F448784

General Info

Members Datasets Scaffolds Average Seq Length
461 243 922 68

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_1019471|Ga0451577_1019471_480_722
Length 80
Sequence MVGRSSGGIIARMQTIELKVEGMDCQGCVKSVTRMLSGVPGVDKVDVSLEQALARVTYDPAKSGPAQFKRAIERAGYKAP

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
159 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
185 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
186 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
217 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
225 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 99.13
Stem 0
Stem Tuber 0
Unclassified 4.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_1019471 3300042876 Bacteria 743
2 JGI25406J46586_10054151 3300003203 Bacteria 1328
3 Ga0065707_10117069 3300005295 Bacteria 2221
4 Ga0070690_100300168 3300005330 Bacteria 1152
5 Ga0070670_100398279 3300005331 Bacteria 1215
6 Ga0068869_100175504 3300005334 Bacteria 1677
7 Ga0070680_100008758 3300005336 Bacteria 7760
8 Ga0070680_100422743 3300005336 Bacteria 1137
9 Ga0070680_101009610 3300005336 Bacteria 719
10 Ga0070680_101902033 3300005336 Bacteria 516
11 Ga0068868_101234789 3300005338 Bacteria 692
12 Ga0070691_10236802 3300005341 Bacteria 974
13 Ga0070692_10003445 3300005345 Bacteria 6419
14 Ga0070692_10024998 3300005345 Bacteria 2941
15 Ga0070668_100023286 3300005347 Bacteria 4684
16 Ga0070669_100000467 3300005353 Bacteria 30644
17 Ga0070669_100754518 3300005353 Bacteria 825
18 Ga0070669_101048764 3300005353 Bacteria 701
19 Ga0070675_100942050 3300005354 Bacteria 792
20 Ga0070671_100923099 3300005355 Bacteria 763
21 Ga0070671_101416915 3300005355 Bacteria 614
22 Ga0070674_100113483 3300005356 Bacteria 1994
23 Ga0070673_100232474 3300005364 Bacteria 1600
24 Ga0070673_102040066 3300005364 Bacteria 545
25 Ga0070688_100836472 3300005365 Bacteria 722
26 Ga0070688_101234058 3300005365 Bacteria 602
27 Ga0070703_10116577 3300005406 Bacteria 963
28 Ga0070709_11667240 3300005434 Bacteria 520
29 Ga0070714_100188959 3300005435 Bacteria 1878
30 Ga0070710_10194573 3300005437 Bacteria 1277
31 Ga0070701_10106343 3300005438 Bacteria 1562
32 Ga0070701_10467503 3300005438 Bacteria 813
33 Ga0070701_10938975 3300005438 Bacteria 600
34 Ga0070711_100807428 3300005439 Bacteria 796
35 Ga0070705_100004773 3300005440 Bacteria 6598
36 Ga0070705_100039818 3300005440 Bacteria 2669
37 Ga0070700_100050041 3300005441 Bacteria 2596
38 Ga0070700_100156791 3300005441 Bacteria 1563
39 Ga0070694_100055822 3300005444 Bacteria 2680
40 Ga0070694_100059887 3300005444 Bacteria 2595
41 Ga0070662_100265113 3300005457 Bacteria 1385
42 Ga0070681_11240910 3300005458 Bacteria 668
43 Ga0068867_100001691 3300005459 Bacteria 15389
44 Ga0068867_100830000 3300005459 Bacteria 827
45 Ga0068867_101347984 3300005459 Unclassified 660
46 Ga0070706_100250744 3300005467 Bacteria 1653
47 Ga0070707_100630069 3300005468 Bacteria 1035
48 Ga0070707_101292006 3300005468 Bacteria 696
49 Ga0070699_100055844 3300005518 Bacteria 3419
50 Ga0070679_101230537 3300005530 Bacteria 694
51 Ga0070684_100305544 3300005535 Bacteria 1460
52 Ga0070697_100164693 3300005536 Bacteria 1874
53 Ga0070672_100063363 3300005543 Bacteria 2920
54 Ga0070672_101985611 3300005543 Bacteria 524
55 Ga0070686_100621338 3300005544 Bacteria 854
56 Ga0070686_101394594 3300005544 Bacteria 588
57 Ga0070695_100033229 3300005545 Bacteria 3227
58 Ga0070695_100531691 3300005545 Bacteria 914
59 Ga0070696_100010529 3300005546 Bacteria 6197
60 Ga0070696_100019424 3300005546 Bacteria 4601
61 Ga0070696_100164022 3300005546 Bacteria 1639
62 Ga0070693_100306273 3300005547 Bacteria 1073
63 Ga0070693_101023955 3300005547 Bacteria 626
64 Ga0070704_100005221 3300005549 Bacteria 7558
65 Ga0070704_100417137 3300005549 Bacteria 1149
66 Ga0070704_100800509 3300005549 Bacteria 842
67 Ga0070704_101051418 3300005549 Bacteria 738
68 Ga0070704_102289045 3300005549 Bacteria 503
69 Ga0068857_100206621 3300005577 Bacteria 1791
70 Ga0068854_101405474 3300005578 Bacteria 631
71 Ga0070702_100106333 3300005615 Bacteria 1731
72 Ga0070702_101455040 3300005615 Unclassified 562
73 Ga0068859_101832245 3300005617 Bacteria 670
74 Ga0068861_100004621 3300005719 Bacteria 9241
75 Ga0068861_100531071 3300005719 Bacteria 1069
76 Ga0068861_102032032 3300005719 Unclassified 574
77 Ga0068870_10075533 3300005840 Bacteria 1848
