164_c1
881 nmdc:mga08y16_46586_c1
882 nmdc:mga08y16_887_c1
883 nmdc:mga08y16_908539_c1
884 nmdc:mga0n895_16567_c1
885 nmdc:mga0n895_41626_c1
886 nmdc:mga0n895_48507_c1
887 nmdc:mga0n895_74990_c1
888 nmdc:mga0n895_8372_c1
889 nmdc:mga0rr50_207117_c1
890 nmdc:mga0rr50_22417_c2
891 nmdc:mga0rr50_8362_c1
892 nmdc:mga0a205_1028_c1
893 nmdc:mga0a205_152235_c1
894 nmdc:mga0a205_162963_c1
895 nmdc:mga0a205_1776_c1
896 nmdc:mga0a205_331083_c1
897 nmdc:mga0a205_365244_c1
898 nmdc:mga0a205_4251_c1
899 Ga0500641_0098548
900 Ga0500555_023157
901 Ga0500568_0005485
902 Ga0501084_0034390
903 Ga0501084_0137242
904 Ga0501084_0349193
905 Ga0590071_000053
906 Ga0590071_001390
907 Ga0590071_025347
908 Ga0590074_001045
909 Ga0590074_008919
910 Ga0590075_000420
911 Ga0590075_001583
912 Ga0590075_004797
913 Ga0590077_000124
914 Ga0590077_000478
915 Ga0501082_0030667
916 Ga0501082_0160420
917 Ga0501082_0225447
918 Ga0501082_0247261
919 Ga0501082_0371730
920 Ga0530510_0009602
921 Ga0530510_0037215
922 Ga0530510_0472143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

97

167

0.91

PF09445

Methyltransf_15

RNA cap guanine-N2 methyltransferase

93

188

0.89

PF13649

Methyltransf_25

Methyltransferase domain

96

180

0.85

PF08123

DOT1

Histone methylation protein DOT1

63

209

0.71

PF13847

Methyltransf_31

Methyltransferase domain

90

242

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bxy-assembly2.cif.gz_B crystal structure of rna methyltransferase from salinibacter ruber in complex with s-adenosyl-l-homocysteine 0.9499 46 195
5bxy-assembly2.cif.gz_B crystal structure of rna methyltransferase from salinibacter ruber in complex with s-adenosyl-l-homocysteine 0.9077 46 195
5fa8-assembly1.cif.gz_A sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu 0.9047 34 191
5fa8-assembly1.cif.gz_A sam complex with akmt from the hyperthermophilic archaeon sulfolobus islandicu 0.8823 34 191
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8703 53 135
ID Description Score Start End Superfamily
5bxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.949 46 195 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9352 51 121 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9254 51 135 3.40.50.150
af_Q9D1Z3_62_211_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9238 43 189 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9222 62 121 3.40.50.150
ID Description Score Start End GO Terms
AF-K1XB30-F1-model_v4 RNA methylase family UPF0020 family protein 0.9929 57 174 GO:0016279
GO:0032259
AF-K1XB30-F1-model_v4 RNA methylase family UPF0020 family protein 0.9764 57 174 GO:0016279
GO:0032259
AF-A0A834AYP7-F1-model_v4 ATP synthase c subunit lysine N-methyltransferase 0.9679 65 172 GO:0005739
GO:0016279
GO:0032259
GO:1905706
AF-A0A7Y4WHA3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9638 57 191 GO:0016279
GO:0032259
AF-A0A2P6BZQ2-F1-model_v4 deleted 0.9623 45 195

Map