78 Ga0068858_100701048 3300005842 Bacteria 985
79 Ga0068858_101098420 3300005842 Bacteria 781
80 Ga0068862_100003507 3300005844 Bacteria 13472
81 Ga0068862_100251222 3300005844 Bacteria 1612
82 Ga0068862_101736789 3300005844 Bacteria 633
83 Ga0081538_10171087 3300005981 Bacteria 948
84 Ga0081539_10000308 3300005985 Bacteria 109598
85 Ga0070712_101922996 3300006175 Bacteria 518
86 Ga0097621_100023431 3300006237 Bacteria 4808
87 Ga0068871_100007009 3300006358 Bacteria 8032
88 Ga0068871_102071724 3300006358 Bacteria 542
89 Ga0075428_100044560 3300006844 Bacteria 4875
90 Ga0075428_100100908 3300006844 Bacteria 3146
91 Ga0075428_102234742 3300006844 Bacteria 564
92 Ga0075428_102322646 3300006844 Bacteria 552
93 Ga0075430_100022058 3300006846 Bacteria 5412
94 Ga0075430_100442467 3300006846 Bacteria 1073
95 Ga0075430_100467091 3300006846 Bacteria 1041
96 Ga0075431_100086086 3300006847 Bacteria 3243
97 Ga0075431_100215757 3300006847 Bacteria 1958
98 Ga0075431_100854079 3300006847 Bacteria 881
99 Ga0075431_101394328 3300006847 Bacteria 660
100 Ga0075433_10110134 3300006852 Bacteria 2443
101 Ga0075429_101543606 3300006880 Bacteria 577
102 Ga0075436_100000267 3300006914 Bacteria 32669
103 Ga0075436_100007473 3300006914 Bacteria 7473
104 Ga0075436_100037978 3300006914 Bacteria 3324
105 Ga0075436_100600702 3300006914 Bacteria 811
106 Ga0097620_101832598 3300006931 Bacteria 670
107 Ga0075435_100071178 3300007076 Bacteria 2839
108 Ga0075435_100135625 3300007076 Bacteria 2062
109 Ga0111539_10012064 3300009094 Bacteria 10841
110 Ga0111539_10072086 3300009094 Bacteria 4074
111 Ga0111539_10120281 3300009094 Bacteria 3077
112 Ga0111539_12519346 3300009094 Bacteria 597
113 Ga0114129_10129751 3300009147 Bacteria 3464
114 Ga0114129_10246420 3300009147 Bacteria 2400
115 Ga0114129_10451856 3300009147 Bacteria 1685
116 Ga0114129_10891821 3300009147 Bacteria 1127
117 Ga0114129_11166209 3300009147 Bacteria 961
118 Ga0114129_11446304 3300009147 Bacteria 846
119 Ga0114129_11695309 3300009147 Bacteria 771
120 Ga0114129_12665199 3300009147 Bacteria 596
121 Ga0105243_10015030 3300009148 Bacteria 5859
122 Ga0105243_11024558 3300009148 Bacteria 829
123 Ga0105242_12360224 3300009176 Bacteria 579
124 Ga0105246_10878497 3300011119 Bacteria 802
125 Ga0157378_13302743 3300013297 Bacteria 501
126 Ga0157375_10724474 3300013308 Bacteria 1147
127 Ga0157380_10004024 3300014326 Bacteria 10150
128 Ga0157377_11412454 3300014745 Bacteria 549
129 Ga0157376_10029558 3300014969 Bacteria 4365
130 Ga0207642_11127985 3300025899 Bacteria 507
131 Ga0207645_10024689 3300025907 Bacteria 3893
132 Ga0207645_10289251 3300025907 Bacteria 1089
133 Ga0207643_10044372 3300025908 Bacteria 2510
134 Ga0207643_10302080 3300025908 Bacteria 996
135 Ga0207684_10137251 3300025910 Bacteria 2101
136 Ga0207663_11448284 3300025916 Bacteria 553
137 Ga0207660_10135341 3300025917 Bacteria 1879
138 Ga0207660_10228067 3300025917 Bacteria 1464
139 Ga0207662_10040537 3300025918 Bacteria 2738
140 Ga0207652_10429247 3300025921 Bacteria 1192
141 Ga0207646_11428318 3300025922 Bacteria 601
142 Ga0207681_10013063 3300025923 Bacteria 5134
143 Ga0207681_10301611 3300025923 Bacteria 1268
144 Ga0207650_10648251 3300025925 Bacteria 890
145 Ga0207659_10750430 3300025926 Bacteria 837
146 Ga0207664_10230970 3300025929 Bacteria 1608
147 Ga0207644_10803393 3300025931 Bacteria 787
148 Ga0207644_10933223 3300025931 Bacteria 728
149 Ga0207706_10156613 3300025933 Bacteria 2003
150 Ga0207686_10723307 3300025934 Bacteria 793
151 Ga0207709_10001903 3300025935 Bacteria 13763
152 Ga0207669_10160540 3300025937 Bacteria 1587
153 Ga0207704_10000792 3300025938 Bacteria 13979
154 Ga0207704_11347403 3300025938 Bacteria 611
155 Ga0207665_10934693 3300025939 Unclassified 689
156 Ga0207665_11637486 3300025939 Bacteria 510
157 Ga0207691_10072785 3300025940 Bacteria 3100
158 Ga0207691_10578378 3300025940 Bacteria 951
159 Ga0207689_10102148 3300025942 Bacteria 2355
160 Ga0207651_10050987 3300025960 Bacteria 2814
161 Ga0207712_10004418 3300025961 Bacteria 8885
162 Ga0207668_10011137 3300025972 Bacteria 5458
163 Ga0207640_11574581 3300025981 Bacteria 592
164 Ga0207677_12124036 3300026023 Bacteria 522
165 Ga0207703_10177118 3300026035 Bacteria 1879
166 Ga0207708_10000647 3300026075 Bacteria 26752
167 Ga0207708_10119715 3300026075 Bacteria 2051
168 Ga0207708_10996584 3300026075 Bacteria 728
169 Ga0207648_10001065 3300026089 Bacteria 30735
170 Ga0207648_10211566 3300026089 Bacteria 1721
171 Ga0207648_11140050 3300026089 Bacteria 732
172 Ga0207674_10311681 3300026116 Bacteria 1523
173 Ga0207675_100004290 3300026118 Bacteria 13785
174 Ga0207675_100339387 3300026118 Bacteria 1470
175 Ga0207675_100789043 3300026118 Bacteria 963
176 Ga0207683_10778630 3300026121 Bacteria 888
177 Ga0209969_1016244 3300027360 Bacteria 1091
178 Ga0209967_1008885 3300027364 Bacteria 1388
179 Ga0209967_1019891 3300027364 Bacteria 977
180 Ga0209981_1015843 3300027378 Bacteria 1057
181 Ga0209981_1041615 3300027378 Bacteria 687
182 Ga0209996_1024961 3300027395 Bacteria 854
183 Ga0210000_1006854 3300027462 Bacteria 1662
184 Ga0210000_1007261 3300027462 Bacteria 1620
185 Ga0210000_1013174 3300027462 Bacteria 1233
186 Ga0209995_1081607 3300027471 Bacteria 555
187 Ga0209968_1004774 3300027526 Bacteria 2030
188 Ga0209968_1037447 3300027526 Bacteria 823
189 Ga0209968_1040596 3300027526 Unclassified 795
190 Ga0209999_1000286 3300027543 Bacteria 7447
191 Ga0209970_1060076 3300027614 Bacteria 697
192 Ga0209971_1025360 3300027682 Bacteria 1416
193 Ga0209971_1080721 3300027682 Bacteria 792
194 Ga0209966_1122686 3300027695 Bacteria 597
195 Ga0209974_10134308 3300027876 Unclassified 884
196 Ga0209974_10224965 3300027876 Bacteria 700
197 Ga0207428_10142924 3300027907 Bacteria 1825
198 Ga0207428_10249264 3300027907 Bacteria 1325
199 Ga0268265_10001976 3300028380 Bacteria 16224
200 Ga0268265_12384991 3300028380 Bacteria 535
201 Ga0307408_100222599 3300031548 Bacteria 1541
202 Ga0307408_100374860 3300031548 Bacteria 1215
203 Ga0307408_100421441 3300031548 Bacteria 1151
204 Ga0307408_101392274 3300031548 Bacteria 660
205 Ga0316575_10006424 3300031665 Bacteria 4226
206 Ga0307405_10886344 3300031731 Bacteria 754
207 Ga0307405_10902065 3300031731 Bacteria 748
208 Ga0307405_11403022 3300031731 Bacteria 611
209 Ga0307413_12193518 3300031824 Bacteria 501
210 Ga0307410_10540140 3300031852 Unclassified 965
211 Ga0307410_10566007 3300031852 Bacteria 944
212 Ga0307410_10869753 3300031852 Unclassified 771
213 Ga0307407_10679167 3300031903 Bacteria 774
214 Ga0307407_10988837 3300031903 Bacteria 650
215 Ga0307407_11236044 3300031903 Bacteria 584
216 Ga0307412_10131450 3300031911 Bacteria 1819
217 Ga0307412_10596227 3300031911 Bacteria 935
218 Ga0307412_10980146 3300031911 Bacteria 746
219 Ga0307409_100364764 3300031995 Bacteria 1368
220 Ga0307416_100030684 3300032002 Bacteria 4036
221 Ga0307416_100081683 3300032002 Bacteria 2734
222 Ga0307416_100138597 3300032002 Unclassified 2206
223 Ga0307416_100395761 3300032002 Bacteria 1417
224 Ga0307416_100630412 3300032002 Bacteria 1155
225 Ga0307416_101421351 3300032002 Bacteria 799
226 Ga0307411_10996289 3300032005 Bacteria 750
227 Ga0307411_11001207 3300032005 Bacteria 748
228 Ga0307411_11508004 3300032005 Bacteria 618
229 Ga0307411_12224680 3300032005 Bacteria 514
230 Ga0307415_100836582 3300032126 Bacteria 843
231 Ga0307415_102594994 3300032126 Bacteria 500
232 Ga0373948_0079464 3300034817 Unclassified 746
233 Ga0373938_0066771 3300034957 Bacteria 852
234 Ga0373923_0219262 3300035111 Bacteria 884
235 Ga0373936_0158571 3300035113 Bacteria 985
236 Ga0373941_0327561 3300035115 Bacteria 618
237 Ga0373953_0003931 3300035117 Bacteria 4685
238 Ga0373956_0027509 3300035119 Bacteria 2469
239 Ga0373957_0288653 3300035120 Bacteria 694
240 Ga0373960_0048394 3300035121 Bacteria 1254
241 Ga0373955_0016147 3300035172 Bacteria 3670
242 Ga0373942_0220176 3300035207 Bacteria 636
243 Ga0373962_0085270 3300035242 Bacteria 965
244 Ga0316574_0071620 3300035398 Bacteria 2189
245 Ga0373924_0029200 3300035410 Bacteria 2203
246 Ga0373931_0185718 3300035691 Bacteria 1234
247 Ga0373931_1148061 3300035691 Bacteria 530
248 Ga0373927_0539839 3300035695 Bacteria 771
249 Ga0373933_0006179 3300035724 Bacteria 6520
250 Ga0373937_0007981 3300036401 Bacteria 9176
251 Ga0439461_0002149 3300041410 Bacteria 3121
252 Ga0439466_0198068 3300041411 Bacteria 611
253 Ga0451800_0254829 3300041459 Bacteria 592
254 Ga0451804_0759087 3300041463 Bacteria 758
255 Ga0451807_0472921 3300041486 Bacteria 1433
256 Ga0451849_1270827 3300041505 Bacteria 1511
257 Ga0439441_008621 3300042001 Bacteria 1670
258 Ga0439441_147671 3300042001 Unclassified 552
259 Ga0439443_060650 3300042003 Unclassified 677
260 Ga0439445_0255804 3300042004 Bacteria 523
261 Ga0439456_093810 3300042013 Bacteria 676
262 Ga0439463_103751 3300042016 Unclassified 734
263 Ga0450923_137499 3300042125 Bacteria 585
264 Ga0450894_047304 3300042131 Bacteria 628
265 Ga0439446_0002540 3300042156 Bacteria 4390
266 Ga0439434_0001248 3300042435 Bacteria 7315
267 Ga0439435_0000135 3300042436 Bacteria 9839
268 Ga0439435_0000260 3300042436 Bacteria 7716
269 Ga0439435_0091934 3300042436 Unclassified 922
270 Ga0439444_0003169 3300042437 Bacteria 2308
271 Ga0439444_0089933 3300042437 Bacteria 683
272 Ga0439460_0004028 3300042461 Bacteria 3571
273 Ga0439460_0004653 3300042461 Bacteria 3349
274 Ga0466963_0405727 3300044694 Bacteria 961
275 Ga0466968_0572495 3300044735 Unclassified 568
276 Ga0466957_0755790 3300044842 Bacteria 689
277 Ga0466960_0065825 3300044901 Bacteria 1791
278 Ga0466960_0387184 3300044901 Bacteria 803
279 Ga0451576_0050160 3300045051 Bacteria 4378
280 Ga0466967_0052902 3300045976 Bacteria 3567
281 Ga0495662_0350472 3300046476 Bacteria 726
282 Ga0495664_0586858 3300046477 Bacteria 663
283 Ga0495584_0088164 3300046491 Bacteria 1564
284 Ga0495652_0280673 3300046529 Bacteria 1220
285 Ga0495598_0075412 3300046537 Bacteria 1071
286 Ga0495598_0186948 3300046537 Bacteria 742
287 Ga0495598_0304106 3300046537 Unclassified 604
288 Ga0495598_0388971 3300046537 Unclassified 543
289 Ga0495598_0427336 3300046537 Bacteria 521
290 Ga0495621_0509328 3300046539 Bacteria 520
291 Ga0495667_0299443 3300046559 Bacteria 1019
292 Ga0495659_0542591 3300046664 Bacteria 512
293 Ga0495669_0056645 3300046684 Bacteria 1767
294 Ga0495680_0339467 3300047322 Bacteria 1048
295 Ga0495675_0746645 3300047444 Bacteria 545
296 Ga0501291_118590 3300049514 Bacteria 571
297 Ga0501292_048052 3300049515 Bacteria 751
298 Ga0501292_142013 3300049515 Bacteria 503
299 Ga0501293_025183 3300049516 Bacteria 607
300 Ga0501298_051154 3300049521 Bacteria 858
301 Ga0501298_118526 3300049521 Bacteria 621
302 Ga0501298_140924 3300049521 Bacteria 583
303 Ga0501298_160138 3300049521 Bacteria 555
304 Ga0501031_0059653 3300049568 Bacteria 2486
305 Ga0501031_0490430 3300049568 Bacteria 793
306 Ga0501032_0858996 3300049569 Bacteria 572
307 Ga0501033_0004615 3300049570 Bacteria 11032
308 Ga0501033_0661534 3300049570 Bacteria 713
309 Ga0501034_0271198 3300049571 Unclassified 1638
310 Ga0501036_0000578 3300049572 Bacteria 26441
311 Ga0501036_0166286 3300049572 Bacteria 1859
312 Ga0501036_0184202 3300049572 Bacteria 1757
313 Ga0501036_1365359 3300049572 Bacteria 575
314 Ga0501037_0004062 3300049573 Bacteria 10613
315 Ga0501037_0109111 3300049573 Bacteria 1994
316 Ga0501037_0663776 3300049573 Bacteria 696
317 Ga0501038_0000612 3300049574 Bacteria 31789
318 Ga0501038_0125802 3300049574 Bacteria 2110
319 Ga0501038_0850393 3300049574 Bacteria 676
320 Ga0501039_0000577 3300049575 Bacteria 26507
321 Ga0501039_0055761 3300049575 Bacteria 3061
322 Ga0501039_0081664 3300049575 Bacteria 2516
323 Ga0501039_1104771 3300049575 Bacteria 614
324 Ga0501040_0000523 3300049576 Bacteria 23063
325 Ga0501040_0001442 3300049576 Bacteria 15069
326 Ga0501040_0004203 3300049576 Bacteria 9373
327 Ga0501040_0205865 3300049576 Bacteria 1398
328 Ga0501040_0256809 3300049576 Bacteria 1247
329 Ga0501040_0676969 3300049576 Unclassified 746
330 Ga0501040_1051566 3300049576 Bacteria 590
331 Ga0501041_0000488 3300049577 Bacteria 20258
332 Ga0501041_0008774 3300049577 Bacteria 5949
333 Ga0501041_0009696 3300049577 Bacteria 5675
334 Ga0501041_0043467 3300049577 Bacteria 2731
335 Ga0501042_0019568 3300049578 Bacteria 4703
336 Ga0501042_0178452 3300049578 Bacteria 1532
337 Ga0501042_0215563 3300049578 Bacteria 1385
338 Ga0501042_0591158 3300049578 Bacteria 807
339 Ga0501042_0936462 3300049578 Unclassified 631
340 Ga0501043_0131050 3300049579 Bacteria 1965
341 Ga0501043_0307516 3300049579 Bacteria 1210
342 Ga0501046_0000987 3300049580 Bacteria 27829
343 Ga0501046_0043598 3300049580 Bacteria 3571
344 Ga0501046_0224385 3300049580 Bacteria 1390
345 Ga0501048_0001320 3300049582 Bacteria 18785
346 Ga0501048_0084433 3300049582 Bacteria 2239
347 Ga0501048_0248177 3300049582 Bacteria 1263
348 Ga0501048_0716865 3300049582 Bacteria 718
349 Ga0501067_0478073 3300049583 Bacteria 696
350 Ga0501067_0660786 3300049583 Bacteria 587
351 Ga0501068_0010621 3300049584 Bacteria 5180
352 Ga0501068_0628570 3300049584 Bacteria 700
353 Ga0501069_0255894 3300049585 Bacteria 1022
354 Ga0501070_0143329 3300049586 Bacteria 1972
355 Ga0501071_0005706 3300049587 Bacteria 8026
356 Ga0501071_0173998 3300049587 Bacteria 1612
357 Ga0501071_1253620 3300049587 Bacteria 573
358 Ga0501071_1466607 3300049587 Bacteria 527
359 Ga0501072_0002390 3300049588 Bacteria 14071
360 Ga0501072_0003229 3300049588 Bacteria 12234
361 Ga0501072_0154583 3300049588 Bacteria 1829
362 Ga0501072_0186518 3300049588 Bacteria 1654
363 Ga0501072_1105307 3300049588 Bacteria 617
364 Ga0501073_0166383 3300049589 Bacteria 1527
365 Ga0501074_0284541 3300049590 Bacteria 1175
366 Ga0501074_1177912 3300049590 Bacteria 538
367 Ga0501075_0000175 3300049591 Bacteria 33306
368 Ga0501075_0011507 3300049591 Bacteria 6263
369 Ga0501075_0082870 3300049591 Bacteria 2429
370 Ga0501075_0424036 3300049591 Bacteria 1014
371 Ga0501075_0914308 3300049591 Bacteria 667
372 Ga0501076_0000588 3300049592 Bacteria 23245
373 Ga0501076_0001233 3300049592 Bacteria 17022
374 Ga0501076_0647068 3300049592 Bacteria 872
375 Ga0501076_1577791 3300049592 Bacteria 539
376 Ga0501076_1583598 3300049592 Bacteria 538
377 Ga0501077_0002511 3300049593 Bacteria 10984
378 Ga0501077_0236977 3300049593 Bacteria 1160
379 Ga0501077_0315858 3300049593 Bacteria 996
380 Ga0501077_0557764 3300049593 Bacteria 735
381 Ga0501217_175796 3300049661 Bacteria 654
382 Ga0501227_178788 3300049665 Bacteria 596
383 Ga0501235_075307 3300049669 Bacteria 802
384 Ga0501249_074485 3300049679 Bacteria 795
385 Ga0501249_151639 3300049679 Bacteria 584
386 Ga0501250_108218 3300049680 Bacteria 502
387 Ga0501221_139534 3300049704 Bacteria 634
388 Ga0501225_0353484 3300049705 Bacteria 509
389 Ga0501079_0000215 3300049741 Bacteria 34021
390 Ga0501079_0362381 3300049741 Bacteria 1136
391 Ga0501079_1048950 3300049741 Bacteria 642
392 Ga0501080_0092284 3300049742 Bacteria 2812
393 Ga0501080_0115297 3300049742 Bacteria 2491
394 Ga0501080_0418959 3300049742 Bacteria 1203
395 Ga0501080_1405439 3300049742 Bacteria 595
396 Ga0501081_0000103 3300049743 Bacteria 35665
397 Ga0501081_0041687 3300049743 Bacteria 3144
398 Ga0501081_0219847 3300049743 Bacteria 1381
399 Ga0501081_0998670 3300049743 Bacteria 632
400 Ga0501083_0143993 3300049744 Bacteria 1560
401 Ga0501278_011598 3300049774 Bacteria 718
402 Ga0501279_082072 3300049775 Bacteria 558
403 Ga0501283_092282 3300049779 Bacteria 581
404 Ga0501035_0008122 3300049822 Bacteria 9782
405 Ga0501035_0192314 3300049822 Bacteria 1754
406 Ga0501035_1359303 3300049822 Bacteria 546
407 Ga0501044_0229188 3300049823 Bacteria 1806
408 Ga0501045_0002595 3300049824 Bacteria 12330
409 Ga0501045_0089339 3300049824 Bacteria 2276
410 Ga0501045_0208573 3300049824 Bacteria 1455
411 Ga0501045_0253023 3300049824 Bacteria 1311
412 Ga0501045_0258333 3300049824 Bacteria 1296
413 nmdc:mga05p37_1163249_c1 3300050507 Bacteria 801
414 nmdc:mga05p37_487953_c1 3300050507 Bacteria 1417
415 nmdc:mga05p37_489052_c1 3300050507 Bacteria 1415
416 nmdc:mga05p37_514075_c1 3300050507 Bacteria 1371
417 nmdc:mga05p37_543435_c1 3300050507 Bacteria 1324
418 nmdc:mga05p37_827954_c1 3300050507 Bacteria 1008
419 nmdc:mga05p37_896406_c1 3300050507 Bacteria 957
420 nmdc:mga05p37_960894_c1 3300050507 Bacteria 913
421 nmdc:mga09592_104022_c1 3300050508 Bacteria 2433
422 nmdc:mga09592_357107_c1 3300050508 Bacteria 1265
423 nmdc:mga09592_64977_c1 3300050508 Bacteria 3090
424 nmdc:mga09592_755656_c1 3300050508 Bacteria 825
425 nmdc:mga0qj67_15517_c1 3300050509 Bacteria 5767
426 nmdc:mga0qj67_270589_c1 3300050509 Bacteria 1378
427 nmdc:mga0qj67_31664_c1 3300050509 Bacteria 4122
428 nmdc:mga0qj67_343078_c1 3300050509 Bacteria 1208
429 nmdc:mga0qj67_78653_c1 3300050509 Bacteria 2640
430 nmdc:mga0qj67_996181_c1 3300050509 Bacteria 658
431 nmdc:mga06r32_144755_c1 3300050510 Bacteria 2354
432 nmdc:mga06r32_254271_c1 3300050510 Bacteria 1745
433 nmdc:mga06r32_264333_c1 3300050510 Bacteria 1708
434 nmdc:mga06r32_433191_c1 3300050510 Bacteria 1296
435 nmdc:mga06r32_584398_c1 3300050510 Unclassified 1089
436 nmdc:mga08y16_108566_c1 3300050511 Bacteria 2889
437 nmdc:mga08y16_67457_c1 3300050511 Bacteria 3732
438 nmdc:mga08y16_91842_c1 3300050511 Bacteria 3164
439 nmdc:mga0rr50_153369_c1 3300050513 Bacteria 1864
440 nmdc:mga0rr50_22846_c1 3300050513 Bacteria 4300
441 nmdc:mga0rr50_2724_c1 3300050513 Bacteria 10019
442 nmdc:mga08x19_1344316_c1 3300050514 Bacteria 506
443 nmdc:mga08x19_188105_c1 3300050514 Bacteria 1412
444 nmdc:mga08x19_22430_c1 3300050514 Bacteria 3910
445 nmdc:mga08x19_8903_c1 3300050514 Bacteria 5989
446 nmdc:mga0a205_151261_c1 3300050515 Bacteria 1780
447 Ga0501084_0000536 3300054114 Bacteria 28960
448 Ga0501084_0024980 3300054114 Bacteria 4986
449 Ga0501084_0090725 3300054114 Bacteria 2566
450 Ga0501084_0264556 3300054114 Bacteria 1452
451 Ga0590071_011376 3300059421 Bacteria 2083
452 Ga0590071_167516 3300059421 Unclassified 573
453 Ga0590077_003589 3300059426 Bacteria 3204
454 Ga0501082_0000678 3300060353 Bacteria 29983
455 Ga0501082_0017450 3300060353 Bacteria 6184
456 Ga0501082_0151610 3300060353 Bacteria 2014
457 Ga0501082_0690035 3300060353 Bacteria 894
458 Ga0466962_0268260 3300061719 Bacteria 841
459 Ga0530510_0000309 3300061734 Bacteria 31225
460 Ga0530510_0000325 3300061734 Bacteria 30731
461 Ga0530510_1112969 3300061734 Bacteria 605
462 Ga0451577_1019471
463 JGI25406J46586_10054151
464 Ga0065707_10117069
465 Ga0070690_100300168
466 Ga0070670_100398279
467 Ga0068869_100175504
468 Ga0070680_100008758
469 Ga0070680_100422743
470 Ga0070680_101009610
471 Ga0070680_101902033
472 Ga0068868_101234789
473 Ga0070691_10236802
474 Ga0070692_10003445
475 Ga0070692_10024998
476 Ga0070668_100023286
477 Ga0070669_100000467
478 Ga0070669_100754518
479 Ga0070669_101048764
480 Ga0070675_100942050
481 Ga0070671_100923099
482 Ga0070671_101416915
483 Ga0070674_100113483
484 Ga0070673_100232474
485 Ga0070673_102040066
486 Ga0070688_100836472
487 Ga0070688_101234058
488 Ga0070703_10116577
489 Ga0070709_11667240
490 Ga0070714_100188959
491 Ga0070710_10194573
492 Ga0070701_10106343
493 Ga0070701_10467503
494 Ga0070701_10938975
495 Ga0070711_100807428
496 Ga0070705_100004773
497 Ga0070705_100039818
498 Ga0070700_100050041
499 Ga0070700_100156791
500 Ga0070694_100055822
501 Ga0070694_100059887
502 Ga0070662_100265113
503 Ga0070681_11240910
504 Ga0068867_100001691
505 Ga0068867_100830000
506 Ga0068867_101347984
507 Ga0070706_100250744
508 Ga0070707_100630069
509 Ga0070707_101292006
510 Ga0070699_100055844
511 Ga0070679_101230537
512 Ga0070684_100305544
513 Ga0070697_100164693
514 Ga0070672_100063363
515 Ga0070672_101985611
516 Ga0070686_100621338
517 Ga0070686_101394594
518 Ga0070695_100033229
519 Ga0070695_100531691
520 Ga0070696_100010529
521 Ga0070696_100019424
522 Ga0070696_100164022
523 Ga0070693_100306273
524 Ga0070693_101023955
525 Ga0070704_100005221
526 Ga0070704_100417137
527 Ga0070704_100800509
528 Ga0070704_101051418
529 Ga0070704_102289045
530 Ga0068857_100206621
531 Ga0068854_101405474
532 Ga0070702_100106333
533 Ga0070702_101455040
534 Ga0068859_101832245
535 Ga0068861_100004621
536 Ga0068861_100531071
537 Ga0068861_102032032
538 Ga0068870_10075533
539 Ga0068858_100701048
540 Ga0068858_101098420
541 Ga0068862_100003507
542 Ga0068862_100251222
543 Ga0068862_101736789
544 Ga0081538_10171087
545 Ga0081539_10000308
546 Ga0070712_101922996
547 Ga0097621_100023431
548 Ga0068871_100007009
549 Ga0068871_102071724
550 Ga0075428_100044560
551 Ga0075428_100100908
552 Ga0075428_102234742
553 Ga0075428_102322646
554 Ga0075430_100022058
555 Ga0075430_100442467
556 Ga0075430_100467091
557 Ga0075431_100086086
558 Ga0075431_100215757
559 Ga0075431_100854079
560 Ga0075431_101394328
561 Ga0075433_10110134
562 Ga0075429_101543606
563 Ga0075436_100000267
564 Ga0075436_100007473
565 Ga0075436_100037978
566 Ga0075436_100600702
567 Ga0097620_101832598
568 Ga0075435_100071178
569 Ga0075435_100135625
570 Ga0111539_10012064
571 Ga0111539_10072086
572 Ga0111539_10120281
573 Ga0111539_12519346
574 Ga0114129_10129751
575 Ga0114129_10246420
576 Ga0114129_10451856
577 Ga0114129_10891821
578 Ga0114129_11166209
579 Ga0114129_11446304
580 Ga0114129_11695309
581 Ga0114129_12665199
582 Ga0105243_10015030
583 Ga0105243_11024558
584 Ga0105242_12360224
585 Ga0105246_10878497
586 Ga0157378_13302743
587 Ga0157375_10724474
588 Ga0157380_10004024
589 Ga0157377_11412454
590 Ga0157376_10029558
591 Ga0207642_11127985
592 Ga0207645_10024689
593 Ga0207645_10289251
594 Ga0207643_10044372
595 Ga0207643_10302080
596 Ga0207684_10137251
597 Ga0207663_11448284
598 Ga0207660_10135341
599 Ga0207660_10228067
600 Ga0207662_10040537
601 Ga0207652_10429247
602 Ga0207646_11428318
603 Ga0207681_10013063
604 Ga0207681_10301611
605 Ga0207650_10648251
606 Ga0207659_10750430
607 Ga0207664_10230970
608 Ga0207644_10803393
609 Ga0207644_10933223
610 Ga0207706_10156613
611 Ga0207686_10723307
612 Ga0207709_10001903
613 Ga0207669_10160540
614 Ga0207704_10000792
615 Ga0207704_11347403
616 Ga0207665_10934693
617 Ga0207665_11637486
618 Ga0207691_10072785
619 Ga0207691_10578378
620 Ga0207689_10102148
621 Ga0207651_10050987
622 Ga0207712_10004418
623 Ga0207668_10011137
624 Ga0207640_11574581
625 Ga0207677_12124036
626 Ga0207703_10177118
627 Ga0207708_10000647
628 Ga0207708_10119715
629 Ga0207708_10996584
630 Ga0207648_10001065
631 Ga0207648_10211566
632 Ga0207648_11140050
633 Ga0207674_10311681
634 Ga0207675_100004290
635 Ga0207675_100339387
636 Ga0207675_100789043
637 Ga0207683_10778630
638 Ga0209969_1016244
639 Ga0209967_1008885
640 Ga0209967_1019891
641 Ga0209981_1015843
642 Ga0209981_1041615
643 Ga0209996_1024961
644 Ga0210000_1006854
645 Ga0210000_1007261
646 Ga0210000_1013174
647 Ga0209995_1081607
648 Ga0209968_1004774
649 Ga0209968_1037447
650 Ga0209968_1040596
651 Ga0209999_1000286
652 Ga0209970_1060076
653 Ga0209971_1025360
654 Ga0209971_1080721
655 Ga0209966_1122686
656 Ga0209974_10134308
657 Ga0209974_10224965
658 Ga0207428_10142924
659 Ga0207428_10249264
660 Ga0268265_10001976
661 Ga0268265_12384991
662 Ga0307408_100222599
663 Ga0307408_100374860
664 Ga0307408_100421441
665 Ga0307408_101392274
666 Ga0316575_10006424
667 Ga0307405_10886344
668 Ga0307405_10902065
669 Ga0307405_11403022
670 Ga0307413_12193518
671 Ga0307410_10540140
672 Ga0307410_10566007
673 Ga0307410_10869753
674 Ga0307407_10679167
675 Ga0307407_10988837
676 Ga0307407_11236044
677 Ga0307412_10131450
678 Ga0307412_10596227
679 Ga0307412_10980146
680 Ga0307409_100364764
681 Ga0307416_100030684
682 Ga0307416_100081683
683 Ga0307416_100138597
684 Ga0307416_100395761
685 Ga0307416_100630412
686 Ga0307416_101421351
687 Ga0307411_10996289
688 Ga0307411_11001207
689 Ga0307411_11508004
690 Ga0307411_12224680
691 Ga0307415_100836582
692 Ga0307415_102594994
693 Ga0373948_0079464
694 Ga0373938_0066771
695 Ga0373923_0219262
696 Ga0373936_0158571
697 Ga0373941_0327561
698 Ga0373953_0003931
699 Ga0373956_0027509
700 Ga0373957_0288653
701 Ga0373960_0048394
702 Ga0373955_0016147
703 Ga0373942_0220176
704 Ga0373962_0085270
705 Ga0316574_0071620
706 Ga0373924_0029200
707 Ga0373931_0185718
708 Ga0373931_1148061
709 Ga0373927_0539839
710 Ga0373933_0006179
711 Ga0373937_0007981
712 Ga0439461_0002149
713 Ga0439466_0198068
714 Ga0451800_0254829
715 Ga0451804_0759087
716 Ga0451807_0472921
717 Ga0451849_1270827
718 Ga0439441_008621
719 Ga0439441_147671
720 Ga0439443_060650
721 Ga0439445_0255804
722 Ga0439456_093810
723 Ga0439463_103751
724 Ga0450923_137499
725 Ga0450894_047304
726 Ga0439446_0002540
727 Ga0439434_0001248
728 Ga0439435_0000135
729 Ga0439435_0000260
730 Ga0439435_0091934
731 Ga0439444_0003169
732 Ga0439444_0089933
733 Ga0439460_0004028
734 Ga0439460_0004653
735 Ga0466963_0405727
736 Ga0466968_0572495
737 Ga0466957_0755790
738 Ga0466960_0065825
739 Ga0466960_0387184
740 Ga0451576_0050160
741 Ga0466967_0052902
742 Ga0495662_0350472
743 Ga0495664_0586858
744 Ga0495584_0088164
745 Ga0495652_0280673
746 Ga0495598_0075412
747 Ga0495598_0186948
748 Ga0495598_0304106
749 Ga0495598_0388971
750 Ga0495598_0427336
751 Ga0495621_0509328
752 Ga0495667_0299443
753 Ga0495659_0542591
754 Ga0495669_0056645
755 Ga0495680_0339467
756 Ga0495675_0746645
757 Ga0501291_118590
758 Ga0501292_048052
759 Ga0501292_142013
760 Ga0501293_025183
761 Ga0501298_051154
762 Ga0501298_118526
763 Ga0501298_140924
764 Ga0501298_160138
765 Ga0501031_0059653
766 Ga0501031_0490430
767 Ga0501032_0858996
768 Ga0501033_0004615
769 Ga0501033_0661534
770 Ga0501034_0271198
771 Ga0501036_0000578
772 Ga0501036_0166286
773 Ga0501036_0184202
774 Ga0501036_1365359
775 Ga0501037_0004062
776 Ga0501037_0109111
777 Ga0501037_0663776
778 Ga0501038_0000612
779 Ga0501038_0125802
780 Ga0501038_0850393
781 Ga0501039_0000577
782 Ga0501039_0055761
783 Ga0501039_0081664
784 Ga0501039_1104771
785 Ga0501040_0000523
786 Ga0501040_0001442
787 Ga0501040_0004203
788 Ga0501040_0205865
789 Ga0501040_0256809
790 Ga0501040_0676969
791 Ga0501040_1051566
792 Ga0501041_0000488
793 Ga0501041_0008774
794 Ga0501041_0009696
795 Ga0501041_0043467
796 Ga0501042_0019568
797 Ga0501042_0178452
798 Ga0501042_0215563
799 Ga0501042_0591158
800 Ga0501042_0936462
801 Ga0501043_0131050
802 Ga0501043_0307516
803 Ga0501046_0000987
804 Ga0501046_0043598
805 Ga0501046_0224385
806 Ga0501048_0001320
807 Ga0501048_0084433
808 Ga0501048_0248177
809 Ga0501048_0716865
810 Ga0501067_0478073
811 Ga0501067_0660786
812 Ga0501068_0010621
813 Ga0501068_0628570
814 Ga0501069_0255894
815 Ga0501070_0143329
816 Ga0501071_0005706
817 Ga0501071_0173998
818 Ga0501071_1253620
819 Ga0501071_1466607
820 Ga0501072_0002390
821 Ga0501072_0003229
822 Ga0501072_0154583
823 Ga0501072_0186518
824 Ga0501072_1105307
825 Ga0501073_0166383
826 Ga0501074_0284541
827 Ga0501074_1177912
828 Ga0501075_0000175
829 Ga0501075_0011507
830 Ga0501075_0082870
831 Ga0501075_0424036
832 Ga0501075_0914308
833 Ga0501076_0000588
834 Ga0501076_0001233
835 Ga0501076_0647068
836 Ga0501076_1577791
837 Ga0501076_1583598
838 Ga0501077_0002511
839 Ga0501077_0236977
840 Ga0501077_0315858
841 Ga0501077_0557764
842 Ga0501217_175796
843 Ga0501227_178788
844 Ga0501235_075307
845 Ga0501249_074485
846 Ga0501249_151639
847 Ga0501250_108218
848 Ga0501221_139534
849 Ga0501225_0353484
850 Ga0501079_0000215
851 Ga0501079_0362381
852 Ga0501079_1048950
853 Ga0501080_0092284
854 Ga0501080_0115297
855 Ga0501080_0418959
856 Ga0501080_1405439
857 Ga0501081_0000103
858 Ga0501081_0041687
859 Ga0501081_0219847
860 Ga0501081_0998670
861 Ga0501083_0143993
862 Ga0501278_011598
863 Ga0501279_082072
864 Ga0501283_092282
865 Ga0501035_0008122
866 Ga0501035_0192314
867 Ga0501035_1359303
868 Ga0501044_0229188
869 Ga0501045_0002595
870 Ga0501045_0089339
871 Ga0501045_0208573
872 Ga0501045_0253023
873 Ga0501045_0258333
874 nmdc:mga05p37_1163249_c1
875 nmdc:mga05p37_487953_c1
876 nmdc:mga05p37_489052_c1
877 nmdc:mga05p37_514075_c1
878 nmdc:mga05p37_543435_c1
879 nmdc:mga05p37_827954_c1
880 nmdc:mga05p37_896406_c1
881 nmdc:mga05p37_960894_c1
882 nmdc:mga09592_104022_c1
883 nmdc:mga09592_357107_c1
884 nmdc:mga09592_64977_c1
885 nmdc:mga09592_755656_c1
886 nmdc:mga0qj67_15517_c1
887 nmdc:mga0qj67_270589_c1
888 nmdc:mga0qj67_31664_c1
889 nmdc:mga0qj67_343078_c1
890 nmdc:mga0qj67_78653_c1
891 nmdc:mga0qj67_996181_c1
892 nmdc:mga06r32_144755_c1
893 nmdc:mga06r32_254271_c1
894 nmdc:mga06r32_264333_c1
895 nmdc:mga06r32_433191_c1
896 nmdc:mga06r32_584398_c1
897 nmdc:mga08y16_108566_c1
898 nmdc:mga08y16_67457_c1
899 nmdc:mga08y16_91842_c1
900 nmdc:mga0rr50_153369_c1
901 nmdc:mga0rr50_22846_c1
902 nmdc:mga0rr50_2724_c1
903 nmdc:mga08x19_1344316_c1
904 nmdc:mga08x19_188105_c1
905 nmdc:mga08x19_22430_c1
906 nmdc:mga08x19_8903_c1
907 nmdc:mga0a205_151261_c1
908 Ga0501084_0000536
909 Ga0501084_0024980
910 Ga0501084_0090725
911 Ga0501084_0264556
912 Ga0590071_011376
913 Ga0590071_167516
914 Ga0590077_003589
915 Ga0501082_0000678
916 Ga0501082_0017450
917 Ga0501082_0151610
918 Ga0501082_0690035
919 Ga0466962_0268260
920 Ga0530510_0000309
921 Ga0530510_0000325
922 Ga0530510_1112969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

17

78

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxs-assembly1.cif.gz_X crystal structure of a copper binding domain from hma7, a p-type atpase 0.9917 1 68
3dxs-assembly1.cif.gz_X crystal structure of a copper binding domain from hma7, a p-type atpase 0.9775 1 68
2qif-assembly1.cif.gz_A crystal structure of a metallochaperone with a tetranuclear cu(i) cluster 0.9753 1 68
4a4j-assembly1.cif.gz_A crosstalk between cu(i) and zn(ii) homeostasis 0.9721 1 68
6ff2-assembly1.cif.gz_B copz metallochaperone 0.9704 2 68
ID Description Score Start End Superfamily
af_A0A0N7KES2_46_116_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9978 2 68 3.30.70.100
af_I1JA65_34_107_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9933 2 68 3.30.70.100
af_Q5AG51_176_245_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9912 2 67 3.30.70.100
af_Q59385_102_164_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9848 6 68 3.30.70.100
af_P38995_81_152_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9841 5 68 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1F3ZLV0-F1-model_v4 Heavy metal transporter 1.005 1 68 GO:0046872
AF-A0A3A5ARY0-F1-model_v4 Cation-translocating P-type ATPase 1.002 3 67 GO:0005507
GO:0016020
GO:0043682
GO:0055070
AF-A0A355B2P8-F1-model_v4 Copper resistance protein CopZ 1.001 1 68 GO:0046872
AF-A0A7J5EGL0-F1-model_v4 Heavy-metal-associated domain-containing protein 1.001 2 68 GO:0046872
AF-A0A1F7TES7-F1-model_v4 HMA domain-containing protein 1.001 1 66 GO:0046872

Map